diff -Nurpa binutils-2.13/bfd/ChangeLog binutils-2.13.1/bfd/ChangeLog --- binutils-2.13/bfd/ChangeLog 2002-08-05 16:45:24.000000000 -0400 +++ binutils-2.13.1/bfd/ChangeLog 2002-11-07 17:32:15.000000000 -0500 @@ -1,3 +1,628 @@ +2002-11-07 Daniel Jacobowitz + + * configure.in: Bump version and set is_release. + * configure: Regenerate. + +2002-11-07 Nick Clifton + + * po/da.po: Updated Danish translation. + +2002-11-07 Graeme Peterson + + * Makefile.am: Removed entries for elf32-i386qnx.c and + elf32-i386qnx.lo. + * Makefile.in: Regenerate. + * config.bfd: Changed i[3456]86-*-nto-qnx* targ_defvec from + bfd_elf32_i386qnx_vec to bfd_elf32_i386_vec. + * configure.in: Removed support for bfd_elf32_i386qnx_vec. + * configure: Regenerate. + * elf32-i386qnx.c: Removed. + * elf.c: Removed calls to QNX specific set_nonloadable_filepos, + is_contained_by_filepos, and copy_private_bfd_data_p. + * elf32-i386.c: Removed QNX specific #ifdef ELF32_I386_C_INCLUDED. + * targets.c: Removed bfd_elf32_i386qnx_vec. + * elfxx-target.h: Removed QNX specific elf_backend_set_nonloadable_filepos, + elf_backend_is_contained_by_filepos, and elf_backend_copy_private_bfd_data_p. + * elf-bfd.h: Removed QNX specific set_nonloadable_filepos, + is_contained_by_filepos, and copy_private_bfd_data_p. + +2002-11-06 David O'Brien + Alan Modra + + * elf64-sparc.c (sparc64_elf_relocate_section): Adjust addend of + dynamic relocs against section symbols for the output section vma. + +2002-11-05 Elias Athanasopoulos + + * vms-gsd.c (_bfd_vms_write_gsd): Check that symbol->udata.p is + non-NULL before dereferencing. + +2002-11-04 Kaz Kojima + + * vms.c (vms_object_p): Restore the start address when returning + NULL. + +2002-10-31 David O'Brien + + * elf-eh-frame.c (_bfd_elf_discard_section_eh_frame): Don't mix + signed and unsigned in comparison. + +2002-10-30 Daniel Jacobowitz + + * bfd-in2.h: Regenerated. + * po/SRC-POTFILES.in: Regenerated. + * po/bfd.pot: Regenerated. + +2002-10-30 Daniel Jacobowitz + + * coffcode.h: Remove extraneous '\'. + +2002-10-28 Daniel Jacobowitz + + Merge from mainline: + 2002-10-24 John David Anglin + * aoutx.h (NAME(aout,swap_ext_reloc_in)): Cast bytes->r_index to + unsigned int. Cast RELOC_BASE10, RELOC_BASE13 and RELOC_BASE22 to + unsigned int. + (NAME(aout,final_link)): Cast enum used in assignment. + (aout_link_write_symbols): Cast enums in comparisons, int values to + boolean, enums in assignments to int. + (aout_link_input_section_std): Cast rel->r_index to unsigned int. + (aout_link_input_section_ext): Likewise. Cast enums used in comparisons + with unsigned ints. + (aout_link_reloc_link_order): Cast enum to int in assignment. + * archive.c (_bfd_generic_read_ar_hdr_mag): Cast result of memchr + calls to char *. + * bfd-in.h (bfd_set_section_vma): Cast enum true to unsigned int in + assignment. + * bfd-in2.h (bfd_set_section_vma): Likewise. + * bfd.c (bfd_record_phdr): Cast enums in assignments. + * binary.c (bfd_alloc): Cast enum to long. + * coffgen.c (_bfd_coff_is_local_label_name): Cast return to boolean. + * dwarf2.c (read_abbrevs): Add casts to enum types. + (read_attribute_value): Likewise. + (arange_add): Cast result of bfd_zalloc call. + (comp_unit_contains_address): Return true and false. + (comp_unit_find_nearest_line): Cast return to boolean. + * format.c (bfd_check_format_matches, bfd_set_format): Likewise. + * gen-aout.c: define macro '_' if not defined. + * libbfd.c (bfd_realloc): Cast malloc and realloc to PTR. + (bfd_bwrite): Cast bfd_realloc to bfd_byte *. + (bfd_write_bigendian_4byte_int): Cast return to boolean. + (bfd_seek): Cast bfd_realloc to bfd_byte *. + (bfd_generic_is_local_label_name): Cast return to boolean. + * libcoff.h (_bfd_coff_adjust_symndx): Remove extraneous '\'. + * linker.c (_bfd_link_hash_newfunc): Cast bfd_hash_allocate result to + struct bfd_hash_entry *. + (_bfd_generic_link_hash_newfunc): likewise. + (_bfd_generic_final_link): Cast enum to unsigned int. + * merge.c (sec_merge_emit): Cast return to boolean. + (merge_strings): Add casts to const unsigned char *. + * reloc.c (bfd_get_reloc_code_name): Cast enums in comparison to int. + (bfd_generic_get_relocated_section_content): Cast enum to unsigned int. + * section.c (bfd_section_hash_newfunc): Cast bfd_hash_allocate result to + struct bfd_hash_entry *. + (bfd_set_section_content): Add cast to PTR in comparison. + * srec.c (S3Forced): Initialize to false. + (srec_get_symtab): Cast return value from bfd_alloc to asymbol *. + * stabs.c (_bfd_link_section_stabs): Cast enum to int in comparisons. + (_bfd_discard_section_stabs): Likewise. Also cast return to boolean. + * syms.c (bfd_is_undefined_symclass): Cast return to boolean. + (_bfd_stab_section_find_nearest_line): Cast enum to bfd_byte in + comparisons. + + 2002-10-23 Jakub Jelinek + * elf64-alpha.c (elf64_alpha_check_relocs): Only put maybe_dynamic + relocs into shared lib non-allocated reloc sections. + + 2002-10-23 Nathan Tallent + * dwarf2.c (add_line_info): Ensure that the line_info_table is + sorted even when given an out-of-order line sequence. + (lookup_address_in_line_info_table): When an exact VMA match is + not found, return line information with the closest VMA. + + 2002-10-21 Alan Modra + * targets.c (bfd_target_list): Don't return the default target twice. + + 2002-10-19 H.J. Lu + * elflink.h (elf_link_add_object_symbols): Correctly handle + DT_RPATH and DT_RUNPATH. + + 2002-10-16 Jakub Jelinek + * config.bfd (s390-*-linux*): Add targ64_selvecs. + (s390x-*-linux*): Add targ_selvecs. + + 2002-10-16 Alan Modra + * elflink.h (elf_link_add_object_symbols): Error out on dynamic objects + loaded with --just-symbols. + + * elf32-i386qnx.c (TARGET_LITTLE_NAME): Define. + + 2002-10-14 Kaz Kojima + * config.bfd (sh*eb-*-linux*, sh*-*-linux*): Add the alternative + endian vector to targ_selvecs. + + 2002-10-08 H.J. Lu + * elf32-i386.c (elf_i386_relocate_section): Re-arrange the + IE->LE transition for R_386_TLS_IE. + + 2002-10-07 Mark Elbrecht + * cofflink.c (mark_relocs): Don't mark relocations in excluded + sections. + + 2002-10-05 Alexandre Oliva + * elfxx-mips.c (mips_elf_create_dynamic_relocation): Set the type + of the other two relocations packed with a REL32 to NONE. + + 2002-10-02 Stephen Clarke + * elf32-sh.c (elf_sh_link_hash_entry): Add gotplt_refcount. + (sh_elf_link_hash_newfunc): Initialize it. + (allocate_dynrelocs): Transfer gotplt refs from plt.refcount + to got.refcount for symbols that are forced local or when + we have direct got refs. + (sh_elf_gc_sweep_hook): Adjust gotplt_refcount. Use it + to correctly adjust got.refcount and plt.refcount. + (sh_elf_copy_indirect_symbol): Copy gotplt_refcount across. + (sh_elf_check_relocs): Increment gotplt_refcount. + + 2002-10-01 Jakub Jelinek + * elf32-i386.c (elf_i386_relocate_section): Fix + movl foo@indntpoff, %eax IE->LE transition. + + 2002-09-28 Jason Thorpe + * elf32-vax.c (elf_vax_size_dynamic_section): Don't strip + .got sections. + + 2002-09-27 Matt Thomas + * elf32-vax.c (elf_vax_check_relocs): Remove unused + local_got_refcounts usage. Remove allocation of got slot. + (elf_vax_gc_sweep_hook): Remove unused local_got_refcounts usage. + Remove de-allocation of got slot. + (elf_vax_size_dynamic_section): Fix some indentation. Add hash + traversal for elf_vax_instantiate_got_entries. Allow empty .got + sections to be GC'ed. + (elf_vax_instantiate_got_entries): New function. + (elf_vax_relocate_section): Simplify R_VAX_GOT32 handling. Remove + tests that are now handled by elf_vax_instantiate_got_entries. + Assert GOT entry falls within .got section size. Remove redundant + comparisions. Fix comments. + + 2002-09-24 Jakub Jelinek + * elf32-sparc.c (elf32_sparc_relocate_section): Put R_SPARC_RELATIVE + addend into r_addend, not *r_offset. + (elf32_sparc_finish_dynamic_symbol): Likewise. + * elf64-sparc.c (sparc64_elf_finish_dynamic_symbol): Clear xword at + R_SPARC_RELATIVE's r_offset. + + 2002-08-07 Thiemo Seufer + * elfxx-mips.c (mips_elf_create_dynamic_relocation): Cast signedness + mismatch. + +2002-10-14 Richard Henderson + + * elf64-alpha.c (elf64_alpha_relocate_section) [BRSGP]: Increment + VALUE, not ADDEND. + +2002-10-11 Alan Modra + + * coff-arm.c (record_arm_to_thumb_glue): Avoid type-punned pointers. + (record_thumb_to_arm_glue): Likewise. + * ecoff.c (ecoff_link_add_externals): Likewise. + * elf32-arm.h (record_arm_to_thumb_glue): Likewise. + (record_thumb_to_arm_glue): Likewise. + * elf32-m32r.c (m32r_elf_add_symbol_hook): Likewise. + * elf32-sh.c (sh_elf_create_dynamic_sections): Likewise. + * elf32-sh64.c (sh64_elf_add_symbol_hook): Likewise. + * elf64-alpha.c (elf64_alpha_create_dynamic_sections): Likewise. + * elf64-ppc.c (func_desc_adjust): Likewise. + * elf64-sh64.c (sh64_elf64_add_symbol_hook): Likewise. + (sh64_elf64_create_dynamic_sections): Likewise. + * elflink.c (_bfd_elf_create_got_section): Likewise. + (_bfd_elf_create_dynamic_sections): Likewise. + (_bfd_elf_create_linker_section): Likewise. + * elflink.h (elf_add_default_symbol): Likewise. + (elf_link_create_dynamic_sections): Likewise. + (NAME(bfd_elf,size_dynamic_sections)): Likewise. + * elfxx-ia64.c (elfNN_ia64_aix_add_symbol_hook): Likewise. + * elfxx-mips.c (mips_elf_create_got_section): Likewise. + (_bfd_mips_elf_add_symbol_hook): Likewise. + (_bfd_mips_elf_create_dynamic_sections): Likewise. + * linker.c (generic_link_add_symbol_list): Likewise. + * xcofflink.c (xcoff_link_add_symbols): Likewise. + + * elfxx-ia64.c (oor_brl, oor_ip): Conditionally define. + + * elf64-ppc.c (edit_opd): Only zero opd syms when function is + completely removed. Correct local sym adjustment. + +2002-10-08 Alan Modra + + * elf64-ppc.c (edit_opd): Correct test for discarded sections. + +2002-10-07 Alan Modra + + * elflink.h (elf_link_input_bfd): Remove BFD_VERSION_DATE dependent + code. + + * elf64-ppc.c (ppc64_elf_build_stubs): Increment .glink indx. + +2002-09-28 Alan Modra + + * elf.c (map_sections_to_segments): Correct test for start of + writable section in the same page as end of read-only section. + +2002-09-26 Alan Modra + + * elf64-ppc.c (ppc_build_one_stub): Don't build glink stubs here. + (ppc64_elf_build_stubs): Build them here instead. + +2002-09-23 Daniel Jacobowitz + + Merge from mainline: + 2002-09-23 Alan Modra + * elf-eh-frame.c (_bfd_elf_discard_section_eh_frame): Zero relocs + for discarded FDEs. Remove redundant assignment. + * elflink.h (elf_bfd_discard_info): Save edited relocs. + + 2002-09-23 Nathan Tallent + * dwarf2.c (decode_line_info): Update to correctly decode + the (non-standard DWARF2) out-of-order address sequences + generated by the Intel C++ 6.0 compiler for ia64-Linux. + + 2002-09-22 H.J. Lu + * elf64-alpha.c (elf64_alpha_merge_ind_symbols): Don't merge + the relocation count between different .reloc sections. + + 2002-09-22 Mark Elbrecht + * config.bfd: For DJGPP targets, match with any cpu and any machine. + + 2002-09-21 Alan Modra + * elfcode.h (elf_slurp_reloc_table_from_section): Make "symcount" + unsigned. Move "symcount" assignment out of loop. + + 2002-09-19 Nathan Tallent + * dwarf2.c (_bfd_dwarf2_find_nearest_line): If address length is + zero, set it to 8 for (non-standard) 64-bit DWARF2 formats + (e.g. IRIX64). + + 2002-09-19 Jakub Jelinek + * reloc.c (BFD_RELOC_386_TLS_TPOFF, BFD_RELOC_386_TLS_IE, + BFD_RELOC_386_TLS_GOTIE): Add. + * bfd-in2.h, libbfd.h: Rebuilt. + * elf32-i386.c (elf_howto_table): Add R_386_TLS_TPOFF, R_386_TLS_IE + and R_386_TLS_GOTIE. + (elf_i386_reloc_type_lookup): Handle it. + (struct elf_i386_link_hash_entry): Change tls_type type to unsigned + char instead of enum, change GOT_* into defines. + (GOT_TLS_IE_POS, GOT_TLS_IE_NEG, GOT_TLS_IE_BOTH): Define. + (elf_i386_tls_transition): Handle R_386_TLS_IE and R_386_TLS_GOTIE. + (elf_i386_check_relocs): Likewise. Avoid crash if local symbol is + accessed both as normal and TLS symbol. Move R_386_TLS_LDM and + R_386_PLT32 cases so that R_386_TLS_IE can fall through. + Handle R_386_TLS_LE_32 and R_386_TLS_LE in shared libs. + (elf_i386_gc_sweep_hook): Handle R_386_TLS_IE and R_386_TLS_GOTIE. + Handle R_386_TLS_LE_32 and R_386_TLS_LE in shared libs. + (allocate_dynrelocs): Allocate 2 .got and 2 .rel.got entries if + tls_type is GOT_TLS_IE_BOTH. + (elf_i386_size_dynamic_sections): Likewise. + (elf_i386_relocate_section): Handle R_386_TLS_IE and R_386_TLS_GOTIE. + Handle R_386_TLS_LE_32 and R_386_TLS_LE in shared libs. + (elf_i386_finish_dynamic_symbol): Use tls_type & GOT_TLS_IE to catch + all 4 GOT_TLS_* TLS types. + + 2002-09-18 Daniel Jacobowitz + * elfcode.h (elf_slurp_reloc_table_from_section): Check + correct relocation count. + + 2002-09-17 Daniel Jacobowitz + * bfd-in.h (bfd_get_dynamic_symcount): Define. + * bfd.c (struct _bfd): Add dynsymcount. + * bfd-in2.h: Regenerated. + * elf.c (_bfd_elf_canonicalize_dynamic_symtab): Set + abfd->dynsymcount. + * elfcode.h (elf_slurp_reloc_table_from_section): Check + for overflow. + + 2002-09-17 Alan Modra + * elf64-alpha.c (alpha_elf_size_info): Make static. + + 2002-09-17 Jakub Jelinek + * elf32-ppc.c (ppc_elf_finish_dynamic_symbol): Clear .got word + even if generating R_PPC_RELATIVE reloc. + (ppc_elf_relocate_section): Make sure relocation is performed if + skip == -2. Clear memory at r_offset when creating dynamic + relocation. + + 2002-09-16 David O'Brien + * elf32-i386-fbsd.c: Always label using the EI_OSABI method. + It is benign for FreeBSD < 4.1. Minor reformatting. + * elf64-alpha-fbsd.c: Likewise. + + 2002-09-16 Nathan Tallent + * ecoff.c (_bfd_ecoff_slurp_symbolic_info) : Fix error + reading ECOFF information: 'ioptMax' refers to the actual *size* + of the optimization symtab, not the number of entries. + + 2002-09-16 Jakub Jelinek + * elf_i386_relocate_section (R_386_TLS_TPOFF32): Negate addend. + + 2002-09-13 Daniel Jacobowitz + * elf32-arm.h (elf32_arm_adjust_dynamic_symbol): Update + ELF_LINK_HASH_NEEDS_PLT logic. + + 2002-09-11 Nick Clifton + * po/da.po: New Danish translation file. + * configure.in (LINGUAS): Add 'da'. + * configure: Regenerate. + + 2002-09-11 Jakub Jelinek + * elf32-i386.c (dtpoff_base, tpoff): Don't crash if tls_segment is + NULL. + (elf_i386_relocate_section): Return false after printing error about + unresolvable relocation. + + 2002-09-11 Jeffrey Law + * elf32-h8300.c (elf32_h8_relax_section): Fix typo. + + 2002-09-06 Andrew Haley + * elf.c (_bfd_elf_find_nearest_line): Check functionname_ptr and + line_ptr before deciding we've found a symbol. + + 2002-08-29 John David Anglin + * bfd-in.h (align_power): Cast constants to bfd_vma type. + * bfd-in2.h (align_power): Likewise. + + 2002-08-24 Kaz Kojima + * elf32-sh.c (sh_elf_copy_indirect_symbol): New. + (create_got_section, allocate_dynrelocs, readonly_dynrelocs): + Likewise. + (struct elf_sh_pcrel_relocs_copied): Removed. + (struct elf_sh_dyn_relocs): New. + (struct elf_sh_link_hash_entry): Replace pcrel_relocs_copied + field with dyn_relocs. + (struct elf_sh_link_hash_table): Add short-cuts to get dynamic + sections and sym_sec. + (sh_elf_link_hash_newfunc): Clear dyn_relocs. + (sh_elf_link_hash_table_create): Clear shorts-cuts and sym_sec. + (sh_elf_create_dynamic_sections): Use create_got_section instead + of _bfd_elf_create_got_section. + (sh_elf_check_relocs): Likewise. + (sh_elf_create_dynamic_sections): Use short-cuts to the dynamic + sections. + (sh_elf_adjust_dynamic_symbol, sh_elf_size_dynamic_sections, + sh_elf_relocate_section, sh_elf_check_relocs, + sh_elf_finish_dynamic_symbol, sh_elf_finish_dynamic_sections): + Likewise. + (sh_elf_adjust_dynamic_symbol): Handle nocopyreloc. Keep the + dynamic relocations and avoiding the copy relocation when we + didn't find any dynamic relocations in the section which has + contents or is read-only. + (WILL_CALL_FINISH_DYNAMIC_SYMBOL): New. + (sh_elf_size_dynamic_sections): Don't reset the size of + .rela.got section even if dynamic_sections_created flag is off. + Don't use sh_elf_discard_copies. Scan all input bfd and use + allocate_dynrelocs. Call readonly_dynrelocs to determine + whether we need DT_TEXTREL. + (sh_elf_adjust_dynamic_symbol): Use plt.refcount to determine + whether the symbol was never referred to. + (sh_elf_relocate_section): Use WILL_CALL_FINISH_DYNAMIC_SYMBOL. + (sh_elf_gc_sweep_hook): Fill with the real sweep function. + (sh_elf_check_relocs): Call create_got_section if the short-cut + to .got is null. Increment reference counters only instead of + allocating space on dynamic sections here. Don't conditionalize + uninitialized got.offset value when marking the symbol as a + global offset table entry. Keep relocations for symbols satisfied + by a dynamic library to avoid copy relocations for the symbol. + Set dynobj field of an elf hash table if needed. + (sh_elf_finish_dynamic_sections): Handle null section pointer + correctly. + (elf_backend_copy_indirect_symbol): Defined. + (elf_backend_can_refcount): Defined. + + 2002-08-22 Nick Clifton + * po/tr.po: Updated Turkish translation. + + 2002-08-21 Stephen Clarke + * bfd/elf32-sh.c (sh_elf_size_dynamic_sections): Zero + initialize dynamic section. + * bfd/elf64-sh64.c (sh64_elf64_size_dynamic_sections): + Likewise. + + 2002-08-13 H.J. Lu + * elflink.h (NAME(bfd_elf,size_dynamic_sections): Don't count + definitions in shared objects when checking symbol with + undefined version. + + 2002-08-10 H.J. Lu + * elflink.h (elf_add_default_symbol): Preserve section across + elf_merge_symbol. + + 2002-08-09 Nick Clifton + * po/sv.po: Updated Swedish translation. + + 2002-08-08 Alan Modra + * elflink.h (elf_link_output_extsym): Don't output symbols from + SEC_EXCLUDE sections. + + * aoutx.h (aout_link_write_symbols): Correct handling of warning syms. + + 2002-08-08 H.J. Lu + * elflink.h (elf_add_default_symbol): Don't warn a defintion + overrides an indirect versioned symbol. + + 2002-08-07 Alan Modra + * elf64-ppc.c (edit_opd): Arrange to drop symbols for discarded .opd + entries. + + 2002-08-07 Jakub Jelinek + * elf32-i386.c (elf_i386_relocate_section): Fill in proper addend + for R_386_TLS_TPOFF32 relocs against symndx 0. + + 2002-08-07 Thiemo Seufer + * elfxx-mips.c (mips_elf_global_got_index): Avoid segfault if + g->global_gotsym is NULL. + + 2002-08-06 Alan Modra + * xcofflink.c (xcoff_write_global_symbol): Set n_scnum for abs_section. + + 2002-08-06 Alan Modra + * elf64-ppc.c (ppc64_elf_howto_raw): Zero all src_mask entries. + + 2002-08-06 H.J. Lu + * elflink.h (NAME(bfd_elf,size_dynamic_sections)): Check symbol + with undefined version if needed. + (elf_link_assign_sym_version): Match a default symbol with a + version without definition. No need to hide the default + definition separately. + + 2002-08-06 Alan Modra + * coff-rs6000.c: Formatting fixes. + (xcoff_calculate_relocation): Use PARAMS in declaration. + (xcoff_complain_overflow): Likewise. + (xcoff_ppc_relocate_section): Use old-style function pointer call. + (bfd_xcoff_backend_data): Remove useless comments. + (rs6000coff_vec): Likewise. + (bfd_pmac_xcoff_backend_data): Likewise. + (pmac_xcoff_vec): Likewise. + * coff64-rs6000.c: Formatting fixes. + (xcoff64_calculate_relocation): Use PARAMS in declaration. + (xcoff64_ppc_relocate_section): Use old-style function pointer call. + (bfd_xcoff_backend_data): Remove useless comments. + (rs6000coff64_vec): Likewise. + (bfd_xcoff_aix5_backend_data): Likewise. + (aix5coff64_vec): Likewise. + + 2002-08-06 Alan Modra + * coff-rs6000.c: (xcoff_rtype2howto): Don't place reloc address in + addend. + * coff64-rs6000.c: (xcoff64_rtype2howto): Likewise. + + 2002-08-06 Alan Modra + * coff-rs6000.c (xcoff_howto_table): Revert some of last change to + mask entries. Use complain_overflow_dont for R_REF. + (xcoff_reloc_type_ba): Revert last change. + (xcoff_reloc_type_br): Likewise. + (xcoff_reloc_type_crel): Likewise. + (xcoff_ppc_relocate_section): Likewise. + * coff64-rs6000.c (xcoff64_reloc_type_br): Likewise. + (xcoff64_ppc_relocate_section): Likewise. + (xcoff64_howto_table): Revert some of last change to mask entries. + Use complain_overflow_dont for R_REF. + + * coff-rs6000.c (xcoff_howto_table): Fix src_mask entries. Make all + relocs with bitsize == 16 have size = 1. + (xcoff_reloc_type_ba): Correct src_mask and dst_mask adjustment. + (xcoff_reloc_type_br): Likewise. + (xcoff_reloc_type_crel): Likewise. + (xcoff_ppc_relocate_section): Set up src_mask and dst_mask correctly. + * coff64-rs6000.c (xcoff64_reloc_type_br): Correct src_mask and + dst_mask adjustment. + (xcoff64_ppc_relocate_section): Set up src_mask and dst_mask correctly. + (xcoff64_howto_table): Fix src_mask entries. Make all relocs with + bitsize == 16 have size = 1. + + 2002-07-31 Nick Clifton + * bfd.c (bfd_alt_mach_code): Rename parameter 'index' to + 'alternative' in order to avoid shadowing global symbol of the + same name. + * bfd-in2.h: Regenerate. + * libbfd.h: Regenerate. + * libcoff.h: Regenerate. + + 2002-07-30 Alan Modra + * aoutx.h (some_aout_object_p): Clean up tdata properly on error. + * archive.c (bfd_generic_archive_p): Likewise. + * coff-rs6000.c (_bfd_xcoff_archive_p): Likewise. + (_bfd_xcoff_archive_p): Use bfd_scan_vma in place of strtol. + * coff64-rs6000.c (xcoff64_slurp_armap): Likewise. + (xcoff64_archive_p): Likewise. + (xcoff64_openr_next_archived_file): Likewise. + (xcoff64_archive_p): Clean up tdata properly on error. + * coffgen.c (coff_real_object_p): Likewise. + (coff_object_p): Release filehdr and opthdr. + * ecoff.c (_bfd_ecoff_archive_p): Clean up tdata properly on error. + * ieee.c (ieee_archive_p): Likewise. + * ihex.c (ihex_object_p): Likewise. + (ihex_mkobject): Always allocate tdata. + * peicode.h (pe_ILF_object_p): Release bfd_alloc'd buffer on error. + * srec.c (srec_mkobject): Always allocate tdata. + (srec_object_p): Clean up tdata properly on error. + (symbolsrec_object_p): Likewise. + * versados.c (versados_object_p): Likewise. + * vms-misc.c (_bfd_vms_get_record): Use bfd_malloc instead of malloc, + and bfd_realloc instead of realloc. + (add_new_contents): Use bfd_alloc instead of bfd_malloc for sections. + * vms.c (vms_initialize): Always allocate tdata. Use bfd_alloc in + place of bfd_malloc, simplifying error freeing. Free hash table too. + (vms_object_p): Clean up tdata on error. + (vms_mkobject): Don't complain on stderr if vms_initialize fails. + (vms_close_and_cleanup): Adjust for bfd_alloc use. + + 2002-07-17 Ian Rickards + * dwarf2.c (concat_filename): If we can't establish the directory + just return the filename. + + 2002-07-16 Alan Modra + * elflink.h: Formatting fixes, tidy prototypes. + (elf_link_assign_sym_version): Move common code out of loop. + + 2002-07-04 Bruno Haible + * elf32-i386.c: Don't defined ELF_ARCH etc. if this file is included + by a target variant implementation. + * elf64-alpha.c: Likewise. + * elf32-i386-fbsd.c: New file. + * elf64-alpha-fbsd.c: New file. + * targets.c: Support bfd_elf32_i386_freebsd_vec and + bfd_elf64_alpha_freebsd_vec. + * configure.in: Accept the vectors bfd_elf32_i386_freebsd_vec, + bfd_elf64_alpha_freebsd_vec. + * Makefile.am (BFD32_BACKENDS): Add elf32-i386-fbsd.lo. + (BFD32_BACKENDS_CFILES): Add elf32-i386-fbsd.c. + (BFD64_BACKENDS): Add elf64-alpha-fbsd.lo. + (BFD64_BACKENDS_CFILES): Add elf64-alpha-fbsd.c. + (elf32-i386-fbsd.lo, elf64-alpha-fbsd.lo): Add dependencies. + * config.bfd: For FreeBSD targets, set targ_defvec to a FreeBSD + specific targets. Define OLD_FREEBSD_ABI_LABEL if appropriate. + +2002-09-21 David O'Brien + + Merge from mainline: + 2002-08-17 Andrew Cagney + * elf.c (bfd_elf_get_elf_syms): Change type of `esym' to + `bfd_byte'. + +2002-08-26 Alan Modra + + * coffcode.h (coff_set_arch_mach_hook): Handle W65MAGIC. + +2002-08-22 Alan Modra + + * configure.in: Unset is_release. + * configure: Regenerate. + + * elf-bfd.h (struct elf_backend_data): Add struct elf_backend_data + param to elf_backend_copy_indirect_symbol. + (_bfd_elf_link_hash_copy_indirect): Likewise. + * elflink.h (elf_add_default_symbol, elf_fix_symbol_flags): Adjust + calls to copy_indirect_symbol. + * elf32-hppa.c (elf32_hppa_copy_indirect_symbol): Likewise. + * elf32-i386.c (elf_i386_copy_indirect_symbol): Likewise. + * elf32-s390.c (elf_s390_copy_indirect_symbol): Likewise. + * elf64-ppc.c (ppc64_elf_copy_indirect_symbol): Likewise. + * elf64-s390.c (elf_s390_copy_indirect_symbol): Likewise. + * elf64-x86-64.c (elf64_x86_64_copy_indirect_symbol): Likewise. + * elfxx-ia64.c (elfNN_ia64_hash_copy_indirect): Likewise. + * elfxx-mips.c (_bfd_mips_elf_copy_indirect_symbol): Likewise. + * elfxx-mips.h (_bfd_mips_elf_copy_indirect_symbol): Likewise. + * elf.c (_bfd_elf_link_hash_copy_indirect): Likewise. Properly + test refcounts for "used" values. + +2002-08-15 Hans-Peter Nilsson + + * elf32-cris.c (elf_cris_discard_excess_program_dynamics): Add + missing check for whether the symbol is referenced by DSO before + unexporting it as an unneeded dynamic symbol. + 2002-08-05 Daniel Jacobowitz * configure.in: Bump version, set is_release. diff -Nurpa binutils-2.13/bfd/Makefile.am binutils-2.13.1/bfd/Makefile.am --- binutils-2.13/bfd/Makefile.am 2002-07-01 04:31:52.000000000 -0400 +++ binutils-2.13.1/bfd/Makefile.am 2002-11-07 11:57:31.000000000 -0500 @@ -210,7 +210,7 @@ BFD32_BACKENDS = \ elf32-hppa.lo \ elf32-i370.lo \ elf32-i386.lo \ - elf32-i386qnx.lo \ + elf32-i386-fbsd.lo \ elf32-i860.lo \ elf32-i960.lo \ elf32-ia64.lo \ @@ -367,7 +367,7 @@ BFD32_BACKENDS_CFILES = \ elf32-hppa.c \ elf32-i370.c \ elf32-i386.c \ - elf32-i386qnx.c \ + elf32-i386-fbsd.c \ elf32-i860.c \ elf32-i960.c \ elf32-m32r.c \ @@ -473,6 +473,7 @@ BFD64_BACKENDS = \ efi-app-ia64.lo \ elf64-x86-64.lo \ elf64-alpha.lo \ + elf64-alpha-fbsd.lo \ elf64-hppa.lo \ elf64-ia64.lo \ elf64-gen.lo \ @@ -498,6 +499,7 @@ BFD64_BACKENDS_CFILES = \ efi-app-ia64.c \ elf64-x86-64.c \ elf64-alpha.c \ + elf64-alpha-fbsd.c \ elf64-hppa.c \ elf64-gen.c \ elf64-mips.c \ @@ -1137,7 +1139,7 @@ elf32-i386.lo: elf32-i386.c $(INCDIR)/fi elf-bfd.h $(INCDIR)/elf/common.h $(INCDIR)/elf/internal.h \ $(INCDIR)/elf/external.h $(INCDIR)/elf/i386.h $(INCDIR)/elf/reloc-macros.h \ elf32-target.h -elf32-i386qnx.lo: elf32-i386qnx.c elf32-i386.c $(INCDIR)/filenames.h \ +elf32-i386-fbsd.lo: elf32-i386-fbsd.c elf32-i386.c $(INCDIR)/filenames.h \ $(INCDIR)/bfdlink.h elf-bfd.h $(INCDIR)/elf/common.h \ $(INCDIR)/elf/internal.h $(INCDIR)/elf/external.h $(INCDIR)/elf/i386.h \ $(INCDIR)/elf/reloc-macros.h elf32-target.h @@ -1485,6 +1487,13 @@ elf64-alpha.lo: elf64-alpha.c $(INCDIR)/ $(INCDIR)/coff/sym.h $(INCDIR)/coff/symconst.h $(INCDIR)/coff/ecoff.h \ $(INCDIR)/coff/alpha.h $(INCDIR)/aout/ar.h libcoff.h \ libecoff.h ecoffswap.h elf64-target.h +elf64-alpha-fbsd.lo: elf64-alpha-fbsd.c elf64-alpha.c $(INCDIR)/filenames.h \ + elf-bfd.h $(INCDIR)/elf/common.h $(INCDIR)/elf/internal.h \ + $(INCDIR)/elf/external.h $(INCDIR)/bfdlink.h $(INCDIR)/elf/alpha.h \ + $(INCDIR)/elf/reloc-macros.h $(INCDIR)/coff/internal.h \ + $(INCDIR)/coff/sym.h $(INCDIR)/coff/symconst.h $(INCDIR)/coff/ecoff.h \ + $(INCDIR)/coff/alpha.h $(INCDIR)/aout/ar.h libcoff.h \ + libecoff.h ecoffswap.h elf64-target.h elf64-hppa.lo: elf64-hppa.c $(INCDIR)/alloca-conf.h \ $(INCDIR)/filenames.h elf-bfd.h $(INCDIR)/elf/common.h \ $(INCDIR)/elf/internal.h $(INCDIR)/elf/external.h $(INCDIR)/bfdlink.h \ diff -Nurpa binutils-2.13/bfd/Makefile.in binutils-2.13.1/bfd/Makefile.in --- binutils-2.13/bfd/Makefile.in 2002-07-01 04:31:52.000000000 -0400 +++ binutils-2.13.1/bfd/Makefile.in 2002-11-07 11:57:31.000000000 -0500 @@ -1,6 +1,6 @@ -# Makefile.in generated automatically by automake 1.4-p5 from Makefile.am +# Makefile.in generated automatically by automake 1.4 from Makefile.am -# Copyright (C) 1994, 1995-8, 1999, 2001 Free Software Foundation, Inc. +# Copyright (C) 1994, 1995-8, 1999 Free Software Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. @@ -338,7 +338,7 @@ BFD32_BACKENDS = \ elf32-hppa.lo \ elf32-i370.lo \ elf32-i386.lo \ - elf32-i386qnx.lo \ + elf32-i386-fbsd.lo \ elf32-i860.lo \ elf32-i960.lo \ elf32-ia64.lo \ @@ -496,7 +496,7 @@ BFD32_BACKENDS_CFILES = \ elf32-hppa.c \ elf32-i370.c \ elf32-i386.c \ - elf32-i386qnx.c \ + elf32-i386-fbsd.c \ elf32-i860.c \ elf32-i960.c \ elf32-m32r.c \ @@ -603,6 +603,7 @@ BFD64_BACKENDS = \ efi-app-ia64.lo \ elf64-x86-64.lo \ elf64-alpha.lo \ + elf64-alpha-fbsd.lo \ elf64-hppa.lo \ elf64-ia64.lo \ elf64-gen.lo \ @@ -629,6 +630,7 @@ BFD64_BACKENDS_CFILES = \ efi-app-ia64.c \ elf64-x86-64.c \ elf64-alpha.c \ + elf64-alpha-fbsd.c \ elf64-hppa.c \ elf64-gen.c \ elf64-mips.c \ @@ -929,7 +931,7 @@ maintainer-clean-recursive: dot_seen=no; \ rev=''; list='$(SUBDIRS)'; for subdir in $$list; do \ rev="$$subdir $$rev"; \ - test "$$subdir" != "." || dot_seen=yes; \ + test "$$subdir" = "." && dot_seen=yes; \ done; \ test "$$dot_seen" = "no" && rev=". $$rev"; \ target=`echo $@ | sed s/-recursive//`; \ @@ -1667,7 +1669,7 @@ elf32-i386.lo: elf32-i386.c $(INCDIR)/fi elf-bfd.h $(INCDIR)/elf/common.h $(INCDIR)/elf/internal.h \ $(INCDIR)/elf/external.h $(INCDIR)/elf/i386.h $(INCDIR)/elf/reloc-macros.h \ elf32-target.h -elf32-i386qnx.lo: elf32-i386qnx.c elf32-i386.c $(INCDIR)/filenames.h \ +elf32-i386-fbsd.lo: elf32-i386-fbsd.c elf32-i386.c $(INCDIR)/filenames.h \ $(INCDIR)/bfdlink.h elf-bfd.h $(INCDIR)/elf/common.h \ $(INCDIR)/elf/internal.h $(INCDIR)/elf/external.h $(INCDIR)/elf/i386.h \ $(INCDIR)/elf/reloc-macros.h elf32-target.h @@ -2015,6 +2017,13 @@ elf64-alpha.lo: elf64-alpha.c $(INCDIR)/ $(INCDIR)/coff/sym.h $(INCDIR)/coff/symconst.h $(INCDIR)/coff/ecoff.h \ $(INCDIR)/coff/alpha.h $(INCDIR)/aout/ar.h libcoff.h \ libecoff.h ecoffswap.h elf64-target.h +elf64-alpha-fbsd.lo: elf64-alpha-fbsd.c elf64-alpha.c $(INCDIR)/filenames.h \ + elf-bfd.h $(INCDIR)/elf/common.h $(INCDIR)/elf/internal.h \ + $(INCDIR)/elf/external.h $(INCDIR)/bfdlink.h $(INCDIR)/elf/alpha.h \ + $(INCDIR)/elf/reloc-macros.h $(INCDIR)/coff/internal.h \ + $(INCDIR)/coff/sym.h $(INCDIR)/coff/symconst.h $(INCDIR)/coff/ecoff.h \ + $(INCDIR)/coff/alpha.h $(INCDIR)/aout/ar.h libcoff.h \ + libecoff.h ecoffswap.h elf64-target.h elf64-hppa.lo: elf64-hppa.c $(INCDIR)/alloca-conf.h \ $(INCDIR)/filenames.h elf-bfd.h $(INCDIR)/elf/common.h \ $(INCDIR)/elf/internal.h $(INCDIR)/elf/external.h $(INCDIR)/bfdlink.h \ diff -Nurpa binutils-2.13/bfd/aoutx.h binutils-2.13.1/bfd/aoutx.h --- binutils-2.13/bfd/aoutx.h 2002-06-25 02:21:47.000000000 -0400 +++ binutils-2.13.1/bfd/aoutx.h 2002-10-28 13:45:42.000000000 -0500 @@ -533,7 +533,7 @@ NAME(aout,some_aout_object_p) (abfd, exe obj_aout_sym_hashes (abfd) = NULL; if (! NAME(aout,make_sections) (abfd)) - return NULL; + goto error_ret; obj_datasec (abfd)->_raw_size = execp->a_data; obj_bsssec (abfd)->_raw_size = execp->a_bss; @@ -655,13 +655,13 @@ NAME(aout,some_aout_object_p) (abfd, exe obj_textsec (abfd)->next = obj_datasec (abfd); obj_datasec (abfd)->next = obj_bsssec (abfd); #endif + return result; } - else - { - free (rawptr); - abfd->tdata.aout_data = oldrawptr; - } - return result; + + error_ret: + bfd_release (abfd, rawptr); + abfd->tdata.aout_data = oldrawptr; + return NULL; } /* @@ -2259,8 +2259,8 @@ NAME(aout,swap_ext_reloc_in) (abfd, byte /* now the fun stuff */ if (bfd_header_big_endian (abfd)) { - r_index = ((bytes->r_index[0] << 16) - | (bytes->r_index[1] << 8) + r_index = (((unsigned int) bytes->r_index[0] << 16) + | ((unsigned int) bytes->r_index[1] << 8) | bytes->r_index[2]); r_extern = (0 != (bytes->r_type[0] & RELOC_EXT_BITS_EXTERN_BIG)); r_type = ((bytes->r_type[0] & RELOC_EXT_BITS_TYPE_BIG) @@ -2268,8 +2268,8 @@ NAME(aout,swap_ext_reloc_in) (abfd, byte } else { - r_index = ((bytes->r_index[2] << 16) - | (bytes->r_index[1] << 8) + r_index = (((unsigned int) bytes->r_index[2] << 16) + | ((unsigned int) bytes->r_index[1] << 8) | bytes->r_index[0]); r_extern = (0 != (bytes->r_type[0] & RELOC_EXT_BITS_EXTERN_LITTLE)); r_type = ((bytes->r_type[0] & RELOC_EXT_BITS_TYPE_LITTLE) @@ -2281,9 +2281,9 @@ NAME(aout,swap_ext_reloc_in) (abfd, byte /* Base relative relocs are always against the symbol table, regardless of the setting of r_extern. r_extern just reflects whether the symbol the reloc is against is local or global. */ - if (r_type == RELOC_BASE10 - || r_type == RELOC_BASE13 - || r_type == RELOC_BASE22) + if (r_type == (unsigned int) RELOC_BASE10 + || r_type == (unsigned int) RELOC_BASE13 + || r_type == (unsigned int) RELOC_BASE22) r_extern = 1; if (r_extern && r_index > symcount) @@ -2318,8 +2318,8 @@ NAME(aout,swap_std_reloc_in) (abfd, byte /* now the fun stuff */ if (bfd_header_big_endian (abfd)) { - r_index = ((bytes->r_index[0] << 16) - | (bytes->r_index[1] << 8) + r_index = (((unsigned int) bytes->r_index[0] << 16) + | ((unsigned int) bytes->r_index[1] << 8) | bytes->r_index[2]); r_extern = (0 != (bytes->r_type[0] & RELOC_STD_BITS_EXTERN_BIG)); r_pcrel = (0 != (bytes->r_type[0] & RELOC_STD_BITS_PCREL_BIG)); @@ -2331,8 +2331,8 @@ NAME(aout,swap_std_reloc_in) (abfd, byte } else { - r_index = ((bytes->r_index[2] << 16) - | (bytes->r_index[1] << 8) + r_index = (((unsigned int) bytes->r_index[2] << 16) + | ((unsigned int) bytes->r_index[1] << 8) | bytes->r_index[0]); r_extern = (0 != (bytes->r_type[0] & RELOC_STD_BITS_EXTERN_LITTLE)); r_pcrel = (0 != (bytes->r_type[0] & RELOC_STD_BITS_PCREL_LITTLE)); @@ -3863,7 +3863,7 @@ NAME(aout,final_link) (abfd, info, callb for (p = o->link_order_head; p != NULL; p = p->next) { if (p->type == bfd_indirect_link_order) - p->u.indirect.section->linker_mark = true; + p->u.indirect.section->linker_mark = (unsigned int) true; } } @@ -4186,7 +4186,8 @@ aout_link_write_symbols (finfo, input_bf /* Use the name from the hash table, in case the symbol was wrapped. */ - if (h != NULL) + if (h != NULL + && h->root.type != bfd_link_hash_warning) name = h->root.root.string; /* If this is an indirect or warning symbol, then change @@ -4208,7 +4209,6 @@ aout_link_write_symbols (finfo, input_bf /* If the symbol has already been written out, skip it. */ if (h != (struct aout_link_hash_entry *) NULL - && h->root.type != bfd_link_hash_warning && h->written) { if ((type & N_TYPE) == N_INDR @@ -4412,7 +4412,7 @@ aout_link_write_symbols (finfo, input_bf characters in the symbol names, not including the file numbers in types (the first number after an open parenthesis). */ - if (type == N_BINCL) + if (type == (int) N_BINCL) { struct external_nlist *incl_sym; int nest; @@ -4426,13 +4426,13 @@ aout_link_write_symbols (finfo, input_bf int incl_type; incl_type = H_GET_8 (input_bfd, incl_sym->e_type); - if (incl_type == N_EINCL) + if (incl_type == (int) N_EINCL) { if (nest == 0) break; --nest; } - else if (incl_type == N_BINCL) + else if (incl_type == (int) N_BINCL) ++nest; else if (nest == 0) { @@ -4457,7 +4457,7 @@ aout_link_write_symbols (finfo, input_bf /* If we have already included a header file with the same value, then replace this one with an N_EXCL symbol. */ - copy = ! finfo->info->keep_memory; + copy = (boolean) (! finfo->info->keep_memory); incl_entry = aout_link_includes_lookup (&finfo->includes, name, true, copy); if (incl_entry == NULL) @@ -4485,7 +4485,7 @@ aout_link_write_symbols (finfo, input_bf /* This is a duplicate header file. We must change it to be an N_EXCL entry, and mark all the included symbols to prevent outputting them. */ - type = N_EXCL; + type = (int) N_EXCL; nest = 0; for (incl_sym = sym + 1, incl_map = symbol_map + 1; @@ -4495,7 +4495,7 @@ aout_link_write_symbols (finfo, input_bf int incl_type; incl_type = H_GET_8 (input_bfd, incl_sym->e_type); - if (incl_type == N_EINCL) + if (incl_type == (int) N_EINCL) { if (nest == 0) { @@ -4504,7 +4504,7 @@ aout_link_write_symbols (finfo, input_bf } --nest; } - else if (incl_type == N_BINCL) + else if (incl_type == (int) N_BINCL) ++nest; else if (nest == 0) *incl_map = -1; @@ -4859,8 +4859,8 @@ aout_link_input_section_std (finfo, inpu if (bfd_header_big_endian (input_bfd)) { - r_index = ((rel->r_index[0] << 16) - | (rel->r_index[1] << 8) + r_index = (((unsigned int) rel->r_index[0] << 16) + | ((unsigned int) rel->r_index[1] << 8) | rel->r_index[2]); r_extern = (0 != (rel->r_type[0] & RELOC_STD_BITS_EXTERN_BIG)); r_pcrel = (0 != (rel->r_type[0] & RELOC_STD_BITS_PCREL_BIG)); @@ -4872,8 +4872,8 @@ aout_link_input_section_std (finfo, inpu } else { - r_index = ((rel->r_index[2] << 16) - | (rel->r_index[1] << 8) + r_index = (((unsigned int) rel->r_index[2] << 16) + | ((unsigned int) rel->r_index[1] << 8) | rel->r_index[0]); r_extern = (0 != (rel->r_type[0] & RELOC_STD_BITS_EXTERN_LITTLE)); r_pcrel = (0 != (rel->r_type[0] & RELOC_STD_BITS_PCREL_LITTLE)); @@ -5195,8 +5195,8 @@ aout_link_input_section_ext (finfo, inpu if (bfd_header_big_endian (input_bfd)) { - r_index = ((rel->r_index[0] << 16) - | (rel->r_index[1] << 8) + r_index = (((unsigned int) rel->r_index[0] << 16) + | ((unsigned int) rel->r_index[1] << 8) | rel->r_index[2]); r_extern = (0 != (rel->r_type[0] & RELOC_EXT_BITS_EXTERN_BIG)); r_type = ((rel->r_type[0] & RELOC_EXT_BITS_TYPE_BIG) @@ -5204,8 +5204,8 @@ aout_link_input_section_ext (finfo, inpu } else { - r_index = ((rel->r_index[2] << 16) - | (rel->r_index[1] << 8) + r_index = (((unsigned int) rel->r_index[2] << 16) + | ((unsigned int) rel->r_index[1] << 8) | rel->r_index[0]); r_extern = (0 != (rel->r_type[0] & RELOC_EXT_BITS_EXTERN_LITTLE)); r_type = ((rel->r_type[0] & RELOC_EXT_BITS_TYPE_LITTLE) @@ -5221,16 +5221,16 @@ aout_link_input_section_ext (finfo, inpu /* We are generating a relocateable output file, and must modify the reloc accordingly. */ if (r_extern - || r_type == RELOC_BASE10 - || r_type == RELOC_BASE13 - || r_type == RELOC_BASE22) + || r_type == (unsigned int) RELOC_BASE10 + || r_type == (unsigned int) RELOC_BASE13 + || r_type == (unsigned int) RELOC_BASE22) { /* If we know the symbol this relocation is against, convert it into a relocation against a section. This is what the native linker does. */ - if (r_type == RELOC_BASE10 - || r_type == RELOC_BASE13 - || r_type == RELOC_BASE22) + if (r_type == (unsigned int) RELOC_BASE10 + || r_type == (unsigned int) RELOC_BASE13 + || r_type == (unsigned int) RELOC_BASE22) h = NULL; else h = sym_hashes[r_index]; @@ -5398,9 +5398,9 @@ aout_link_input_section_ext (finfo, inpu relocation = 0; } } - else if (r_type == RELOC_BASE10 - || r_type == RELOC_BASE13 - || r_type == RELOC_BASE22) + else if (r_type == (unsigned int) RELOC_BASE10 + || r_type == (unsigned int) RELOC_BASE13 + || r_type == (unsigned int) RELOC_BASE22) { struct external_nlist *sym; int type; @@ -5482,9 +5482,9 @@ aout_link_input_section_ext (finfo, inpu to skip this reloc. */ if (hundef && ! finfo->info->shared - && r_type != RELOC_BASE10 - && r_type != RELOC_BASE13 - && r_type != RELOC_BASE22) + && r_type != (unsigned int) RELOC_BASE10 + && r_type != (unsigned int) RELOC_BASE13 + && r_type != (unsigned int) RELOC_BASE22) { const char *name; @@ -5498,7 +5498,7 @@ aout_link_input_section_ext (finfo, inpu return false; } - if (r_type != RELOC_SPARC_REV32) + if (r_type != (unsigned int) RELOC_SPARC_REV32) r = MY_final_link_relocate (howto_table_ext + r_type, input_bfd, input_section, contents, r_addr, relocation, @@ -5527,9 +5527,9 @@ aout_link_input_section_ext (finfo, inpu if (h != NULL) name = h->root.root.string; else if (r_extern - || r_type == RELOC_BASE10 - || r_type == RELOC_BASE13 - || r_type == RELOC_BASE22) + || r_type == (unsigned int) RELOC_BASE10 + || r_type == (unsigned int) RELOC_BASE13 + || r_type == (unsigned int) RELOC_BASE22) name = strings + GET_WORD (input_bfd, syms[r_index].e_strx); else @@ -5645,7 +5645,7 @@ aout_link_reloc_link_order (finfo, o, p) int r_relative; int r_length; - r_pcrel = howto->pc_relative; + r_pcrel = (int) howto->pc_relative; r_baserel = (howto->type & 8) != 0; r_jmptable = (howto->type & 16) != 0; r_relative = (howto->type & 32) != 0; diff -Nurpa binutils-2.13/bfd/archive.c binutils-2.13.1/bfd/archive.c --- binutils-2.13/bfd/archive.c 2002-06-25 02:21:47.000000000 -0400 +++ binutils-2.13.1/bfd/archive.c 2002-10-28 13:45:42.000000000 -0500 @@ -436,12 +436,12 @@ _bfd_generic_read_ar_hdr_mag (abfd, mag) spaces, so only look for ' ' if we don't find '/'. */ char *e; - e = memchr (hdr.ar_name, '\0', ar_maxnamelen (abfd)); + e = (char *) memchr (hdr.ar_name, '\0', ar_maxnamelen (abfd)); if (e == NULL) { - e = memchr (hdr.ar_name, '/', ar_maxnamelen (abfd)); + e = (char *) memchr (hdr.ar_name, '/', ar_maxnamelen (abfd)); if (e == NULL) - e = memchr (hdr.ar_name, ' ', ar_maxnamelen (abfd)); + e = (char *) memchr (hdr.ar_name, ' ', ar_maxnamelen (abfd)); } if (e != NULL) @@ -603,8 +603,6 @@ bfd_generic_archive_p (abfd) char armag[SARMAG + 1]; bfd_size_type amt; - tdata_hold = abfd->tdata.aout_ar_data; - if (bfd_bread ((PTR) armag, (bfd_size_type) SARMAG, abfd) != SARMAG) { if (bfd_get_error () != bfd_error_system_call) @@ -621,13 +619,15 @@ bfd_generic_archive_p (abfd) return 0; #endif - /* We are setting bfd_ardata(abfd) here, but since bfd_ardata - involves a cast, we can't do it as the left operand of assignment. */ - amt = sizeof (struct artdata); - abfd->tdata.aout_ar_data = (struct artdata *) bfd_zalloc (abfd, amt); + tdata_hold = bfd_ardata (abfd); + amt = sizeof (struct artdata); + bfd_ardata (abfd) = (struct artdata *) bfd_zalloc (abfd, amt); if (bfd_ardata (abfd) == NULL) - return NULL; + { + bfd_ardata (abfd) = tdata_hold; + return NULL; + } bfd_ardata (abfd)->first_file_filepos = SARMAG; bfd_ardata (abfd)->cache = NULL; @@ -636,21 +636,13 @@ bfd_generic_archive_p (abfd) bfd_ardata (abfd)->extended_names = NULL; bfd_ardata (abfd)->tdata = NULL; - if (!BFD_SEND (abfd, _bfd_slurp_armap, (abfd))) + if (!BFD_SEND (abfd, _bfd_slurp_armap, (abfd)) + || !BFD_SEND (abfd, _bfd_slurp_extended_name_table, (abfd))) { - bfd_release (abfd, bfd_ardata (abfd)); - abfd->tdata.aout_ar_data = tdata_hold; if (bfd_get_error () != bfd_error_system_call) bfd_set_error (bfd_error_wrong_format); - return NULL; - } - - if (!BFD_SEND (abfd, _bfd_slurp_extended_name_table, (abfd))) - { bfd_release (abfd, bfd_ardata (abfd)); - abfd->tdata.aout_ar_data = tdata_hold; - if (bfd_get_error () != bfd_error_system_call) - bfd_set_error (bfd_error_wrong_format); + bfd_ardata (abfd) = tdata_hold; return NULL; } @@ -686,9 +678,9 @@ bfd_generic_archive_p (abfd) release bfd_ardata. FIXME. */ (void) bfd_close (first); bfd_release (abfd, bfd_ardata (abfd)); - abfd->tdata.aout_ar_data = tdata_hold; #endif bfd_set_error (bfd_error_wrong_object_format); + bfd_ardata (abfd) = tdata_hold; return NULL; } /* And we ought to close `first' here too. */ diff -Nurpa binutils-2.13/bfd/bfd-in.h binutils-2.13.1/bfd/bfd-in.h --- binutils-2.13/bfd/bfd-in.h 2002-06-04 23:43:09.000000000 -0400 +++ binutils-2.13.1/bfd/bfd-in.h 2002-10-28 13:45:42.000000000 -0500 @@ -328,7 +328,7 @@ alent; /* Object and core file sections. */ #define align_power(addr, align) \ - ( ((addr) + ((1<<(align))-1)) & (-1 << (align))) + (((addr) + ((bfd_vma) 1 << (align)) - 1) & ((bfd_vma) -1 << (align))) typedef struct sec *sec_ptr; @@ -346,7 +346,7 @@ typedef struct sec *sec_ptr; #define bfd_is_com_section(ptr) (((ptr)->flags & SEC_IS_COMMON) != 0) -#define bfd_set_section_vma(bfd, ptr, val) (((ptr)->vma = (ptr)->lma = (val)), ((ptr)->user_set_vma = (boolean)true), true) +#define bfd_set_section_vma(bfd, ptr, val) (((ptr)->vma = (ptr)->lma = (val)), ((ptr)->user_set_vma = (unsigned int)true), true) #define bfd_set_section_alignment(bfd, ptr, val) (((ptr)->alignment_power = (val)),true) #define bfd_set_section_userdata(bfd, ptr, val) (((ptr)->userdata = (val)),true) @@ -526,6 +526,8 @@ extern void warn_deprecated #define bfd_get_outsymbols(abfd) ((abfd)->outsymbols) #define bfd_count_sections(abfd) ((abfd)->section_count) +#define bfd_get_dynamic_symcount(abfd) ((abfd)->dynsymcount) + #define bfd_get_symbol_leading_char(abfd) ((abfd)->xvec->symbol_leading_char) #define bfd_set_cacheable(abfd,bool) (((abfd)->cacheable = (boolean) (bool)), true) diff -Nurpa binutils-2.13/bfd/bfd-in2.h binutils-2.13.1/bfd/bfd-in2.h --- binutils-2.13/bfd/bfd-in2.h 2002-06-22 22:09:03.000000000 -0400 +++ binutils-2.13.1/bfd/bfd-in2.h 2002-10-30 11:29:40.000000000 -0500 @@ -334,7 +334,7 @@ alent; /* Object and core file sections. */ #define align_power(addr, align) \ - ( ((addr) + ((1<<(align))-1)) & (-1 << (align))) + (((addr) + ((bfd_vma) 1 << (align)) - 1) & ((bfd_vma) -1 << (align))) typedef struct sec *sec_ptr; @@ -352,7 +352,7 @@ typedef struct sec *sec_ptr; #define bfd_is_com_section(ptr) (((ptr)->flags & SEC_IS_COMMON) != 0) -#define bfd_set_section_vma(bfd, ptr, val) (((ptr)->vma = (ptr)->lma = (val)), ((ptr)->user_set_vma = (boolean)true), true) +#define bfd_set_section_vma(bfd, ptr, val) (((ptr)->vma = (ptr)->lma = (val)), ((ptr)->user_set_vma = (unsigned int)true), true) #define bfd_set_section_alignment(bfd, ptr, val) (((ptr)->alignment_power = (val)),true) #define bfd_set_section_userdata(bfd, ptr, val) (((ptr)->userdata = (val)),true) @@ -532,6 +532,8 @@ extern void warn_deprecated #define bfd_get_outsymbols(abfd) ((abfd)->outsymbols) #define bfd_count_sections(abfd) ((abfd)->section_count) +#define bfd_get_dynamic_symcount(abfd) ((abfd)->dynsymcount) + #define bfd_get_symbol_leading_char(abfd) ((abfd)->xvec->symbol_leading_char) #define bfd_set_cacheable(abfd,bool) (((abfd)->cacheable = (boolean) (bool)), true) @@ -2253,6 +2255,9 @@ to compensate for the borrow when the lo BFD_RELOC_386_RELATIVE, BFD_RELOC_386_GOTOFF, BFD_RELOC_386_GOTPC, + BFD_RELOC_386_TLS_TPOFF, + BFD_RELOC_386_TLS_IE, + BFD_RELOC_386_TLS_GOTIE, BFD_RELOC_386_TLS_LE, BFD_RELOC_386_TLS_GD, BFD_RELOC_386_TLS_LDM, @@ -3379,6 +3384,9 @@ struct _bfd /* Symbol table for output BFD (with symcount entries). */ struct symbol_cache_entry **outsymbols; + /* Used for slurped dynamic symbol tables. */ + unsigned int dynsymcount; + /* Pointer to structure which contains architecture information. */ const struct bfd_arch_info *arch_info; @@ -3626,7 +3634,7 @@ extern bfd_byte *bfd_get_relocated_secti boolean, asymbol **)); boolean -bfd_alt_mach_code PARAMS ((bfd *abfd, int index)); +bfd_alt_mach_code PARAMS ((bfd *abfd, int alternative)); /* Extracted from archive.c. */ symindex diff -Nurpa binutils-2.13/bfd/bfd.c binutils-2.13.1/bfd/bfd.c --- binutils-2.13/bfd/bfd.c 2002-06-04 23:43:09.000000000 -0400 +++ binutils-2.13.1/bfd/bfd.c 2002-10-28 13:45:43.000000000 -0500 @@ -128,6 +128,9 @@ CODE_FRAGMENT . {* Symbol table for output BFD (with symcount entries). *} . struct symbol_cache_entry **outsymbols; . +. {* Used for slurped dynamic symbol tables. *} +. unsigned int dynsymcount; +. . {* Pointer to structure which contains architecture information. *} . const struct bfd_arch_info *arch_info; . @@ -1290,10 +1293,10 @@ bfd_record_phdr (abfd, type, flags_valid m->p_type = type; m->p_flags = flags; m->p_paddr = at; - m->p_flags_valid = flags_valid; - m->p_paddr_valid = at_valid; - m->includes_filehdr = includes_filehdr; - m->includes_phdrs = includes_phdrs; + m->p_flags_valid = (unsigned int) flags_valid; + m->p_paddr_valid = (unsigned int) at_valid; + m->includes_filehdr = (unsigned int) includes_filehdr; + m->includes_phdrs = (unsigned int) includes_phdrs; m->count = count; if (count > 0) memcpy (m->sections, secs, count * sizeof (asection *)); @@ -1334,27 +1337,27 @@ FUNCTION bfd_alt_mach_code SYNOPSIS - boolean bfd_alt_mach_code(bfd *abfd, int index); + boolean bfd_alt_mach_code(bfd *abfd, int alternative); DESCRIPTION When more than one machine code number is available for the same machine type, this function can be used to switch between - the preferred one (index == 0) and any others. Currently, + the preferred one (alternative == 0) and any others. Currently, only ELF supports this feature, with up to two alternate machine codes. */ boolean -bfd_alt_mach_code (abfd, index) +bfd_alt_mach_code (abfd, alternative) bfd *abfd; - int index; + int alternative; { if (bfd_get_flavour (abfd) == bfd_target_elf_flavour) { int code; - switch (index) + switch (alternative) { case 0: code = get_elf_backend_data (abfd)->elf_machine_code; diff -Nurpa binutils-2.13/bfd/binary.c binutils-2.13.1/bfd/binary.c --- binutils-2.13/bfd/binary.c 2002-06-04 23:43:09.000000000 -0400 +++ binutils-2.13.1/bfd/binary.c 2002-10-28 13:45:43.000000000 -0500 @@ -185,7 +185,7 @@ binary_get_symtab (abfd, alocation) syms = (asymbol *) bfd_alloc (abfd, amt); if (syms == NULL) - return false; + return (long) false; /* Start symbol. */ syms[0].the_bfd = abfd; diff -Nurpa binutils-2.13/bfd/coff-arm.c binutils-2.13.1/bfd/coff-arm.c --- binutils-2.13/bfd/coff-arm.c 2002-05-23 08:37:19.000000000 -0400 +++ binutils-2.13.1/bfd/coff-arm.c 2002-10-11 04:56:13.000000000 -0400 @@ -1881,6 +1881,7 @@ record_arm_to_thumb_glue (info, h) register asection * s; char * tmp_name; struct coff_link_hash_entry * myh; + struct bfd_link_hash_entry * bh; struct coff_arm_link_hash_table * globals; bfd_vma val; bfd_size_type amt; @@ -1915,10 +1916,10 @@ record_arm_to_thumb_glue (info, h) though the section isn't allocated yet, this is where we will be putting it. */ + bh = NULL; val = globals->arm_glue_size + 1; bfd_coff_link_add_one_symbol (info, globals->bfd_of_glue_owner, tmp_name, - BSF_GLOBAL, s, val, NULL, true, false, - (struct bfd_link_hash_entry **) & myh); + BSF_GLOBAL, s, val, NULL, true, false, &bh); free (tmp_name); @@ -1937,6 +1938,7 @@ record_thumb_to_arm_glue (info, h) register asection * s; char * tmp_name; struct coff_link_hash_entry * myh; + struct bfd_link_hash_entry * bh; struct coff_arm_link_hash_table * globals; bfd_vma val; bfd_size_type amt; @@ -1967,12 +1969,13 @@ record_thumb_to_arm_glue (info, h) return; /* we've already seen this guy */ } + bh = NULL; val = globals->thumb_glue_size + 1; bfd_coff_link_add_one_symbol (info, globals->bfd_of_glue_owner, tmp_name, - BSF_GLOBAL, s, val, NULL, true, false, - (struct bfd_link_hash_entry **) &myh); + BSF_GLOBAL, s, val, NULL, true, false, &bh); /* If we mark it 'thumb', the disassembler will do a better job. */ + myh = (struct coff_link_hash_entry *) bh; myh->class = C_THUMBEXTFUNC; free (tmp_name); @@ -1989,11 +1992,10 @@ record_thumb_to_arm_glue (info, h) sprintf (tmp_name, globals->support_old_code ? BACK_FROM_ARM : CHANGE_TO_ARM, name); - myh = NULL; + bh = NULL; val = globals->thumb_glue_size + (globals->support_old_code ? 8 : 4); bfd_coff_link_add_one_symbol (info, globals->bfd_of_glue_owner, tmp_name, - BSF_LOCAL, s, val, NULL, true, false, - (struct bfd_link_hash_entry **) & myh); + BSF_LOCAL, s, val, NULL, true, false, &bh); free (tmp_name); diff -Nurpa binutils-2.13/bfd/coff-rs6000.c binutils-2.13.1/bfd/coff-rs6000.c --- binutils-2.13/bfd/coff-rs6000.c 2002-06-25 03:40:49.000000000 -0400 +++ binutils-2.13.1/bfd/coff-rs6000.c 2002-09-23 18:12:38.000000000 -0400 @@ -167,7 +167,7 @@ static boolean xcoff_complain_overflow_u PARAMS ((XCOFF_COMPLAIN_FUNCTION_ARGS)); boolean (*xcoff_calculate_relocation[XCOFF_MAX_CALCULATE_RELOCATION]) - (XCOFF_RELOC_FUNCTION_ARGS) = + PARAMS ((XCOFF_RELOC_FUNCTION_ARGS)) = { xcoff_reloc_type_pos, /* R_POS (0x00) */ xcoff_reloc_type_neg, /* R_NEG (0x01) */ @@ -200,7 +200,7 @@ boolean (*xcoff_calculate_relocation[XCO }; boolean (*xcoff_complain_overflow[XCOFF_MAX_COMPLAIN_OVERFLOW]) - (XCOFF_COMPLAIN_FUNCTION_ARGS) = + PARAMS ((XCOFF_COMPLAIN_FUNCTION_ARGS)) = { xcoff_complain_overflow_dont_func, xcoff_complain_overflow_bitfield_func, @@ -655,7 +655,7 @@ reloc_howto_type xcoff_howto_table[] = /* External TOC relative symbol. */ HOWTO (R_GL, /* type */ 0, /* rightshift */ - 2, /* size (0 = byte, 1 = short, 2 = long) */ + 1, /* size (0 = byte, 1 = short, 2 = long) */ 16, /* bitsize */ false, /* pc_relative */ 0, /* bitpos */ @@ -670,7 +670,7 @@ reloc_howto_type xcoff_howto_table[] = /* Local TOC relative symbol. */ HOWTO (R_TCL, /* type */ 0, /* rightshift */ - 2, /* size (0 = byte, 1 = short, 2 = long) */ + 1, /* size (0 = byte, 1 = short, 2 = long) */ 16, /* bitsize */ false, /* pc_relative */ 0, /* bitpos */ @@ -695,8 +695,8 @@ reloc_howto_type xcoff_howto_table[] = 0, /* special_function */ "R_BA_26", /* name */ true, /* partial_inplace */ - 0x3fffffc, /* src_mask */ - 0x3fffffc, /* dst_mask */ + 0x03fffffc, /* src_mask */ + 0x03fffffc, /* dst_mask */ false), /* pcrel_offset */ EMPTY_HOWTO (9), @@ -721,7 +721,7 @@ reloc_howto_type xcoff_howto_table[] = /* Indirect load. */ HOWTO (R_RL, /* type */ 0, /* rightshift */ - 2, /* size (0 = byte, 1 = short, 2 = long) */ + 1, /* size (0 = byte, 1 = short, 2 = long) */ 16, /* bitsize */ false, /* pc_relative */ 0, /* bitpos */ @@ -736,7 +736,7 @@ reloc_howto_type xcoff_howto_table[] = /* Load address. */ HOWTO (R_RLA, /* type */ 0, /* rightshift */ - 2, /* size (0 = byte, 1 = short, 2 = long) */ + 1, /* size (0 = byte, 1 = short, 2 = long) */ 16, /* bitsize */ false, /* pc_relative */ 0, /* bitpos */ @@ -757,7 +757,7 @@ reloc_howto_type xcoff_howto_table[] = 32, /* bitsize */ false, /* pc_relative */ 0, /* bitpos */ - complain_overflow_bitfield, /* complain_on_overflow */ + complain_overflow_dont, /* complain_on_overflow */ 0, /* special_function */ "R_REF", /* name */ false, /* partial_inplace */ @@ -771,7 +771,7 @@ reloc_howto_type xcoff_howto_table[] = /* TOC relative indirect load. */ HOWTO (R_TRL, /* type */ 0, /* rightshift */ - 2, /* size (0 = byte, 1 = short, 2 = long) */ + 1, /* size (0 = byte, 1 = short, 2 = long) */ 16, /* bitsize */ false, /* pc_relative */ 0, /* bitpos */ @@ -786,7 +786,7 @@ reloc_howto_type xcoff_howto_table[] = /* TOC relative load address. */ HOWTO (R_TRLA, /* type */ 0, /* rightshift */ - 2, /* size (0 = byte, 1 = short, 2 = long) */ + 1, /* size (0 = byte, 1 = short, 2 = long) */ 16, /* bitsize */ false, /* pc_relative */ 0, /* bitpos */ @@ -831,7 +831,7 @@ reloc_howto_type xcoff_howto_table[] = /* Modifiable call absolute indirect. */ HOWTO (R_CAI, /* type */ 0, /* rightshift */ - 2, /* size (0 = byte, 1 = short, 2 = long) */ + 1, /* size (0 = byte, 1 = short, 2 = long) */ 16, /* bitsize */ false, /* pc_relative */ 0, /* bitpos */ @@ -846,7 +846,7 @@ reloc_howto_type xcoff_howto_table[] = /* Modifiable call relative. */ HOWTO (R_CREL, /* type */ 0, /* rightshift */ - 2, /* size (0 = byte, 1 = short, 2 = long) */ + 1, /* size (0 = byte, 1 = short, 2 = long) */ 16, /* bitsize */ false, /* pc_relative */ 0, /* bitpos */ @@ -869,8 +869,8 @@ reloc_howto_type xcoff_howto_table[] = 0, /* special_function */ "R_RBA", /* name */ true, /* partial_inplace */ - 0xffff, /* src_mask */ - 0xffff, /* dst_mask */ + 0x03fffffc, /* src_mask */ + 0x03fffffc, /* dst_mask */ false), /* pcrel_offset */ /* Modifiable branch absolute. */ @@ -884,8 +884,8 @@ reloc_howto_type xcoff_howto_table[] = 0, /* special_function */ "R_RBAC", /* name */ true, /* partial_inplace */ - 0xffff, /* src_mask */ - 0xffff, /* dst_mask */ + 0xffffffff, /* src_mask */ + 0xffffffff, /* dst_mask */ false), /* pcrel_offset */ /* Modifiable branch relative. */ @@ -899,14 +899,14 @@ reloc_howto_type xcoff_howto_table[] = 0, /* special_function */ "R_RBR_26", /* name */ true, /* partial_inplace */ - 0xffff, /* src_mask */ - 0xffff, /* dst_mask */ + 0x03fffffc, /* src_mask */ + 0x03fffffc, /* dst_mask */ false), /* pcrel_offset */ /* Modifiable branch absolute. */ HOWTO (R_RBRC, /* type */ 0, /* rightshift */ - 2, /* size (0 = byte, 1 = short, 2 = long) */ + 1, /* size (0 = byte, 1 = short, 2 = long) */ 16, /* bitsize */ false, /* pc_relative */ 0, /* bitpos */ @@ -996,10 +996,6 @@ xcoff_rtype2howto (relent, internal) && (relent->howto->bitsize != ((unsigned int) internal->r_size & 0x1f) + 1)) abort (); - - /* Put a meaningful value in addend */ - relent->addend = (internal->r_size & 0x80) ? - internal->r_vaddr - : internal->r_vaddr; } reloc_howto_type * @@ -1243,10 +1239,11 @@ const bfd_target * _bfd_xcoff_archive_p (abfd) bfd *abfd; { + struct artdata *tdata_hold; char magic[SXCOFFARMAG]; - bfd_size_type amt; + bfd_size_type amt = SXCOFFARMAG; - if (bfd_bread ((PTR) magic, (bfd_size_type) SXCOFFARMAG, abfd) != SXCOFFARMAG) + if (bfd_bread ((PTR) magic, amt, abfd) != amt) { if (bfd_get_error () != bfd_error_system_call) bfd_set_error (bfd_error_wrong_format); @@ -1260,13 +1257,12 @@ _bfd_xcoff_archive_p (abfd) return NULL; } - /* We are setting bfd_ardata(abfd) here, but since bfd_ardata - involves a cast, we can't do it as the left operand of - assignment. */ + tdata_hold = bfd_ardata (abfd); + amt = sizeof (struct artdata); - abfd->tdata.aout_ar_data = (struct artdata *) bfd_zalloc (abfd, amt); + bfd_ardata (abfd) = (struct artdata *) bfd_zalloc (abfd, amt); if (bfd_ardata (abfd) == (struct artdata *) NULL) - return NULL; + goto error_ret_restore; bfd_ardata (abfd)->cache = NULL; bfd_ardata (abfd)->archive_head = NULL; @@ -1283,13 +1279,12 @@ _bfd_xcoff_archive_p (abfd) memcpy (hdr.magic, magic, SXCOFFARMAG); /* Now read the rest of the file header. */ - if (bfd_bread ((PTR) &hdr.memoff, - (bfd_size_type) SIZEOF_AR_FILE_HDR - SXCOFFARMAG, abfd) - != SIZEOF_AR_FILE_HDR - SXCOFFARMAG) + amt = SIZEOF_AR_FILE_HDR - SXCOFFARMAG; + if (bfd_bread ((PTR) &hdr.memoff, amt, abfd) != amt) { if (bfd_get_error () != bfd_error_system_call) bfd_set_error (bfd_error_wrong_format); - return NULL; + goto error_ret; } bfd_ardata (abfd)->first_file_filepos = strtol (hdr.firstmemoff, @@ -1298,7 +1293,7 @@ _bfd_xcoff_archive_p (abfd) amt = SIZEOF_AR_FILE_HDR; bfd_ardata (abfd)->tdata = bfd_zalloc (abfd, amt); if (bfd_ardata (abfd)->tdata == NULL) - return NULL; + goto error_ret; memcpy (bfd_ardata (abfd)->tdata, &hdr, SIZEOF_AR_FILE_HDR); } @@ -1311,33 +1306,32 @@ _bfd_xcoff_archive_p (abfd) memcpy (hdr.magic, magic, SXCOFFARMAG); /* Now read the rest of the file header. */ - if (bfd_bread ((PTR) &hdr.memoff, - (bfd_size_type) SIZEOF_AR_FILE_HDR_BIG - SXCOFFARMAG, abfd) - != SIZEOF_AR_FILE_HDR_BIG - SXCOFFARMAG) + amt = SIZEOF_AR_FILE_HDR_BIG - SXCOFFARMAG; + if (bfd_bread ((PTR) &hdr.memoff, amt, abfd) != amt) { if (bfd_get_error () != bfd_error_system_call) bfd_set_error (bfd_error_wrong_format); - return NULL; + goto error_ret; } - /* XXX This actually has to be a call to strtoll (at least on 32-bit - machines) since the field width is 20 and there numbers with more - than 32 bits can be represented. */ - bfd_ardata (abfd)->first_file_filepos = strtol (hdr.firstmemoff, - (char **) NULL, 10); + bfd_ardata (abfd)->first_file_filepos = bfd_scan_vma (hdr.firstmemoff, + (const char **) 0, + 10); amt = SIZEOF_AR_FILE_HDR_BIG; bfd_ardata (abfd)->tdata = bfd_zalloc (abfd, amt); if (bfd_ardata (abfd)->tdata == NULL) - return NULL; + goto error_ret; memcpy (bfd_ardata (abfd)->tdata, &hdr, SIZEOF_AR_FILE_HDR_BIG); } if (! _bfd_xcoff_slurp_armap (abfd)) { + error_ret: bfd_release (abfd, bfd_ardata (abfd)); - abfd->tdata.aout_ar_data = (struct artdata *) NULL; + error_ret_restore: + bfd_ardata (abfd) = tdata_hold; return NULL; } @@ -2186,9 +2180,9 @@ xcoff_write_archive_contents_old (abfd) sprintf (fhdr.memoff, "%ld", (long) nextoff); memset (&ahdr, 0, sizeof ahdr); - sprintf (ahdr.size, "%ld", (long) (XCOFFARMAG_ELEMENT_SIZE + - count * XCOFFARMAG_ELEMENT_SIZE + - total_namlen)); + sprintf (ahdr.size, "%ld", (long) (XCOFFARMAG_ELEMENT_SIZE + + count * XCOFFARMAG_ELEMENT_SIZE + + total_namlen)); sprintf (ahdr.prevoff, "%ld", (long) prevoff); sprintf (ahdr.date, "%d", 0); sprintf (ahdr.uid, "%d", 0); @@ -2460,9 +2454,9 @@ xcoff_write_archive_contents_big (abfd) hdr = (struct xcoff_ar_hdr_big *) member_table; - PRINT20 (hdr->size, (XCOFFARMAGBIG_ELEMENT_SIZE + - count * XCOFFARMAGBIG_ELEMENT_SIZE + - total_namlen + (total_namlen & 1))); + PRINT20 (hdr->size, (XCOFFARMAGBIG_ELEMENT_SIZE + + count * XCOFFARMAGBIG_ELEMENT_SIZE + + total_namlen + (total_namlen & 1))); if (makemap && hasobjects) PRINT20 (hdr->nextoff, nextoff + member_table_size); else @@ -2825,8 +2819,8 @@ xcoff_reloc_type_rel (input_bfd, input_s addend += input_section->vma; *relocation = val + addend; - *relocation -= (input_section->output_section->vma + - input_section->output_offset); + *relocation -= (input_section->output_section->vma + + input_section->output_offset); return true; } @@ -2868,8 +2862,8 @@ xcoff_reloc_type_toc (input_bfd, input_s + h->toc_section->output_offset); } - *relocation = ((val - xcoff_data (output_bfd)->toc) - - (sym->n_value - xcoff_data (input_bfd)->toc)); + *relocation = ((val - xcoff_data (output_bfd)->toc) + - (sym->n_value - xcoff_data (input_bfd)->toc)); return true; } @@ -2925,8 +2919,8 @@ xcoff_reloc_type_br (input_bfd, input_se cror. */ if (NULL != h && bfd_link_hash_defined == h->root.type - && (rel->r_vaddr - input_section->vma + 8 <= - input_section->_cooked_size)) + && (rel->r_vaddr - input_section->vma + 8 + <= input_section->_cooked_size)) { bfd_byte *pnext; unsigned long next; @@ -2943,7 +2937,8 @@ xcoff_reloc_type_br (input_bfd, input_se || next == 0x60000000) /* ori r0,r0,0 */ bfd_put_32 (input_bfd, 0x80410014, pnext); /* lwz r1,20(r1) */ - } else + } + else { if (next == 0x80410014) /* lwz r1,20(r1) */ bfd_put_32 (input_bfd, 0x60000000, pnext); /* ori r0,r0,0 */ @@ -2969,8 +2964,8 @@ xcoff_reloc_type_br (input_bfd, input_se addend += input_section->vma; *relocation = val + addend; - *relocation -= (input_section->output_section->vma + - input_section->output_offset); + *relocation -= (input_section->output_section->vma + + input_section->output_offset); return true; } @@ -2996,8 +2991,8 @@ xcoff_reloc_type_crel (input_bfd, input_ addend += input_section->vma; *relocation = val + addend; - *relocation -= (input_section->output_section->vma + - input_section->output_offset); + *relocation -= (input_section->output_section->vma + + input_section->output_offset); return true; } @@ -3345,8 +3340,9 @@ xcoff_ppc_relocate_section (output_bfd, howto.size = howto.bitsize > 16 ? 2 : 1; howto.pc_relative = false; howto.bitpos = 0; - howto.complain_on_overflow = rel->r_size & 0x80 ? - complain_overflow_signed : complain_overflow_bitfield; + howto.complain_on_overflow = (rel->r_size & 0x80 + ? complain_overflow_signed + : complain_overflow_bitfield); howto.special_function = NULL; howto.name = "internal"; howto.partial_inplace = true; @@ -3415,7 +3411,7 @@ xcoff_ppc_relocate_section (output_bfd, } if (rel->r_type >= XCOFF_MAX_CALCULATE_RELOCATION - || (false == xcoff_calculate_relocation[rel->r_type] + || !((*xcoff_calculate_relocation[rel->r_type]) (input_bfd, input_section, output_bfd, rel, sym, &howto, val, addend, &relocation, contents))) return false; @@ -3440,11 +3436,11 @@ xcoff_ppc_relocate_section (output_bfd, operation, which would be tedious, or we must do the computations in a type larger than bfd_vma, which would be inefficient. */ - if ((unsigned int) howto.complain_on_overflow >= - XCOFF_MAX_COMPLAIN_OVERFLOW) + if ((unsigned int) howto.complain_on_overflow + >= XCOFF_MAX_COMPLAIN_OVERFLOW) abort(); - if ((true == xcoff_complain_overflow[howto.complain_on_overflow] + if (((*xcoff_complain_overflow[howto.complain_on_overflow]) (input_bfd, value_to_relocate, relocation, &howto))) { const char *name; @@ -3474,9 +3470,9 @@ xcoff_ppc_relocate_section (output_bfd, } /* Add RELOCATION to the right bits of VALUE_TO_RELOCATE. */ - value_to_relocate = ((value_to_relocate & ~howto.dst_mask) | - (((value_to_relocate & howto.src_mask) + - relocation) & howto.dst_mask)); + value_to_relocate = ((value_to_relocate & ~howto.dst_mask) + | (((value_to_relocate & howto.src_mask) + + relocation) & howto.dst_mask)); /* Put the value back in the object file. */ if (1 == howto.size) @@ -3578,8 +3574,8 @@ xcoff_create_csect_from_smclas (abfd, au ".td", NULL, ".sv3264" }; - if ((19 >= aux->x_csect.x_smclas) && - (NULL != names[aux->x_csect.x_smclas])) + if ((19 >= aux->x_csect.x_smclas) + && (NULL != names[aux->x_csect.x_smclas])) { return_value = bfd_make_section_anyway (abfd, names[aux->x_csect.x_smclas]); @@ -3630,8 +3626,7 @@ xcoff_loader_reloc_offset (abfd, ldhdr) bfd *abfd; struct internal_ldhdr *ldhdr; { - return bfd_xcoff_ldhdrsz(abfd) + - (ldhdr->l_nsyms * bfd_xcoff_ldsymsz(abfd)); + return bfd_xcoff_ldhdrsz (abfd) + ldhdr->l_nsyms * bfd_xcoff_ldsymsz (abfd); } static boolean @@ -3955,81 +3950,81 @@ static unsigned long xcoff_glink_code[9] static const struct xcoff_backend_data_rec bfd_xcoff_backend_data = { { /* COFF backend, defined in libcoff.h. */ - _bfd_xcoff_swap_aux_in, /* _bfd_coff_swap_aux_in */ - _bfd_xcoff_swap_sym_in, /* _bfd_coff_swap_sym_in */ - coff_swap_lineno_in, /* _bfd_coff_swap_lineno_in */ - _bfd_xcoff_swap_aux_out, /* _bfd_swap_aux_out */ - _bfd_xcoff_swap_sym_out, /* _bfd_swap_sym_out */ - coff_swap_lineno_out, /* _bfd_swap_lineno_out */ - xcoff_swap_reloc_out, /* _bfd_swap_reloc_out */ - coff_swap_filehdr_out, /* _bfd_swap_filehdr_out */ - coff_swap_aouthdr_out, /* _bfd_swap_aouthdr_out */ - coff_swap_scnhdr_out, /* _bfd_swap_scnhdr_out */ - FILHSZ, /* _bfd_filhsz */ - AOUTSZ, /* _bfd_aoutsz */ - SCNHSZ, /* _bfd_scnhsz */ - SYMESZ, /* _bfd_symesz */ - AUXESZ, /* _bfd_auxesz */ - RELSZ, /* _bfd_relsz */ - LINESZ, /* _bfd_linesz */ - FILNMLEN, /* _bfd_filnmlen */ + _bfd_xcoff_swap_aux_in, + _bfd_xcoff_swap_sym_in, + coff_swap_lineno_in, + _bfd_xcoff_swap_aux_out, + _bfd_xcoff_swap_sym_out, + coff_swap_lineno_out, + xcoff_swap_reloc_out, + coff_swap_filehdr_out, + coff_swap_aouthdr_out, + coff_swap_scnhdr_out, + FILHSZ, + AOUTSZ, + SCNHSZ, + SYMESZ, + AUXESZ, + RELSZ, + LINESZ, + FILNMLEN, true, /* _bfd_coff_long_filenames */ false, /* _bfd_coff_long_section_names */ - (3), /* _bfd_coff_default_section_alignment_power */ + 3, /* _bfd_coff_default_section_alignment_power */ false, /* _bfd_coff_force_symnames_in_strings */ 2, /* _bfd_coff_debug_string_prefix_length */ - coff_swap_filehdr_in, /* _bfd_coff_swap_filehdr_in */ - coff_swap_aouthdr_in, /* _bfd_swap_aouthdr_in */ - coff_swap_scnhdr_in, /* _bfd_swap_scnhdr_in */ - xcoff_swap_reloc_in, /* _bfd_reloc_in */ - coff_bad_format_hook, /* _bfd_bad_format_hook */ - coff_set_arch_mach_hook, /* _bfd_set_arch_mach_hook */ - coff_mkobject_hook, /* _bfd_mkobject_hook */ - styp_to_sec_flags, /* _bfd_syp_to_sec_flags */ - coff_set_alignment_hook, /* _bfd_set_alignment_hook */ - coff_slurp_symbol_table, /* _bfd_coff_slurp_symbol_table */ - symname_in_debug_hook, /* _coff_symname_in_debug_hook */ - coff_pointerize_aux_hook, /* _bfd_coff_pointerize_aux_hook */ - coff_print_aux, /* bfd_coff_print_aux */ - dummy_reloc16_extra_cases, /* _bfd_coff_reloc16_extra_cases */ - dummy_reloc16_estimate, /* _bfd_coff_reloc16_estimate */ + coff_swap_filehdr_in, + coff_swap_aouthdr_in, + coff_swap_scnhdr_in, + xcoff_swap_reloc_in, + coff_bad_format_hook, + coff_set_arch_mach_hook, + coff_mkobject_hook, + styp_to_sec_flags, + coff_set_alignment_hook, + coff_slurp_symbol_table, + symname_in_debug_hook, + coff_pointerize_aux_hook, + coff_print_aux, + dummy_reloc16_extra_cases, + dummy_reloc16_estimate, NULL, /* bfd_coff_sym_is_global */ - coff_compute_section_file_positions, /* _bfd_coff_compute_section_file_positions */ + coff_compute_section_file_positions, NULL, /* _bfd_coff_start_final_link */ - xcoff_ppc_relocate_section, /* _bfd_coff_relocate_section */ - coff_rtype_to_howto, /* _bfd_coff_rtype_to_howto */ - NULL, /* _bfd_coff_addust_symndx */ - _bfd_generic_link_add_one_symbol, /* _bfd_coff_add_one_symbol */ - coff_link_output_has_begun, /* _bfd_coff_link_output_has_begun */ - coff_final_link_postscript /* _bfd_coff_final_link_postscript */ + xcoff_ppc_relocate_section, + coff_rtype_to_howto, + NULL, /* _bfd_coff_adjust_symndx */ + _bfd_generic_link_add_one_symbol, + coff_link_output_has_begun, + coff_final_link_postscript }, 0x01DF, /* magic number */ - bfd_arch_rs6000, /* architecture */ - bfd_mach_rs6k, /* machine */ + bfd_arch_rs6000, + bfd_mach_rs6k, /* Function pointers to xcoff specific swap routines. */ - xcoff_swap_ldhdr_in, /* _xcoff_swap_ldhdr_in */ - xcoff_swap_ldhdr_out, /* _xcoff_swap_ldhdr_out */ - xcoff_swap_ldsym_in, /* _xcoff_swap_ldsym_in */ - xcoff_swap_ldsym_out, /* _xcoff_swap_ldsym_out */ - xcoff_swap_ldrel_in, /* _xcoff_swap_ldrel_in */ - xcoff_swap_ldrel_out, /* _xcoff_swap_ldrel_out */ + xcoff_swap_ldhdr_in, + xcoff_swap_ldhdr_out, + xcoff_swap_ldsym_in, + xcoff_swap_ldsym_out, + xcoff_swap_ldrel_in, + xcoff_swap_ldrel_out, /* Sizes. */ - LDHDRSZ, /* _xcoff_ldhdrsz */ - LDSYMSZ, /* _xcoff_ldsymsz */ - LDRELSZ, /* _xcoff_ldrelsz */ + LDHDRSZ, + LDSYMSZ, + LDRELSZ, 12, /* _xcoff_function_descriptor_size */ - SMALL_AOUTSZ, /* _xcoff_small_aout_header_size */ + SMALL_AOUTSZ, /* Versions. */ 1, /* _xcoff_ldhdr_version */ - _bfd_xcoff_put_symbol_name, /* _xcoff_put_symbol_name */ - _bfd_xcoff_put_ldsymbol_name, /* _xcoff_put_ldsymbol_name */ - & xcoff_dynamic_reloc, /* dynamic reloc howto */ - xcoff_create_csect_from_smclas, /* _xcoff_create_csect_from_smclas */ + _bfd_xcoff_put_symbol_name, + _bfd_xcoff_put_ldsymbol_name, + &xcoff_dynamic_reloc, + xcoff_create_csect_from_smclas, /* Lineno and reloc count overflow. */ xcoff_is_lineno_count_overflow, @@ -4040,11 +4035,11 @@ static const struct xcoff_backend_data_r /* glink. */ & xcoff_glink_code[0], - (36), /* _xcoff_glink_size */ + 36, /* _xcoff_glink_size */ /* rtinit */ 64, /* _xcoff_rtinit_size */ - xcoff_generate_rtinit, /* _xcoff_generate_rtinit */ + xcoff_generate_rtinit, }; /* The transfer vector that leads the outside world to all of the above. */ @@ -4055,36 +4050,35 @@ const bfd_target rs6000coff_vec = BFD_ENDIAN_BIG, /* data byte order is big */ BFD_ENDIAN_BIG, /* header byte order is big */ - (HAS_RELOC | EXEC_P | /* object flags */ - HAS_LINENO | HAS_DEBUG | DYNAMIC | - HAS_SYMS | HAS_LOCALS | WP_TEXT), + (HAS_RELOC | EXEC_P | HAS_LINENO | HAS_DEBUG | DYNAMIC + | HAS_SYMS | HAS_LOCALS | WP_TEXT), - (SEC_HAS_CONTENTS | SEC_ALLOC | SEC_LOAD | SEC_RELOC), /* section flags */ + (SEC_HAS_CONTENTS | SEC_ALLOC | SEC_LOAD | SEC_RELOC), 0, /* leading char */ '/', /* ar_pad_char */ - 15, /* ar_max_namelen??? FIXMEmgo */ + 15, /* ar_max_namelen */ /* data */ - bfd_getb64, /* bfd_getx64 */ - bfd_getb_signed_64, /* bfd_getx_signed_64 */ - bfd_putb64, /* bfd_putx64 */ - bfd_getb32, /* bfd_getx32 */ - bfd_getb_signed_32, /* bfd_getx_signed_32 */ - bfd_putb32, /* bfd_putx32 */ - bfd_getb16, /* bfd_getx16 */ - bfd_getb_signed_16, /* bfd_getx_signed_16 */ - bfd_putb16, /* bfd_putx16 */ + bfd_getb64, + bfd_getb_signed_64, + bfd_putb64, + bfd_getb32, + bfd_getb_signed_32, + bfd_putb32, + bfd_getb16, + bfd_getb_signed_16, + bfd_putb16, /* hdrs */ - bfd_getb64, /* bfd_h_getx64 */ - bfd_getb_signed_64, /* bfd_h_getx_signed_64 */ - bfd_putb64, /* bfd_h_putx64 */ - bfd_getb32, /* bfd_h_getx32 */ - bfd_getb_signed_32, /* bfd_h_getx_signed_32 */ - bfd_putb32, /* bfd_h_putx32 */ - bfd_getb16, /* bfd_h_getx16 */ - bfd_getb_signed_16, /* bfd_h_getx_signed_16 */ - bfd_putb16, /* bfd_h_putx16 */ + bfd_getb64, + bfd_getb_signed_64, + bfd_putb64, + bfd_getb32, + bfd_getb_signed_32, + bfd_putb32, + bfd_getb16, + bfd_getb_signed_16, + bfd_putb16, { /* bfd_check_format */ _bfd_dummy_target, @@ -4108,206 +4102,186 @@ const bfd_target rs6000coff_vec = }, /* Generic */ - bfd_true, /* _close_and_cleanup */ - bfd_true, /* _bfd_free_cached_info */ - coff_new_section_hook, /* _new_section_hook */ - _bfd_generic_get_section_contents, /* _bfd_get_section_contents */ - /* _bfd_get_section_contents_in_window */ + bfd_true, + bfd_true, + coff_new_section_hook, + _bfd_generic_get_section_contents, _bfd_generic_get_section_contents_in_window, /* Copy */ - _bfd_xcoff_copy_private_bfd_data, /* _bfd_copy_private_bfd */ - /* _bfd_merge_private_bfd_data */ + _bfd_xcoff_copy_private_bfd_data, ((boolean (*) (bfd *, bfd *)) bfd_true), - /* _bfd_copy_pivate_section_data */ ((boolean (*) (bfd *, asection *, bfd *, asection *)) bfd_true), - /* _bfd_copy_private_symbol_data */ ((boolean (*) (bfd *, asymbol *, bfd *, asymbol *)) bfd_true), - ((boolean (*) (bfd *, flagword)) bfd_true), /* _bfd_set_private_flags */ - ((boolean (*) (bfd *, void * )) bfd_true), /* _bfd_print_private_bfd_data */ + ((boolean (*) (bfd *, flagword)) bfd_true), + ((boolean (*) (bfd *, void * )) bfd_true), /* Core */ - coff_core_file_failing_command, /* _core_file_failing_command */ - coff_core_file_failing_signal, /* _core_file_failing_signal */ - /* _core_file_matches_executable_p */ + coff_core_file_failing_command, + coff_core_file_failing_signal, coff_core_file_matches_executable_p, /* Archive */ - _bfd_xcoff_slurp_armap, /* _slurp_armap */ - /* XCOFF archives do not have - anything which corresponds to - an extended name table. */ - bfd_false, /* _slurp_extended_name_table */ - /* _construct_extended_name_table */ + _bfd_xcoff_slurp_armap, + bfd_false, ((boolean (*) (bfd *, char **, bfd_size_type *, const char **)) bfd_false), - bfd_dont_truncate_arname, /* _truncate_arname */ - _bfd_xcoff_write_armap, /* _write_armap */ - _bfd_xcoff_read_ar_hdr, /* _read_ar_hdr */ - _bfd_xcoff_openr_next_archived_file, /* _openr_next_archived_file */ - _bfd_generic_get_elt_at_index, /* _get_elt_at_index */ - _bfd_xcoff_stat_arch_elt, /* _generic_stat_arch_elt */ - /* XCOFF archives do not have - a timestamp. */ - bfd_true, /* _update_armap_timestamp */ + bfd_dont_truncate_arname, + _bfd_xcoff_write_armap, + _bfd_xcoff_read_ar_hdr, + _bfd_xcoff_openr_next_archived_file, + _bfd_generic_get_elt_at_index, + _bfd_xcoff_stat_arch_elt, + bfd_true, /* Symbols */ - coff_get_symtab_upper_bound, /* _get_symtab_upper_bound */ - coff_get_symtab, /* _get_symtab */ - coff_make_empty_symbol, /* _make_empty_symbol */ - coff_print_symbol, /* _print_symbol */ - coff_get_symbol_info, /* _get_symbol_info */ - _bfd_xcoff_is_local_label_name, /* _bfd_is_local_label_name */ - coff_get_lineno, /* _get_lineno */ - coff_find_nearest_line, /* _find_nearest_line */ - coff_bfd_make_debug_symbol, /* _bfd_make_debug_symbol */ - _bfd_generic_read_minisymbols, /* _read_minisymbols */ - _bfd_generic_minisymbol_to_symbol, /* _minsymbol_to_symbol */ + coff_get_symtab_upper_bound, + coff_get_symtab, + coff_make_empty_symbol, + coff_print_symbol, + coff_get_symbol_info, + _bfd_xcoff_is_local_label_name, + coff_get_lineno, + coff_find_nearest_line, + coff_bfd_make_debug_symbol, + _bfd_generic_read_minisymbols, + _bfd_generic_minisymbol_to_symbol, /* Reloc */ - coff_get_reloc_upper_bound, /* _get_reloc_upper_bound */ - coff_canonicalize_reloc, /* _cononicalize_reloc */ - _bfd_xcoff_reloc_type_lookup, /* _bfd_reloc_type_lookup */ + coff_get_reloc_upper_bound, + coff_canonicalize_reloc, + _bfd_xcoff_reloc_type_lookup, /* Write */ - coff_set_arch_mach, /* _set_arch_mach */ - coff_set_section_contents, /* _set_section_contents */ + coff_set_arch_mach, + coff_set_section_contents, /* Link */ - _bfd_xcoff_sizeof_headers, /* _sizeof_headers */ - /* _bfd_get_relocated_section_contents */ + _bfd_xcoff_sizeof_headers, bfd_generic_get_relocated_section_contents, - bfd_generic_relax_section, /* _bfd_relax_section */ - _bfd_xcoff_bfd_link_hash_table_create, /* _bfd_link_hash_table_create */ - _bfd_generic_link_hash_table_free, /* _bfd_link_hash_table_free */ - _bfd_xcoff_bfd_link_add_symbols, /* _bfd_link_add_symbols */ - _bfd_generic_link_just_syms, /* _bfd_link_just_syms */ - _bfd_xcoff_bfd_final_link, /* _bfd_final_link */ - _bfd_generic_link_split_section, /* _bfd_link_split_section */ - bfd_generic_gc_sections, /* _bfd_gc_sections */ - bfd_generic_merge_sections, /* _bfd_merge_sections */ - bfd_generic_discard_group, /* _bfd_discard_group */ + bfd_generic_relax_section, + _bfd_xcoff_bfd_link_hash_table_create, + _bfd_generic_link_hash_table_free, + _bfd_xcoff_bfd_link_add_symbols, + _bfd_generic_link_just_syms, + _bfd_xcoff_bfd_final_link, + _bfd_generic_link_split_section, + bfd_generic_gc_sections, + bfd_generic_merge_sections, + bfd_generic_discard_group, /* Dynamic */ - /* _get_dynamic_symtab_upper_bound */ _bfd_xcoff_get_dynamic_symtab_upper_bound, - _bfd_xcoff_canonicalize_dynamic_symtab, /* _cononicalize_dynamic_symtab */ - _bfd_xcoff_get_dynamic_reloc_upper_bound,/* _get_dynamic_reloc_upper_bound */ - _bfd_xcoff_canonicalize_dynamic_reloc, /* _cononicalize_dynamic_reloc */ + _bfd_xcoff_canonicalize_dynamic_symtab, + _bfd_xcoff_get_dynamic_reloc_upper_bound, + _bfd_xcoff_canonicalize_dynamic_reloc, /* Opposite endian version, none exists */ NULL, - /* back end data */ (void *) &bfd_xcoff_backend_data, }; -/* - * xcoff-powermac target - * Old target. - * Only difference between this target and the rs6000 target is the - * the default architecture and machine type used in coffcode.h - * - * PowerPC Macs use the same magic numbers as RS/6000 - * (because that's how they were bootstrapped originally), - * but they are always PowerPC architecture. - */ +/* xcoff-powermac target + Old target. + Only difference between this target and the rs6000 target is the + the default architecture and machine type used in coffcode.h + + PowerPC Macs use the same magic numbers as RS/6000 + (because that's how they were bootstrapped originally), + but they are always PowerPC architecture. */ static const struct xcoff_backend_data_rec bfd_pmac_xcoff_backend_data = { - { /* COFF backend, defined in libcoff.h */ - _bfd_xcoff_swap_aux_in, /* _bfd_coff_swap_aux_in */ - _bfd_xcoff_swap_sym_in, /* _bfd_coff_swap_sym_in */ - coff_swap_lineno_in, /* _bfd_coff_swap_lineno_in */ - _bfd_xcoff_swap_aux_out, /* _bfd_swap_aux_out */ - _bfd_xcoff_swap_sym_out, /* _bfd_swap_sym_out */ - coff_swap_lineno_out, /* _bfd_swap_lineno_out */ - xcoff_swap_reloc_out, /* _bfd_swap_reloc_out */ - coff_swap_filehdr_out, /* _bfd_swap_filehdr_out */ - coff_swap_aouthdr_out, /* _bfd_swap_aouthdr_out */ - coff_swap_scnhdr_out, /* _bfd_swap_scnhdr_out */ - FILHSZ, /* _bfd_filhsz */ - AOUTSZ, /* _bfd_aoutsz */ - SCNHSZ, /* _bfd_scnhsz */ - SYMESZ, /* _bfd_symesz */ - AUXESZ, /* _bfd_auxesz */ - RELSZ, /* _bfd_relsz */ - LINESZ, /* _bfd_linesz */ - FILNMLEN, /* _bfd_filnmlen */ + { /* COFF backend, defined in libcoff.h. */ + _bfd_xcoff_swap_aux_in, + _bfd_xcoff_swap_sym_in, + coff_swap_lineno_in, + _bfd_xcoff_swap_aux_out, + _bfd_xcoff_swap_sym_out, + coff_swap_lineno_out, + xcoff_swap_reloc_out, + coff_swap_filehdr_out, + coff_swap_aouthdr_out, + coff_swap_scnhdr_out, + FILHSZ, + AOUTSZ, + SCNHSZ, + SYMESZ, + AUXESZ, + RELSZ, + LINESZ, + FILNMLEN, true, /* _bfd_coff_long_filenames */ false, /* _bfd_coff_long_section_names */ - (3), /* _bfd_coff_default_section_alignment_power */ + 3, /* _bfd_coff_default_section_alignment_power */ false, /* _bfd_coff_force_symnames_in_strings */ 2, /* _bfd_coff_debug_string_prefix_length */ - coff_swap_filehdr_in, /* _bfd_coff_swap_filehdr_in */ - coff_swap_aouthdr_in, /* _bfd_swap_aouthdr_in */ - coff_swap_scnhdr_in, /* _bfd_swap_scnhdr_in */ - xcoff_swap_reloc_in, /* _bfd_reloc_in */ - coff_bad_format_hook, /* _bfd_bad_format_hook */ - coff_set_arch_mach_hook, /* _bfd_set_arch_mach_hook */ - coff_mkobject_hook, /* _bfd_mkobject_hook */ - styp_to_sec_flags, /* _bfd_syp_to_sec_flags */ - coff_set_alignment_hook, /* _bfd_set_alignment_hook */ - coff_slurp_symbol_table, /* _bfd_coff_slurp_symbol_table */ - symname_in_debug_hook, /* _coff_symname_in_debug_hook */ - coff_pointerize_aux_hook, /* _bfd_coff_pointerize_aux_hook */ - coff_print_aux, /* bfd_coff_print_aux */ - dummy_reloc16_extra_cases, /* _bfd_coff_reloc16_extra_cases */ - dummy_reloc16_estimate, /* _bfd_coff_reloc16_estimate */ + coff_swap_filehdr_in, + coff_swap_aouthdr_in, + coff_swap_scnhdr_in, + xcoff_swap_reloc_in, + coff_bad_format_hook, + coff_set_arch_mach_hook, + coff_mkobject_hook, + styp_to_sec_flags, + coff_set_alignment_hook, + coff_slurp_symbol_table, + symname_in_debug_hook, + coff_pointerize_aux_hook, + coff_print_aux, + dummy_reloc16_extra_cases, + dummy_reloc16_estimate, NULL, /* bfd_coff_sym_is_global */ - /* _bfd_coff_compute_section_file_positions */ coff_compute_section_file_positions, NULL, /* _bfd_coff_start_final_link */ - xcoff_ppc_relocate_section, /* _bfd_coff_relocate_section */ - coff_rtype_to_howto, /* _bfd_coff_rtype_to_howto */ - NULL, /* _bfd_coff_addust_symndx */ - _bfd_generic_link_add_one_symbol, /* _bfd_coff_add_one_symbol */ - coff_link_output_has_begun, /* _bfd_coff_link_output_has_begun */ - coff_final_link_postscript /* _bfd_coff_final_link_postscript */ + xcoff_ppc_relocate_section, + coff_rtype_to_howto, + NULL, /* _bfd_coff_adjust_symndx */ + _bfd_generic_link_add_one_symbol, + coff_link_output_has_begun, + coff_final_link_postscript }, 0x01DF, /* magic number */ - bfd_arch_powerpc, /* architecture */ - bfd_mach_ppc, /* machine */ + bfd_arch_powerpc, + bfd_mach_ppc, - /* function pointers to xcoff specific swap routines */ - xcoff_swap_ldhdr_in, /* _xcoff_swap_ldhdr_in */ - xcoff_swap_ldhdr_out, /* _xcoff_swap_ldhdr_out */ - xcoff_swap_ldsym_in, /* _xcoff_swap_ldsym_in */ - xcoff_swap_ldsym_out, /* _xcoff_swap_ldsym_out */ - xcoff_swap_ldrel_in, /* _xcoff_swap_ldrel_in */ - xcoff_swap_ldrel_out, /* _xcoff_swap_ldrel_out */ - - /* sizes */ - LDHDRSZ, /* _xcoff_ldhdrsz */ - LDSYMSZ, /* _xcoff_ldsymsz */ - LDRELSZ, /* _xcoff_ldrelsz */ + /* Function pointers to xcoff specific swap routines. */ + xcoff_swap_ldhdr_in, + xcoff_swap_ldhdr_out, + xcoff_swap_ldsym_in, + xcoff_swap_ldsym_out, + xcoff_swap_ldrel_in, + xcoff_swap_ldrel_out, + + /* Sizes. */ + LDHDRSZ, + LDSYMSZ, + LDRELSZ, 12, /* _xcoff_function_descriptor_size */ - SMALL_AOUTSZ, /* _xcoff_small_aout_header_size */ + SMALL_AOUTSZ, - /* versions */ + /* Versions. */ 1, /* _xcoff_ldhdr_version */ - /* xcoff vs xcoff64 putting symbol names */ - _bfd_xcoff_put_symbol_name, /* _xcoff_put_symbol_name */ - _bfd_xcoff_put_ldsymbol_name, /* _xcoff_put_ldsymbol_name */ + _bfd_xcoff_put_symbol_name, + _bfd_xcoff_put_ldsymbol_name, + &xcoff_dynamic_reloc, + xcoff_create_csect_from_smclas, - &xcoff_dynamic_reloc, /* dynamic reloc howto */ - - xcoff_create_csect_from_smclas, /* _xcoff_create_csect_from_smclas */ - - /* lineno and reloc count overflow */ + /* Lineno and reloc count overflow. */ xcoff_is_lineno_count_overflow, xcoff_is_reloc_count_overflow, xcoff_loader_symbol_offset, xcoff_loader_reloc_offset, - /* glink */ + /* glink. */ &xcoff_glink_code[0], - (36), /* _xcoff_glink_size */ + 36, /* _xcoff_glink_size */ /* rtinit */ 0, /* _xcoff_rtinit_size */ - xcoff_generate_rtinit, /* _xcoff_generate_rtinit */ + xcoff_generate_rtinit, }; /* The transfer vector that leads the outside world to all of the above. */ @@ -4318,36 +4292,35 @@ const bfd_target pmac_xcoff_vec = BFD_ENDIAN_BIG, /* data byte order is big */ BFD_ENDIAN_BIG, /* header byte order is big */ - (HAS_RELOC | EXEC_P | /* object flags */ - HAS_LINENO | HAS_DEBUG | DYNAMIC | - HAS_SYMS | HAS_LOCALS | WP_TEXT), + (HAS_RELOC | EXEC_P | HAS_LINENO | HAS_DEBUG | DYNAMIC + | HAS_SYMS | HAS_LOCALS | WP_TEXT), - (SEC_HAS_CONTENTS | SEC_ALLOC | SEC_LOAD | SEC_RELOC), /* section flags */ + (SEC_HAS_CONTENTS | SEC_ALLOC | SEC_LOAD | SEC_RELOC), 0, /* leading char */ '/', /* ar_pad_char */ - 15, /* ar_max_namelen??? FIXMEmgo */ + 15, /* ar_max_namelen */ /* data */ - bfd_getb64, /* bfd_getx64 */ - bfd_getb_signed_64, /* bfd_getx_signed_64 */ - bfd_putb64, /* bfd_putx64 */ - bfd_getb32, /* bfd_getx32 */ - bfd_getb_signed_32, /* bfd_getx_signed_32 */ - bfd_putb32, /* bfd_putx32 */ - bfd_getb16, /* bfd_getx16 */ - bfd_getb_signed_16, /* bfd_getx_signed_16 */ - bfd_putb16, /* bfd_putx16 */ + bfd_getb64, + bfd_getb_signed_64, + bfd_putb64, + bfd_getb32, + bfd_getb_signed_32, + bfd_putb32, + bfd_getb16, + bfd_getb_signed_16, + bfd_putb16, /* hdrs */ - bfd_getb64, /* bfd_h_getx64 */ - bfd_getb_signed_64, /* bfd_h_getx_signed_64 */ - bfd_putb64, /* bfd_h_putx64 */ - bfd_getb32, /* bfd_h_getx32 */ - bfd_getb_signed_32, /* bfd_h_getx_signed_32 */ - bfd_putb32, /* bfd_h_putx32 */ - bfd_getb16, /* bfd_h_getx16 */ - bfd_getb_signed_16, /* bfd_h_getx_signed_16 */ - bfd_putb16, /* bfd_h_putx16 */ + bfd_getb64, + bfd_getb_signed_64, + bfd_putb64, + bfd_getb32, + bfd_getb_signed_32, + bfd_putb32, + bfd_getb16, + bfd_getb_signed_16, + bfd_putb16, { /* bfd_check_format */ _bfd_dummy_target, @@ -4371,95 +4344,81 @@ const bfd_target pmac_xcoff_vec = }, /* Generic */ - bfd_true, /* _close_and_cleanup */ - bfd_true, /* _bfd_free_cached_info */ - coff_new_section_hook, /* _new_section_hook */ - _bfd_generic_get_section_contents, /* _bfd_get_section_contents */ - /* _bfd_get_section_contents_in_window */ + bfd_true, + bfd_true, + coff_new_section_hook, + _bfd_generic_get_section_contents, _bfd_generic_get_section_contents_in_window, /* Copy */ - _bfd_xcoff_copy_private_bfd_data, /* _bfd_copy_private_bfd */ - /* _bfd_merge_private_bfd_data */ + _bfd_xcoff_copy_private_bfd_data, ((boolean (*) (bfd *, bfd *)) bfd_true), - /* _bfd_copy_pivate_section_data */ ((boolean (*) (bfd *, asection *, bfd *, asection *)) bfd_true), - /* _bfd_copy_private_symbol_data */ ((boolean (*) (bfd *, asymbol *, bfd *, asymbol *)) bfd_true), - ((boolean (*) (bfd *, flagword)) bfd_true), /* _bfd_set_private_flags */ - ((boolean (*) (bfd *, void * )) bfd_true), /* _bfd_print_private_bfd_data */ + ((boolean (*) (bfd *, flagword)) bfd_true), + ((boolean (*) (bfd *, void * )) bfd_true), /* Core */ - coff_core_file_failing_command, /* _core_file_failing_command */ - coff_core_file_failing_signal, /* _core_file_failing_signal */ - /* _core_file_matches_executable_p */ + coff_core_file_failing_command, + coff_core_file_failing_signal, coff_core_file_matches_executable_p, /* Archive */ - _bfd_xcoff_slurp_armap, /* _slurp_armap */ - /* XCOFF archives do not have - anything which corresponds to - an extended name table. */ - bfd_false, /* _slurp_extended_name_table */ - /* _construct_extended_name_table */ + _bfd_xcoff_slurp_armap, + bfd_false, ((boolean (*) (bfd *, char **, bfd_size_type *, const char **)) bfd_false), - bfd_dont_truncate_arname, /* _truncate_arname */ - _bfd_xcoff_write_armap, /* _write_armap */ - _bfd_xcoff_read_ar_hdr, /* _read_ar_hdr */ - _bfd_xcoff_openr_next_archived_file, /* _openr_next_archived_file */ - _bfd_generic_get_elt_at_index, /* _get_elt_at_index */ - _bfd_xcoff_stat_arch_elt, /* _generic_stat_arch_elt */ - /* XCOFF archives do not have - a timestamp. */ - bfd_true, /* _update_armap_timestamp */ + bfd_dont_truncate_arname, + _bfd_xcoff_write_armap, + _bfd_xcoff_read_ar_hdr, + _bfd_xcoff_openr_next_archived_file, + _bfd_generic_get_elt_at_index, + _bfd_xcoff_stat_arch_elt, + bfd_true, /* Symbols */ - coff_get_symtab_upper_bound, /* _get_symtab_upper_bound */ - coff_get_symtab, /* _get_symtab */ - coff_make_empty_symbol, /* _make_empty_symbol */ - coff_print_symbol, /* _print_symbol */ - coff_get_symbol_info, /* _get_symbol_info */ - _bfd_xcoff_is_local_label_name, /* _bfd_is_local_label_name */ - coff_get_lineno, /* _get_lineno */ - coff_find_nearest_line, /* _find_nearest_line */ - coff_bfd_make_debug_symbol, /* _bfd_make_debug_symbol */ - _bfd_generic_read_minisymbols, /* _read_minisymbols */ - _bfd_generic_minisymbol_to_symbol, /* _minsymbol_to_symbol */ + coff_get_symtab_upper_bound, + coff_get_symtab, + coff_make_empty_symbol, + coff_print_symbol, + coff_get_symbol_info, + _bfd_xcoff_is_local_label_name, + coff_get_lineno, + coff_find_nearest_line, + coff_bfd_make_debug_symbol, + _bfd_generic_read_minisymbols, + _bfd_generic_minisymbol_to_symbol, /* Reloc */ - coff_get_reloc_upper_bound, /* _get_reloc_upper_bound */ - coff_canonicalize_reloc, /* _cononicalize_reloc */ - _bfd_xcoff_reloc_type_lookup, /* _bfd_reloc_type_lookup */ + coff_get_reloc_upper_bound, + coff_canonicalize_reloc, + _bfd_xcoff_reloc_type_lookup, /* Write */ - coff_set_arch_mach, /* _set_arch_mach */ - coff_set_section_contents, /* _set_section_contents */ + coff_set_arch_mach, + coff_set_section_contents, /* Link */ - _bfd_xcoff_sizeof_headers, /* _sizeof_headers */ - /* _bfd_get_relocated_section_contents */ + _bfd_xcoff_sizeof_headers, bfd_generic_get_relocated_section_contents, - bfd_generic_relax_section, /* _bfd_relax_section */ - _bfd_xcoff_bfd_link_hash_table_create, /* _bfd_link_hash_table_create */ - _bfd_generic_link_hash_table_free, /* _bfd_link_hash_table_free */ - _bfd_xcoff_bfd_link_add_symbols, /* _bfd_link_add_symbols */ - _bfd_generic_link_just_syms, /* _bfd_link_just_syms */ - _bfd_xcoff_bfd_final_link, /* _bfd_final_link */ - _bfd_generic_link_split_section, /* _bfd_link_split_section */ - bfd_generic_gc_sections, /* _bfd_gc_sections */ - bfd_generic_merge_sections, /* _bfd_merge_sections */ - bfd_generic_discard_group, /* _bfd_discard_group */ + bfd_generic_relax_section, + _bfd_xcoff_bfd_link_hash_table_create, + _bfd_generic_link_hash_table_free, + _bfd_xcoff_bfd_link_add_symbols, + _bfd_generic_link_just_syms, + _bfd_xcoff_bfd_final_link, + _bfd_generic_link_split_section, + bfd_generic_gc_sections, + bfd_generic_merge_sections, + bfd_generic_discard_group, /* Dynamic */ - /* _get_dynamic_symtab_upper_bound */ _bfd_xcoff_get_dynamic_symtab_upper_bound, - _bfd_xcoff_canonicalize_dynamic_symtab, /* _cononicalize_dynamic_symtab */ - _bfd_xcoff_get_dynamic_reloc_upper_bound,/* _get_dynamic_reloc_upper_bound */ - _bfd_xcoff_canonicalize_dynamic_reloc, /* _cononicalize_dynamic_reloc */ + _bfd_xcoff_canonicalize_dynamic_symtab, + _bfd_xcoff_get_dynamic_reloc_upper_bound, + _bfd_xcoff_canonicalize_dynamic_reloc, /* Opposite endian version, none exists */ NULL, - /* back end data */ (void *) &bfd_pmac_xcoff_backend_data, }; diff -Nurpa binutils-2.13/bfd/coff64-rs6000.c binutils-2.13.1/bfd/coff64-rs6000.c --- binutils-2.13/bfd/coff64-rs6000.c 2002-06-25 02:21:47.000000000 -0400 +++ binutils-2.13.1/bfd/coff64-rs6000.c 2002-09-23 18:12:38.000000000 -0400 @@ -156,7 +156,7 @@ static boolean xcoff64_bad_format_hook P static boolean xcoff64_reloc_type_br PARAMS ((XCOFF_RELOC_FUNCTION_ARGS)); boolean (*xcoff64_calculate_relocation[XCOFF_MAX_CALCULATE_RELOCATION]) - (XCOFF_RELOC_FUNCTION_ARGS) = + PARAMS ((XCOFF_RELOC_FUNCTION_ARGS)) = { xcoff_reloc_type_pos, /* R_POS (0x00) */ xcoff_reloc_type_neg, /* R_NEG (0x01) */ @@ -886,9 +886,11 @@ xcoff64_write_object_contents (abfd) memset (&internal_a, 0, sizeof internal_a); internal_f.f_magic = bfd_xcoff_magic_number (abfd); - internal_a.magic = (abfd->flags & D_PAGED) ? RS6K_AOUTHDR_ZMAGIC : - (abfd->flags & WP_TEXT) ? RS6K_AOUTHDR_NMAGIC : - RS6K_AOUTHDR_OMAGIC; + internal_a.magic = (abfd->flags & D_PAGED + ? RS6K_AOUTHDR_ZMAGIC + : (abfd->flags & WP_TEXT + ? RS6K_AOUTHDR_NMAGIC + : RS6K_AOUTHDR_OMAGIC)); /* FIXME: Does anybody ever set this to another value? */ internal_a.vstamp = 0; @@ -1096,8 +1098,8 @@ xcoff64_reloc_type_br (input_bfd, input_ cror. */ if (NULL != h && bfd_link_hash_defined == h->root.type - && (rel->r_vaddr - input_section->vma + 8 <= - input_section->_cooked_size)) + && (rel->r_vaddr - input_section->vma + 8 + <= input_section->_cooked_size)) { bfd_byte *pnext; unsigned long next; @@ -1139,8 +1141,8 @@ xcoff64_reloc_type_br (input_bfd, input_ addend += input_section->vma; *relocation = val + addend; - *relocation -= (input_section->output_section->vma + - input_section->output_offset); + *relocation -= (input_section->output_section->vma + + input_section->output_offset); return true; } @@ -1191,8 +1193,9 @@ xcoff64_ppc_relocate_section (output_bfd howto.size = howto.bitsize > 16 ? (howto.bitsize > 32 ? 4 : 2) : 1; howto.pc_relative = false; howto.bitpos = 0; - howto.complain_on_overflow = rel->r_size & 0x80 ? - complain_overflow_signed : complain_overflow_bitfield; + howto.complain_on_overflow = (rel->r_size & 0x80 + ? complain_overflow_signed + : complain_overflow_bitfield); howto.special_function = NULL; howto.name = "internal"; howto.partial_inplace = true; @@ -1260,7 +1263,7 @@ xcoff64_ppc_relocate_section (output_bfd } if (rel->r_type >= XCOFF_MAX_CALCULATE_RELOCATION - || (false == xcoff64_calculate_relocation[rel->r_type] + || ((*xcoff64_calculate_relocation[rel->r_type]) (input_bfd, input_section, output_bfd, rel, sym, &howto, val, addend, &relocation, contents))) return false; @@ -1287,11 +1290,11 @@ xcoff64_ppc_relocate_section (output_bfd operation, which would be tedious, or we must do the computations in a type larger than bfd_vma, which would be inefficient. */ - if ((unsigned int) howto.complain_on_overflow >= - XCOFF_MAX_COMPLAIN_OVERFLOW) + if ((unsigned int) howto.complain_on_overflow + >= XCOFF_MAX_COMPLAIN_OVERFLOW) abort(); - if ((true == xcoff_complain_overflow[howto.complain_on_overflow] + if (((*xcoff_complain_overflow[howto.complain_on_overflow]) (input_bfd, value_to_relocate, relocation, &howto))) { const char *name; @@ -1321,9 +1324,9 @@ xcoff64_ppc_relocate_section (output_bfd } /* Add RELOCATION to the right bits of VALUE_TO_RELOCATE. */ - value_to_relocate = ((value_to_relocate & ~howto.dst_mask) | - (((value_to_relocate & howto.src_mask) + - relocation) & howto.dst_mask)); + value_to_relocate = ((value_to_relocate & ~howto.dst_mask) + | (((value_to_relocate & howto.src_mask) + + relocation) & howto.dst_mask)); /* Put the value back in the object file. */ if (1 == howto.size) @@ -1424,7 +1427,7 @@ reloc_howto_type xcoff64_howto_table[] = /* External TOC relative symbol. */ HOWTO (R_GL, /* type */ 0, /* rightshift */ - 2, /* size (0 = byte, 1 = short, 2 = long) */ + 1, /* size (0 = byte, 1 = short, 2 = long) */ 16, /* bitsize */ false, /* pc_relative */ 0, /* bitpos */ @@ -1439,7 +1442,7 @@ reloc_howto_type xcoff64_howto_table[] = /* Local TOC relative symbol. */ HOWTO (R_TCL, /* type */ 0, /* rightshift */ - 2, /* size (0 = byte, 1 = short, 2 = long) */ + 1, /* size (0 = byte, 1 = short, 2 = long) */ 16, /* bitsize */ false, /* pc_relative */ 0, /* bitpos */ @@ -1490,7 +1493,7 @@ reloc_howto_type xcoff64_howto_table[] = /* Indirect load. */ HOWTO (R_RL, /* type */ 0, /* rightshift */ - 2, /* size (0 = byte, 1 = short, 2 = long) */ + 1, /* size (0 = byte, 1 = short, 2 = long) */ 16, /* bitsize */ false, /* pc_relative */ 0, /* bitpos */ @@ -1505,7 +1508,7 @@ reloc_howto_type xcoff64_howto_table[] = /* Load address. */ HOWTO (R_RLA, /* type */ 0, /* rightshift */ - 2, /* size (0 = byte, 1 = short, 2 = long) */ + 1, /* size (0 = byte, 1 = short, 2 = long) */ 16, /* bitsize */ false, /* pc_relative */ 0, /* bitpos */ @@ -1526,7 +1529,7 @@ reloc_howto_type xcoff64_howto_table[] = 32, /* bitsize */ false, /* pc_relative */ 0, /* bitpos */ - complain_overflow_bitfield, /* complain_on_overflow */ + complain_overflow_dont, /* complain_on_overflow */ 0, /* special_function */ "R_REF", /* name */ false, /* partial_inplace */ @@ -1540,7 +1543,7 @@ reloc_howto_type xcoff64_howto_table[] = /* TOC relative indirect load. */ HOWTO (R_TRL, /* type */ 0, /* rightshift */ - 2, /* size (0 = byte, 1 = short, 2 = long) */ + 1, /* size (0 = byte, 1 = short, 2 = long) */ 16, /* bitsize */ false, /* pc_relative */ 0, /* bitpos */ @@ -1555,7 +1558,7 @@ reloc_howto_type xcoff64_howto_table[] = /* TOC relative load address. */ HOWTO (R_TRLA, /* type */ 0, /* rightshift */ - 2, /* size (0 = byte, 1 = short, 2 = long) */ + 1, /* size (0 = byte, 1 = short, 2 = long) */ 16, /* bitsize */ false, /* pc_relative */ 0, /* bitpos */ @@ -1600,7 +1603,7 @@ reloc_howto_type xcoff64_howto_table[] = /* Modifiable call absolute indirect. */ HOWTO (R_CAI, /* type */ 0, /* rightshift */ - 2, /* size (0 = byte, 1 = short, 2 = long) */ + 1, /* size (0 = byte, 1 = short, 2 = long) */ 16, /* bitsize */ false, /* pc_relative */ 0, /* bitpos */ @@ -1615,7 +1618,7 @@ reloc_howto_type xcoff64_howto_table[] = /* Modifiable call relative. */ HOWTO (R_CREL, /* type */ 0, /* rightshift */ - 2, /* size (0 = byte, 1 = short, 2 = long) */ + 1, /* size (0 = byte, 1 = short, 2 = long) */ 16, /* bitsize */ false, /* pc_relative */ 0, /* bitpos */ @@ -1638,8 +1641,8 @@ reloc_howto_type xcoff64_howto_table[] = 0, /* special_function */ "R_RBA", /* name */ true, /* partial_inplace */ - 0xffff, /* src_mask */ - 0xffff, /* dst_mask */ + 0x03fffffc, /* src_mask */ + 0x03fffffc, /* dst_mask */ false), /* pcrel_offset */ /* Modifiable branch absolute. */ @@ -1653,8 +1656,8 @@ reloc_howto_type xcoff64_howto_table[] = 0, /* special_function */ "R_RBAC", /* name */ true, /* partial_inplace */ - 0xffff, /* src_mask */ - 0xffff, /* dst_mask */ + 0xffffffff, /* src_mask */ + 0xffffffff, /* dst_mask */ false), /* pcrel_offset */ /* Modifiable branch relative. */ @@ -1668,14 +1671,14 @@ reloc_howto_type xcoff64_howto_table[] = 0, /* special_function */ "R_RBR_26", /* name */ true, /* partial_inplace */ - 0xffff, /* src_mask */ - 0xffff, /* dst_mask */ + 0x03fffffc, /* src_mask */ + 0x03fffffc, /* dst_mask */ false), /* pcrel_offset */ /* Modifiable branch absolute. */ HOWTO (R_RBRC, /* type */ 0, /* rightshift */ - 2, /* size (0 = byte, 1 = short, 2 = long) */ + 1, /* size (0 = byte, 1 = short, 2 = long) */ 16, /* bitsize */ false, /* pc_relative */ 0, /* bitpos */ @@ -1785,10 +1788,6 @@ xcoff64_rtype2howto (relent, internal) && (relent->howto->bitsize != ((unsigned int) internal->r_size & 0x3f) + 1)) abort (); - - /* Put a meaningful value in addend */ - relent->addend = (internal->r_size & 0x80) ? - internal->r_vaddr - : internal->r_vaddr; } reloc_howto_type * @@ -1840,7 +1839,8 @@ xcoff64_slurp_armap (abfd) return true; } - off = strtol (xcoff_ardata_big (abfd)->symoff64, (char **) NULL, 10); + off = bfd_scan_vma (xcoff_ardata_big (abfd)->symoff64, + (const char **) NULL, 10); if (off == 0) { bfd_has_map (abfd) = false; @@ -1861,10 +1861,7 @@ xcoff64_slurp_armap (abfd) if (bfd_seek (abfd, pos, SEEK_CUR) != 0) return false; - /* XXX This actually has to be a call to strtoll (at least on 32-bit - machines) since the field width is 20 and there numbers with more - than 32 bits can be represented. */ - sz = strtol (hdr.size, (char **) NULL, 10); + sz = bfd_scan_vma (hdr.size, (const char **) NULL, 10); /* Read in the entire symbol table. */ contents = (bfd_byte *) bfd_alloc (abfd, sz); @@ -1920,6 +1917,7 @@ static const bfd_target * xcoff64_archive_p (abfd) bfd *abfd; { + struct artdata *tdata_hold; char magic[SXCOFFARMAG]; /* This is the new format. */ struct xcoff_ar_file_hdr_big hdr; @@ -1938,50 +1936,46 @@ xcoff64_archive_p (abfd) return NULL; } - /* We are setting bfd_ardata(abfd) here, but since bfd_ardata - involves a cast, we can't do it as the left operand of - assignment. */ - amt = sizeof (struct artdata); - abfd->tdata.aout_ar_data = (struct artdata *) bfd_zalloc (abfd, amt); - - if (bfd_ardata (abfd) == (struct artdata *) NULL) - return NULL; - - bfd_ardata (abfd)->cache = NULL; - bfd_ardata (abfd)->archive_head = NULL; - bfd_ardata (abfd)->symdefs = NULL; - bfd_ardata (abfd)->extended_names = NULL; - /* Copy over the magic string. */ memcpy (hdr.magic, magic, SXCOFFARMAG); /* Now read the rest of the file header. */ - if (bfd_bread ((PTR) &hdr.memoff, - (bfd_size_type) (SIZEOF_AR_FILE_HDR_BIG - SXCOFFARMAG), - abfd) != SIZEOF_AR_FILE_HDR_BIG - SXCOFFARMAG) + amt = SIZEOF_AR_FILE_HDR_BIG - SXCOFFARMAG; + if (bfd_bread ((PTR) &hdr.memoff, amt, abfd) != amt) { if (bfd_get_error () != bfd_error_system_call) bfd_set_error (bfd_error_wrong_format); return NULL; } - /* XXX This actually has to be a call to strtoll (at least on 32-bit - machines) since the field width is 20 and there numbers with more - than 32 bits can be represented. */ - bfd_ardata (abfd)->first_file_filepos = strtol (hdr.firstmemoff, - (char **) NULL, 10); + tdata_hold = bfd_ardata (abfd); + + amt = sizeof (struct artdata); + bfd_ardata (abfd) = (struct artdata *) bfd_zalloc (abfd, amt); + if (bfd_ardata (abfd) == (struct artdata *) NULL) + goto error_ret_restore; + + bfd_ardata (abfd)->cache = NULL; + bfd_ardata (abfd)->archive_head = NULL; + bfd_ardata (abfd)->symdefs = NULL; + bfd_ardata (abfd)->extended_names = NULL; + bfd_ardata (abfd)->first_file_filepos = bfd_scan_vma (hdr.firstmemoff, + (const char **) NULL, + 10); amt = SIZEOF_AR_FILE_HDR_BIG; bfd_ardata (abfd)->tdata = bfd_zalloc (abfd, amt); if (bfd_ardata (abfd)->tdata == NULL) - return NULL; + goto error_ret; memcpy (bfd_ardata (abfd)->tdata, &hdr, SIZEOF_AR_FILE_HDR_BIG); if (! xcoff64_slurp_armap (abfd)) { + error_ret: bfd_release (abfd, bfd_ardata (abfd)); - abfd->tdata.aout_ar_data = (struct artdata *) NULL; + error_ret_restore: + bfd_ardata (abfd) = tdata_hold; return NULL; } @@ -2011,20 +2005,15 @@ xcoff64_openr_next_archived_file (archiv } else { - /* XXX These actually have to be a calls to strtoll (at least - on 32-bit machines) since the fields's width is 20 and - there numbers with more than 32 bits can be represented. */ - filestart = strtol (arch_xhdr_big (last_file)->nextoff, (char **) NULL, - 10); - } - /* XXX These actually have to be calls to strtoll (at least on 32-bit - machines) since the fields's width is 20 and there numbers with more - than 32 bits can be represented. */ + filestart = bfd_scan_vma (arch_xhdr_big (last_file)->nextoff, + (const char **) NULL, 10); + } + if (filestart == 0 - || filestart == strtol (xcoff_ardata_big (archive)->memoff, - (char **) NULL, 10) - || filestart == strtol (xcoff_ardata_big (archive)->symoff, - (char **) NULL, 10)) + || filestart == bfd_scan_vma (xcoff_ardata_big (archive)->memoff, + (const char **) NULL, 10) + || filestart == bfd_scan_vma (xcoff_ardata_big (archive)->symoff, + (const char **) NULL, 10)) { bfd_set_error (bfd_error_no_more_archived_files); return NULL; @@ -2297,7 +2286,7 @@ xcoff64_generate_rtinit (abfd, init, fin string_table_size += strlen (rtinit_name) + 1; string_table_size += initsz; string_table_size += finisz; - if (true == rtld) + if (rtld) string_table_size += strlen (rtld_name) + 1; string_table = (bfd_byte *) bfd_zmalloc (string_table_size); @@ -2503,85 +2492,80 @@ static unsigned long xcoff64_glink_code[ static const struct xcoff_backend_data_rec bfd_xcoff_backend_data = { { /* COFF backend, defined in libcoff.h. */ - _bfd_xcoff64_swap_aux_in, /* _bfd_coff_swap_aux_in */ - _bfd_xcoff64_swap_sym_in, /* _bfd_coff_swap_sym_in */ - _bfd_xcoff64_swap_lineno_in, /* _bfd_coff_swap_lineno_in */ - _bfd_xcoff64_swap_aux_out, /* _bfd_swap_aux_out */ - _bfd_xcoff64_swap_sym_out, /* _bfd_swap_sym_out */ - _bfd_xcoff64_swap_lineno_out, /* _bfd_swap_lineno_out */ - xcoff64_swap_reloc_out, /* _bfd_swap_reloc_out */ - coff_swap_filehdr_out, /* _bfd_swap_filehdr_out */ - coff_swap_aouthdr_out, /* _bfd_swap_aouthdr_out */ - coff_swap_scnhdr_out, /* _bfd_swap_scnhdr_out */ - FILHSZ, /* _bfd_filhsz */ - AOUTSZ, /* _bfd_aoutsz */ - SCNHSZ, /* _bfd_scnhsz */ - SYMESZ, /* _bfd_symesz */ - AUXESZ, /* _bfd_auxesz */ - RELSZ, /* _bfd_relsz */ - LINESZ, /* _bfd_linesz */ - FILNMLEN, /* _bfd_filnmlen */ + _bfd_xcoff64_swap_aux_in, + _bfd_xcoff64_swap_sym_in, + _bfd_xcoff64_swap_lineno_in, + _bfd_xcoff64_swap_aux_out, + _bfd_xcoff64_swap_sym_out, + _bfd_xcoff64_swap_lineno_out, + xcoff64_swap_reloc_out, + coff_swap_filehdr_out, + coff_swap_aouthdr_out, + coff_swap_scnhdr_out, + FILHSZ, + AOUTSZ, + SCNHSZ, + SYMESZ, + AUXESZ, + RELSZ, + LINESZ, + FILNMLEN, true, /* _bfd_coff_long_filenames */ false, /* _bfd_coff_long_section_names */ - (3), /* _bfd_coff_default_section_alignment_power */ + 3, /* _bfd_coff_default_section_alignment_power */ true, /* _bfd_coff_force_symnames_in_strings */ 4, /* _bfd_coff_debug_string_prefix_length */ - coff_swap_filehdr_in, /* _bfd_coff_swap_filehdr_in */ - coff_swap_aouthdr_in, /* _bfd_swap_aouthdr_in */ - coff_swap_scnhdr_in, /* _bfd_swap_scnhdr_in */ - xcoff64_swap_reloc_in, /* _bfd_reloc_in */ - xcoff64_bad_format_hook, /* _bfd_bad_format_hook */ - coff_set_arch_mach_hook, /* _bfd_set_arch_mach_hook */ - coff_mkobject_hook, /* _bfd_mkobject_hook */ - styp_to_sec_flags, /* _bfd_syp_to_sec_flags */ - coff_set_alignment_hook, /* _bfd_set_alignment_hook */ - coff_slurp_symbol_table, /* _bfd_coff_slurp_symbol_table */ - symname_in_debug_hook, /* _coff_symname_in_debug_hook */ - coff_pointerize_aux_hook, /* _bfd_coff_pointerize_aux_hook */ - coff_print_aux, /* bfd_coff_print_aux */ - dummy_reloc16_extra_cases, /* _bfd_coff_reloc16_extra_cases */ - dummy_reloc16_estimate, /* _bfd_coff_reloc16_estimate */ + coff_swap_filehdr_in, + coff_swap_aouthdr_in, + coff_swap_scnhdr_in, + xcoff64_swap_reloc_in, + xcoff64_bad_format_hook, + coff_set_arch_mach_hook, + coff_mkobject_hook, + styp_to_sec_flags, + coff_set_alignment_hook, + coff_slurp_symbol_table, + symname_in_debug_hook, + coff_pointerize_aux_hook, + coff_print_aux, + dummy_reloc16_extra_cases, + dummy_reloc16_estimate, NULL, /* bfd_coff_sym_is_global */ - /* _bfd_coff_compute_section_file_positions */ coff_compute_section_file_positions, NULL , /* _bfd_coff_start_final_link */ - xcoff64_ppc_relocate_section, /* _bfd_coff_relocate_section */ - coff_rtype_to_howto, /* _bfd_coff_rtype_to_howto */ - NULL , /* _bfd_coff_addust_symndx */ - _bfd_generic_link_add_one_symbol, /* _bfd_coff_add_one_symbol */ - coff_link_output_has_begun, /* _bfd_coff_link_output_has_begun */ - coff_final_link_postscript /* _bfd_coff_final_link_postscript */ + xcoff64_ppc_relocate_section, + coff_rtype_to_howto, + NULL, /* _bfd_coff_adjust_symndx */ + _bfd_generic_link_add_one_symbol, + coff_link_output_has_begun, + coff_final_link_postscript }, 0x01EF, /* magic number */ - bfd_arch_powerpc, /* architecture */ - bfd_mach_ppc_620, /* machine */ + bfd_arch_powerpc, + bfd_mach_ppc_620, /* Function pointers to xcoff specific swap routines. */ - xcoff64_swap_ldhdr_in, /* _xcoff_swap_ldhdr_in */ - xcoff64_swap_ldhdr_out, /* _xcoff_swap_ldhdr_out */ - xcoff64_swap_ldsym_in, /* _xcoff_swap_ldsym_in */ - xcoff64_swap_ldsym_out, /* _xcoff_swap_ldsym_out */ - xcoff64_swap_ldrel_in, /* _xcoff_swap_ldrel_in */ - xcoff64_swap_ldrel_out, /* _xcoff_swap_ldrel_out */ + xcoff64_swap_ldhdr_in, + xcoff64_swap_ldhdr_out, + xcoff64_swap_ldsym_in, + xcoff64_swap_ldsym_out, + xcoff64_swap_ldrel_in, + xcoff64_swap_ldrel_out, /* Sizes. */ - LDHDRSZ, /* _xcoff_ldhdrsz */ - LDSYMSZ, /* _xcoff_ldsymsz */ - LDRELSZ, /* _xcoff_ldrelsz */ + LDHDRSZ, + LDSYMSZ, + LDRELSZ, 24, /* _xcoff_function_descriptor_size */ 0, /* _xcoff_small_aout_header_size */ /* Versions. */ 2, /* _xcoff_ldhdr_version */ - /* xcoff vs xcoff64 putting symbol names. */ - _bfd_xcoff64_put_symbol_name, /* _xcoff_put_symbol_name */ - _bfd_xcoff64_put_ldsymbol_name, /* _xcoff_put_ldsymbol_name */ - - /* Dynamic reloc howto. */ + _bfd_xcoff64_put_symbol_name, + _bfd_xcoff64_put_ldsymbol_name, &xcoff64_dynamic_reloc, - xcoff64_create_csect_from_smclas, /* Lineno and reloc count overflow. */ @@ -2597,7 +2581,7 @@ static const struct xcoff_backend_data_r /* rtinit. */ 88, /* _xcoff_rtinit_size */ - xcoff64_generate_rtinit, /* _xcoff_generate_rtinit */ + xcoff64_generate_rtinit, }; /* The transfer vector that leads the outside world to all of the above. */ @@ -2608,36 +2592,35 @@ const bfd_target rs6000coff64_vec = BFD_ENDIAN_BIG, /* data byte order is big */ BFD_ENDIAN_BIG, /* header byte order is big */ - (HAS_RELOC | EXEC_P | /* object flags */ - HAS_LINENO | HAS_DEBUG | DYNAMIC | - HAS_SYMS | HAS_LOCALS | WP_TEXT), + (HAS_RELOC | EXEC_P | HAS_LINENO | HAS_DEBUG | DYNAMIC + | HAS_SYMS | HAS_LOCALS | WP_TEXT), - (SEC_HAS_CONTENTS | SEC_ALLOC | SEC_LOAD | SEC_RELOC), /* section flags */ + (SEC_HAS_CONTENTS | SEC_ALLOC | SEC_LOAD | SEC_RELOC), 0, /* leading char */ '/', /* ar_pad_char */ - 15, /* ar_max_namelen??? FIXMEmgo */ + 15, /* ar_max_namelen */ /* data */ - bfd_getb64, /* bfd_getx64 */ - bfd_getb_signed_64, /* bfd_getx_signed_64 */ - bfd_putb64, /* bfd_putx64 */ - bfd_getb32, /* bfd_getx32 */ - bfd_getb_signed_32, /* bfd_getx_signed_32 */ - bfd_putb32, /* bfd_putx32 */ - bfd_getb16, /* bfd_getx16 */ - bfd_getb_signed_16, /* bfd_getx_signed_16 */ - bfd_putb16, /* bfd_putx16 */ + bfd_getb64, + bfd_getb_signed_64, + bfd_putb64, + bfd_getb32, + bfd_getb_signed_32, + bfd_putb32, + bfd_getb16, + bfd_getb_signed_16, + bfd_putb16, /* hdrs */ - bfd_getb64, /* bfd_h_getx64 */ - bfd_getb_signed_64, /* bfd_h_getx_signed_64 */ - bfd_putb64, /* bfd_h_putx64 */ - bfd_getb32, /* bfd_h_getx32 */ - bfd_getb_signed_32, /* bfd_h_getx_signed_32 */ - bfd_putb32, /* bfd_h_putx32 */ - bfd_getb16, /* bfd_h_getx16 */ - bfd_getb_signed_16, /* bfd_h_getx_signed_16 */ - bfd_putb16, /* bfd_h_putx16 */ + bfd_getb64, + bfd_getb_signed_64, + bfd_putb64, + bfd_getb32, + bfd_getb_signed_32, + bfd_putb32, + bfd_getb16, + bfd_getb_signed_16, + bfd_putb16, { /* bfd_check_format */ _bfd_dummy_target, @@ -2661,93 +2644,82 @@ const bfd_target rs6000coff64_vec = }, /* Generic */ - bfd_true, /* _close_and_cleanup */ - bfd_true, /* _bfd_free_cached_info */ - coff_new_section_hook, /* _new_section_hook */ - _bfd_generic_get_section_contents, /* _bfd_get_section_contents */ - /* _bfd_get_section_contents_in_window */ + bfd_true, + bfd_true, + coff_new_section_hook, + _bfd_generic_get_section_contents, _bfd_generic_get_section_contents_in_window, /* Copy */ - _bfd_xcoff_copy_private_bfd_data, /* _bfd_copy_private_bfd */ - /* _bfd_merge_private_bfd_data */ + _bfd_xcoff_copy_private_bfd_data, ((boolean (*) (bfd *, bfd *)) bfd_true), - /* _bfd_copy_pivate_section_data */ ((boolean (*) (bfd *, asection *, bfd *, asection *)) bfd_true), - /* _bfd_copy_private_symbol_data */ ((boolean (*) (bfd *, asymbol *, bfd *, asymbol *)) bfd_true), - ((boolean (*) (bfd *, flagword)) bfd_true), /* _bfd_set_private_flags */ - ((boolean (*) (bfd *, void * )) bfd_true), /* _bfd_print_private_bfd_data */ + ((boolean (*) (bfd *, flagword)) bfd_true), + ((boolean (*) (bfd *, void * )) bfd_true), /* Core */ - coff_core_file_failing_command, /* _core_file_failing_command */ - coff_core_file_failing_signal, /* _core_file_failing_signal */ - coff_core_file_matches_executable_p, /* _core_file_matches_executable_p */ + coff_core_file_failing_command, + coff_core_file_failing_signal, + coff_core_file_matches_executable_p, /* Archive */ - xcoff64_slurp_armap, /* _slurp_armap */ - /* XCOFF archives do not have anything which corresponds to an - extended name table. */ - bfd_false, /* _slurp_extended_name_table */ - /* _construct_extended_name_table */ + xcoff64_slurp_armap, + bfd_false, ((boolean (*) (bfd *, char **, bfd_size_type *, const char **)) bfd_false), - bfd_dont_truncate_arname, /* _truncate_arname */ - _bfd_xcoff_write_armap, /* _write_armap */ - _bfd_xcoff_read_ar_hdr, /* _read_ar_hdr */ - xcoff64_openr_next_archived_file, /* _openr_next_archived_file */ - _bfd_generic_get_elt_at_index, /* _get_elt_at_index */ - _bfd_xcoff_stat_arch_elt, /* _generic_stat_arch_elt */ - /* XCOFF archives do not have a timestamp. */ - bfd_true, /* _update_armap_timestamp */ + bfd_dont_truncate_arname, + _bfd_xcoff_write_armap, + _bfd_xcoff_read_ar_hdr, + xcoff64_openr_next_archived_file, + _bfd_generic_get_elt_at_index, + _bfd_xcoff_stat_arch_elt, + bfd_true, /* Symbols */ - coff_get_symtab_upper_bound, /* _get_symtab_upper_bound */ - coff_get_symtab, /* _get_symtab */ - coff_make_empty_symbol, /* _make_empty_symbol */ - coff_print_symbol, /* _print_symbol */ - coff_get_symbol_info, /* _get_symbol_info */ - _bfd_xcoff_is_local_label_name, /* _bfd_is_local_label_name */ - coff_get_lineno, /* _get_lineno */ - coff_find_nearest_line, /* _find_nearest_line */ - coff_bfd_make_debug_symbol, /* _bfd_make_debug_symbol */ - _bfd_generic_read_minisymbols, /* _read_minisymbols */ - _bfd_generic_minisymbol_to_symbol, /* _minsymbol_to_symbol */ + coff_get_symtab_upper_bound, + coff_get_symtab, + coff_make_empty_symbol, + coff_print_symbol, + coff_get_symbol_info, + _bfd_xcoff_is_local_label_name, + coff_get_lineno, + coff_find_nearest_line, + coff_bfd_make_debug_symbol, + _bfd_generic_read_minisymbols, + _bfd_generic_minisymbol_to_symbol, /* Reloc */ - coff_get_reloc_upper_bound, /* _get_reloc_upper_bound */ - coff_canonicalize_reloc, /* _cononicalize_reloc */ - xcoff64_reloc_type_lookup, /* _bfd_reloc_type_lookup */ + coff_get_reloc_upper_bound, + coff_canonicalize_reloc, + xcoff64_reloc_type_lookup, /* Write */ - coff_set_arch_mach, /* _set_arch_mach */ - coff_set_section_contents, /* _set_section_contents */ + coff_set_arch_mach, + coff_set_section_contents, /* Link */ - xcoff64_sizeof_headers, /* _sizeof_headers */ - /* _bfd_get_relocated_section_contents */ + xcoff64_sizeof_headers, bfd_generic_get_relocated_section_contents, - bfd_generic_relax_section, /* _bfd_relax_section */ - _bfd_xcoff_bfd_link_hash_table_create,/* _bfd_link_hash_table_create */ - _bfd_generic_link_hash_table_free, /* _bfd_link_hash_table_free */ - _bfd_xcoff_bfd_link_add_symbols, /* _bfd_link_add_symbols */ - _bfd_generic_link_just_syms, /* _bfd_link_just_syms */ - _bfd_xcoff_bfd_final_link, /* _bfd_final_link */ - _bfd_generic_link_split_section, /* _bfd_link_split_section */ - bfd_generic_gc_sections, /* _bfd_gc_sections */ - bfd_generic_merge_sections, /* _bfd_merge_sections */ - bfd_generic_discard_group, /* _bfd_discard_group */ + bfd_generic_relax_section, + _bfd_xcoff_bfd_link_hash_table_create, + _bfd_generic_link_hash_table_free, + _bfd_xcoff_bfd_link_add_symbols, + _bfd_generic_link_just_syms, + _bfd_xcoff_bfd_final_link, + _bfd_generic_link_split_section, + bfd_generic_gc_sections, + bfd_generic_merge_sections, + bfd_generic_discard_group, /* Dynamic */ - /* _get_dynamic_symtab_upper_bound */ _bfd_xcoff_get_dynamic_symtab_upper_bound, - _bfd_xcoff_canonicalize_dynamic_symtab, /* _cononicalize_dynamic_symtab */ - _bfd_xcoff_get_dynamic_reloc_upper_bound,/* _get_dynamic_reloc_upper_bound */ - _bfd_xcoff_canonicalize_dynamic_reloc, /* _cononicalize_dynamic_reloc */ + _bfd_xcoff_canonicalize_dynamic_symtab, + _bfd_xcoff_get_dynamic_reloc_upper_bound, + _bfd_xcoff_canonicalize_dynamic_reloc, /* Opposite endian version, none exists */ NULL, - /* back end data */ (void *) &bfd_xcoff_backend_data, }; @@ -2760,81 +2732,78 @@ extern int xcoff64_core_file_failing_sig static const struct xcoff_backend_data_rec bfd_xcoff_aix5_backend_data = { { /* COFF backend, defined in libcoff.h. */ - _bfd_xcoff64_swap_aux_in, /* _bfd_coff_swap_aux_in */ - _bfd_xcoff64_swap_sym_in, /* _bfd_coff_swap_sym_in */ - _bfd_xcoff64_swap_lineno_in, /* _bfd_coff_swap_lineno_in */ - _bfd_xcoff64_swap_aux_out, /* _bfd_swap_aux_out */ - _bfd_xcoff64_swap_sym_out, /* _bfd_swap_sym_out */ - _bfd_xcoff64_swap_lineno_out, /* _bfd_swap_lineno_out */ - xcoff64_swap_reloc_out, /* _bfd_swap_reloc_out */ - coff_swap_filehdr_out, /* _bfd_swap_filehdr_out */ - coff_swap_aouthdr_out, /* _bfd_swap_aouthdr_out */ - coff_swap_scnhdr_out, /* _bfd_swap_scnhdr_out */ - FILHSZ, /* _bfd_filhsz */ - AOUTSZ, /* _bfd_aoutsz */ - SCNHSZ, /* _bfd_scnhsz */ - SYMESZ, /* _bfd_symesz */ - AUXESZ, /* _bfd_auxesz */ - RELSZ, /* _bfd_relsz */ - LINESZ, /* _bfd_linesz */ - FILNMLEN, /* _bfd_filnmlen */ + _bfd_xcoff64_swap_aux_in, + _bfd_xcoff64_swap_sym_in, + _bfd_xcoff64_swap_lineno_in, + _bfd_xcoff64_swap_aux_out, + _bfd_xcoff64_swap_sym_out, + _bfd_xcoff64_swap_lineno_out, + xcoff64_swap_reloc_out, + coff_swap_filehdr_out, + coff_swap_aouthdr_out, + coff_swap_scnhdr_out, + FILHSZ, + AOUTSZ, + SCNHSZ, + SYMESZ, + AUXESZ, + RELSZ, + LINESZ, + FILNMLEN, true, /* _bfd_coff_long_filenames */ false, /* _bfd_coff_long_section_names */ - (3), /* _bfd_coff_default_section_alignment_power */ + 3, /* _bfd_coff_default_section_alignment_power */ true, /* _bfd_coff_force_symnames_in_strings */ 4, /* _bfd_coff_debug_string_prefix_length */ - coff_swap_filehdr_in, /* _bfd_coff_swap_filehdr_in */ - coff_swap_aouthdr_in, /* _bfd_swap_aouthdr_in */ - coff_swap_scnhdr_in, /* _bfd_swap_scnhdr_in */ - xcoff64_swap_reloc_in, /* _bfd_reloc_in */ - xcoff64_bad_format_hook, /* _bfd_bad_format_hook */ - coff_set_arch_mach_hook, /* _bfd_set_arch_mach_hook */ - coff_mkobject_hook, /* _bfd_mkobject_hook */ - styp_to_sec_flags, /* _bfd_syp_to_sec_flags */ - coff_set_alignment_hook, /* _bfd_set_alignment_hook */ - coff_slurp_symbol_table, /* _bfd_coff_slurp_symbol_table */ - symname_in_debug_hook, /* _coff_symname_in_debug_hook */ - coff_pointerize_aux_hook, /* _bfd_coff_pointerize_aux_hook */ - coff_print_aux, /* bfd_coff_print_aux */ - dummy_reloc16_extra_cases, /* _bfd_coff_reloc16_extra_cases */ - dummy_reloc16_estimate, /* _bfd_coff_reloc16_estimate */ + coff_swap_filehdr_in, + coff_swap_aouthdr_in, + coff_swap_scnhdr_in, + xcoff64_swap_reloc_in, + xcoff64_bad_format_hook, + coff_set_arch_mach_hook, + coff_mkobject_hook, + styp_to_sec_flags, + coff_set_alignment_hook, + coff_slurp_symbol_table, + symname_in_debug_hook, + coff_pointerize_aux_hook, + coff_print_aux, + dummy_reloc16_extra_cases, + dummy_reloc16_estimate, NULL, /* bfd_coff_sym_is_global */ - /* _bfd_coff_compute_section_file_positions */ coff_compute_section_file_positions, NULL , /* _bfd_coff_start_final_link */ - xcoff64_ppc_relocate_section, /* _bfd_coff_relocate_section */ - coff_rtype_to_howto, /* _bfd_coff_rtype_to_howto */ - NULL , /* _bfd_coff_addust_symndx */ - _bfd_generic_link_add_one_symbol, /* _bfd_coff_add_one_symbol */ - coff_link_output_has_begun, /* _bfd_coff_link_output_has_begun */ - coff_final_link_postscript /* _bfd_coff_final_link_postscript */ + xcoff64_ppc_relocate_section, + coff_rtype_to_howto, + NULL, /* _bfd_coff_adjust_symndx */ + _bfd_generic_link_add_one_symbol, + coff_link_output_has_begun, + coff_final_link_postscript }, U64_TOCMAGIC, /* magic number */ - bfd_arch_powerpc, /* architecture */ - bfd_mach_ppc_620, /* machine */ + bfd_arch_powerpc, + bfd_mach_ppc_620, /* Function pointers to xcoff specific swap routines. */ - xcoff64_swap_ldhdr_in, /* _xcoff_swap_ldhdr_in */ - xcoff64_swap_ldhdr_out, /* _xcoff_swap_ldhdr_out */ - xcoff64_swap_ldsym_in, /* _xcoff_swap_ldsym_in */ - xcoff64_swap_ldsym_out, /* _xcoff_swap_ldsym_out */ - xcoff64_swap_ldrel_in, /* _xcoff_swap_ldrel_in */ - xcoff64_swap_ldrel_out, /* _xcoff_swap_ldrel_out */ + xcoff64_swap_ldhdr_in, + xcoff64_swap_ldhdr_out, + xcoff64_swap_ldsym_in, + xcoff64_swap_ldsym_out, + xcoff64_swap_ldrel_in, + xcoff64_swap_ldrel_out, /* Sizes. */ - LDHDRSZ, /* _xcoff_ldhdrsz */ - LDSYMSZ, /* _xcoff_ldsymsz */ - LDRELSZ, /* _xcoff_ldrelsz */ + LDHDRSZ, + LDSYMSZ, + LDRELSZ, 24, /* _xcoff_function_descriptor_size */ 0, /* _xcoff_small_aout_header_size */ /* Versions. */ 2, /* _xcoff_ldhdr_version */ - _bfd_xcoff64_put_symbol_name, /* _xcoff_put_symbol_name */ - _bfd_xcoff64_put_ldsymbol_name, /* _xcoff_put_ldsymbol_name */ - - /* Dynamic reloc howto. */ + _bfd_xcoff64_put_symbol_name, + _bfd_xcoff64_put_ldsymbol_name, &xcoff64_dynamic_reloc, xcoff64_create_csect_from_smclas, @@ -2851,7 +2820,7 @@ static const struct xcoff_backend_data_r /* rtinit. */ 88, /* _xcoff_rtinit_size */ - xcoff64_generate_rtinit, /* _xcoff_generate_rtinit */ + xcoff64_generate_rtinit, }; /* The transfer vector that leads the outside world to all of the above. */ @@ -2862,36 +2831,35 @@ const bfd_target aix5coff64_vec = BFD_ENDIAN_BIG, /* data byte order is big */ BFD_ENDIAN_BIG, /* header byte order is big */ - (HAS_RELOC | EXEC_P | /* object flags */ - HAS_LINENO | HAS_DEBUG | DYNAMIC | - HAS_SYMS | HAS_LOCALS | WP_TEXT), + (HAS_RELOC | EXEC_P | HAS_LINENO | HAS_DEBUG | DYNAMIC + | HAS_SYMS | HAS_LOCALS | WP_TEXT), - (SEC_HAS_CONTENTS | SEC_ALLOC | SEC_LOAD | SEC_RELOC), /* section flags */ + (SEC_HAS_CONTENTS | SEC_ALLOC | SEC_LOAD | SEC_RELOC), 0, /* leading char */ '/', /* ar_pad_char */ - 15, /* ar_max_namelen??? FIXMEmgo */ + 15, /* ar_max_namelen */ /* data */ - bfd_getb64, /* bfd_getx64 */ - bfd_getb_signed_64, /* bfd_getx_signed_64 */ - bfd_putb64, /* bfd_putx64 */ - bfd_getb32, /* bfd_getx32 */ - bfd_getb_signed_32, /* bfd_getx_signed_32 */ - bfd_putb32, /* bfd_putx32 */ - bfd_getb16, /* bfd_getx16 */ - bfd_getb_signed_16, /* bfd_getx_signed_16 */ - bfd_putb16, /* bfd_putx16 */ + bfd_getb64, + bfd_getb_signed_64, + bfd_putb64, + bfd_getb32, + bfd_getb_signed_32, + bfd_putb32, + bfd_getb16, + bfd_getb_signed_16, + bfd_putb16, /* hdrs */ - bfd_getb64, /* bfd_h_getx64 */ - bfd_getb_signed_64, /* bfd_h_getx_signed_64 */ - bfd_putb64, /* bfd_h_putx64 */ - bfd_getb32, /* bfd_h_getx32 */ - bfd_getb_signed_32, /* bfd_h_getx_signed_32 */ - bfd_putb32, /* bfd_h_putx32 */ - bfd_getb16, /* bfd_h_getx16 */ - bfd_getb_signed_16, /* bfd_h_getx_signed_16 */ - bfd_putb16, /* bfd_h_putx16 */ + bfd_getb64, + bfd_getb_signed_64, + bfd_putb64, + bfd_getb32, + bfd_getb_signed_32, + bfd_putb32, + bfd_getb16, + bfd_getb_signed_16, + bfd_putb16, { /* bfd_check_format */ _bfd_dummy_target, @@ -2915,92 +2883,81 @@ const bfd_target aix5coff64_vec = }, /* Generic */ - bfd_true, /* _close_and_cleanup */ - bfd_true, /* _bfd_free_cached_info */ - coff_new_section_hook, /* _new_section_hook */ - _bfd_generic_get_section_contents, /* _bfd_get_section_contents */ - /* _bfd_get_section_contents_in_window */ + bfd_true, + bfd_true, + coff_new_section_hook, + _bfd_generic_get_section_contents, _bfd_generic_get_section_contents_in_window, /* Copy */ - _bfd_xcoff_copy_private_bfd_data, /* _bfd_copy_private_bfd */ - /* _bfd_merge_private_bfd_data */ + _bfd_xcoff_copy_private_bfd_data, ((boolean (*) (bfd *, bfd *)) bfd_true), - /* _bfd_copy_pivate_section_data */ ((boolean (*) (bfd *, asection *, bfd *, asection *)) bfd_true), - /* _bfd_copy_private_symbol_data */ ((boolean (*) (bfd *, asymbol *, bfd *, asymbol *)) bfd_true), - ((boolean (*) (bfd *, flagword)) bfd_true), /* _bfd_set_private_flags */ - ((boolean (*) (bfd *, void * )) bfd_true), /* _bfd_print_private_bfd_data */ + ((boolean (*) (bfd *, flagword)) bfd_true), + ((boolean (*) (bfd *, void * )) bfd_true), /* Core */ - xcoff64_core_file_failing_command, /* _core_file_failing_command */ - xcoff64_core_file_failing_signal, /* _core_file_failing_signal */ - xcoff64_core_file_matches_executable_p, /* _core_file_matches_executable_p */ + xcoff64_core_file_failing_command, + xcoff64_core_file_failing_signal, + xcoff64_core_file_matches_executable_p, /* Archive */ - xcoff64_slurp_armap, /* _slurp_armap */ - /* XCOFF archives do not have anything which corresponds to an - extended name table. */ - bfd_false, /* _slurp_extended_name_table */ - /* _construct_extended_name_table */ + xcoff64_slurp_armap, + bfd_false, ((boolean (*) (bfd *, char **, bfd_size_type *, const char **)) bfd_false), - bfd_dont_truncate_arname, /* _truncate_arname */ - _bfd_xcoff_write_armap, /* _write_armap */ - _bfd_xcoff_read_ar_hdr, /* _read_ar_hdr */ - xcoff64_openr_next_archived_file, /* _openr_next_archived_file */ - _bfd_generic_get_elt_at_index, /* _get_elt_at_index */ - _bfd_xcoff_stat_arch_elt, /* _generic_stat_arch_elt */ - /* XCOFF archives do not have a timestamp. */ - bfd_true, /* _update_armap_timestamp */ + bfd_dont_truncate_arname, + _bfd_xcoff_write_armap, + _bfd_xcoff_read_ar_hdr, + xcoff64_openr_next_archived_file, + _bfd_generic_get_elt_at_index, + _bfd_xcoff_stat_arch_elt, + bfd_true, /* Symbols */ - coff_get_symtab_upper_bound, /* _get_symtab_upper_bound */ - coff_get_symtab, /* _get_symtab */ - coff_make_empty_symbol, /* _make_empty_symbol */ - coff_print_symbol, /* _print_symbol */ - coff_get_symbol_info, /* _get_symbol_info */ - _bfd_xcoff_is_local_label_name, /* _bfd_is_local_label_name */ - coff_get_lineno, /* _get_lineno */ - coff_find_nearest_line, /* _find_nearest_line */ - coff_bfd_make_debug_symbol, /* _bfd_make_debug_symbol */ - _bfd_generic_read_minisymbols, /* _read_minisymbols */ - _bfd_generic_minisymbol_to_symbol, /* _minsymbol_to_symbol */ + coff_get_symtab_upper_bound, + coff_get_symtab, + coff_make_empty_symbol, + coff_print_symbol, + coff_get_symbol_info, + _bfd_xcoff_is_local_label_name, + coff_get_lineno, + coff_find_nearest_line, + coff_bfd_make_debug_symbol, + _bfd_generic_read_minisymbols, + _bfd_generic_minisymbol_to_symbol, /* Reloc */ - coff_get_reloc_upper_bound, /* _get_reloc_upper_bound */ - coff_canonicalize_reloc, /* _cononicalize_reloc */ - xcoff64_reloc_type_lookup, /* _bfd_reloc_type_lookup */ + coff_get_reloc_upper_bound, + coff_canonicalize_reloc, + xcoff64_reloc_type_lookup, /* Write */ - coff_set_arch_mach, /* _set_arch_mach */ - coff_set_section_contents, /* _set_section_contents */ + coff_set_arch_mach, + coff_set_section_contents, /* Link */ - xcoff64_sizeof_headers, /* _sizeof_headers */ - /* _bfd_get_relocated_section_contents */ + xcoff64_sizeof_headers, bfd_generic_get_relocated_section_contents, - bfd_generic_relax_section, /* _bfd_relax_section */ - _bfd_xcoff_bfd_link_hash_table_create,/* _bfd_link_hash_table_create */ - _bfd_generic_link_hash_table_free, /* _bfd_link_hash_table_free */ - _bfd_xcoff_bfd_link_add_symbols, /* _bfd_link_add_symbols */ - _bfd_generic_link_just_syms, /* _bfd_link_just_syms */ - _bfd_xcoff_bfd_final_link, /* _bfd_final_link */ - _bfd_generic_link_split_section, /* _bfd_link_split_section */ - bfd_generic_gc_sections, /* _bfd_gc_sections */ - bfd_generic_merge_sections, /* _bfd_merge_sections */ - bfd_generic_discard_group, /* _bfd_discard_group */ + bfd_generic_relax_section, + _bfd_xcoff_bfd_link_hash_table_create, + _bfd_generic_link_hash_table_free, + _bfd_xcoff_bfd_link_add_symbols, + _bfd_generic_link_just_syms, + _bfd_xcoff_bfd_final_link, + _bfd_generic_link_split_section, + bfd_generic_gc_sections, + bfd_generic_merge_sections, + bfd_generic_discard_group, /* Dynamic */ - /* _get_dynamic_symtab_upper_bound */ _bfd_xcoff_get_dynamic_symtab_upper_bound, - _bfd_xcoff_canonicalize_dynamic_symtab, /* _cononicalize_dynamic_symtab */ - _bfd_xcoff_get_dynamic_reloc_upper_bound,/* _get_dynamic_reloc_upper_bound */ - _bfd_xcoff_canonicalize_dynamic_reloc, /* _cononicalize_dynamic_reloc */ + _bfd_xcoff_canonicalize_dynamic_symtab, + _bfd_xcoff_get_dynamic_reloc_upper_bound, + _bfd_xcoff_canonicalize_dynamic_reloc, /* Opposite endian version, none exists. */ NULL, - /* back end data */ (void *) & bfd_xcoff_aix5_backend_data, }; diff -Nurpa binutils-2.13/bfd/coffcode.h binutils-2.13.1/bfd/coffcode.h --- binutils-2.13/bfd/coffcode.h 2002-07-08 01:34:08.000000000 -0400 +++ binutils-2.13.1/bfd/coffcode.h 2002-10-30 10:52:52.000000000 -0500 @@ -1246,7 +1246,7 @@ Special entry points for gdb to swap in . struct coff_link_hash_entry *, struct internal_syment *, . bfd_vma *)); . -. boolean (*_bfd_coff_adjust_symndx)\ +. boolean (*_bfd_coff_adjust_symndx) . PARAMS ((bfd *, struct bfd_link_info *, bfd *, asection *, . struct internal_reloc *, boolean *)); . @@ -2158,6 +2158,13 @@ coff_set_arch_mach_hook (abfd, filehdr) arch = bfd_arch_mcore; break; #endif + +#ifdef W65MAGIC + case W65MAGIC: + arch = bfd_arch_w65; + break; +#endif + default: /* Unreadable input file type */ arch = bfd_arch_obscure; break; diff -Nurpa binutils-2.13/bfd/coffgen.c binutils-2.13.1/bfd/coffgen.c --- binutils-2.13/bfd/coffgen.c 2002-06-25 02:21:48.000000000 -0400 +++ binutils-2.13.1/bfd/coffgen.c 2002-10-28 13:45:43.000000000 -0500 @@ -178,6 +178,7 @@ coff_real_object_p (abfd, nscns, interna flagword oflags = abfd->flags; bfd_vma ostart = bfd_get_start_address (abfd); PTR tdata; + PTR tdata_save; bfd_size_type readsize; /* length of file_info */ unsigned int scnhsz; char *external_sections; @@ -206,9 +207,10 @@ coff_real_object_p (abfd, nscns, interna /* Set up the tdata area. ECOFF uses its own routine, and overrides abfd->flags. */ + tdata_save = abfd->tdata.any; tdata = bfd_coff_mkobject_hook (abfd, (PTR) internal_f, (PTR) internal_a); if (tdata == NULL) - return 0; + goto fail2; scnhsz = bfd_coff_scnhsz (abfd); readsize = (bfd_size_type) nscns * scnhsz; @@ -245,6 +247,8 @@ coff_real_object_p (abfd, nscns, interna fail: bfd_release (abfd, tdata); + fail2: + abfd->tdata.any = tdata_save; abfd->flags = oflags; bfd_get_start_address (abfd) = ostart; return (const bfd_target *) NULL; @@ -270,12 +274,13 @@ coff_object_p (abfd) filehdr = bfd_alloc (abfd, filhsz); if (filehdr == NULL) - return 0; + return NULL; if (bfd_bread (filehdr, filhsz, abfd) != filhsz) { if (bfd_get_error () != bfd_error_system_call) bfd_set_error (bfd_error_wrong_format); - return 0; + bfd_release (abfd, filehdr); + return NULL; } bfd_coff_swap_filehdr_in (abfd, filehdr, &internal_f); bfd_release (abfd, filehdr); @@ -292,7 +297,7 @@ coff_object_p (abfd) || internal_f.f_opthdr > aoutsz) { bfd_set_error (bfd_error_wrong_format); - return 0; + return NULL; } nscns = internal_f.f_nscns; @@ -302,13 +307,15 @@ coff_object_p (abfd) opthdr = bfd_alloc (abfd, aoutsz); if (opthdr == NULL) - return 0; + return NULL; if (bfd_bread (opthdr, (bfd_size_type) internal_f.f_opthdr, abfd) != internal_f.f_opthdr) { - return 0; + bfd_release (abfd, opthdr); + return NULL; } bfd_coff_swap_aouthdr_in (abfd, opthdr, (PTR) &internal_a); + bfd_release (abfd, opthdr); } return coff_real_object_p (abfd, nscns, &internal_f, @@ -2189,7 +2196,7 @@ _bfd_coff_is_local_label_name (abfd, nam bfd *abfd ATTRIBUTE_UNUSED; const char *name; { - return name[0] == '.' && name[1] == 'L'; + return (boolean) (name[0] == '.' && name[1] == 'L'); } /* Provided a BFD, a section and an offset (in bytes, not octets) into the diff -Nurpa binutils-2.13/bfd/cofflink.c binutils-2.13.1/bfd/cofflink.c --- binutils-2.13/bfd/cofflink.c 2002-07-08 01:34:07.000000000 -0400 +++ binutils-2.13.1/bfd/cofflink.c 2002-10-28 13:45:43.000000000 -0500 @@ -1322,6 +1322,9 @@ mark_relocs (finfo, input_bfd) if ((a->flags & SEC_RELOC) == 0 || a->reloc_count < 1) continue; + /* Don't mark relocs in excluded sections. */ + if (a->output_section == bfd_abs_section_ptr) + continue; /* Read in the relocs. */ internal_relocs = _bfd_coff_read_internal_relocs diff -Nurpa binutils-2.13/bfd/config.bfd binutils-2.13.1/bfd/config.bfd --- binutils-2.13/bfd/config.bfd 2002-07-01 04:31:52.000000000 -0400 +++ binutils-2.13.1/bfd/config.bfd 2002-11-07 11:57:31.000000000 -0500 @@ -70,7 +70,16 @@ esac case "${targ}" in # START OF targmatch.h #ifdef BFD64 - alpha*-*-netbsd* | alpha*-*-freebsd* | alpha*-*-openbsd*) + alpha*-*-freebsd*) + targ_defvec=bfd_elf64_alpha_freebsd_vec + targ_selvecs=ecoffalpha_little_vec + # FreeBSD <= 4.0 supports only the old nonstandard way of ABI labelling. + case "${targ}" in + alpha*-*-freebsd3* | alpha*-*-freebsd4 | alpha*-*-freebsd4.0*) + targ_cflags=-DOLD_FREEBSD_ABI_LABEL ;; + esac + ;; + alpha*-*-netbsd* | alpha*-*-openbsd*) targ_defvec=bfd_elf64_alpha_vec targ_selvecs=ecoffalpha_little_vec ;; @@ -350,14 +359,14 @@ case "${targ}" in targ_defvec=bfd_elf32_i386_vec targ_selvecs=i386coff_vec ;; - i[3456]86-*-nto-qnx*) - targ_defvec=bfd_elf32_i386qnx_vec + i[3456]86-*-nto*) + targ_defvec=bfd_elf32_i386_vec targ_selvecs=i386coff_vec ;; i[3456]86-*-chorus*) targ_defvec=bfd_elf32_i386_vec ;; - i[3456]86-*-msdosdjgpp* | i[3456]*-*-go32* | i[3456]86-go32-rtems* ) + *-*-msdosdjgpp* | *-*-go32* | *-go32-rtems* ) targ_defvec=go32coff_vec targ_selvecs="go32stubbedcoff_vec i386aout_vec" ;; @@ -388,8 +397,13 @@ case "${targ}" in targ_underscore=yes ;; i[3456]86-*-freebsd*) - targ_defvec=bfd_elf32_i386_vec + targ_defvec=bfd_elf32_i386_freebsd_vec targ_selvecs=i386coff_vec + # FreeBSD <= 4.0 supports only the old nonstandard way of ABI labelling. + case "${targ}" in + i[3456]86-*-freebsd3* | i[3456]86-*-freebsd4 | i[3456]86-*-freebsd4.0*) + targ_cflags=-DOLD_FREEBSD_ABI_LABEL ;; + esac ;; i[3456]86-*-netbsdelf*) targ_defvec=bfd_elf32_i386_vec @@ -874,10 +888,12 @@ case "${targ}" in s390-*-linux*) targ_defvec=bfd_elf32_s390_vec + targ64_selvecs=bfd_elf64_s390_vec ;; #ifdef BFD64 s390x-*-linux*) targ_defvec=bfd_elf64_s390_vec + targ_selvecs=bfd_elf32_s390_vec ;; #endif @@ -911,9 +927,11 @@ case "${targ}" in ;; sh*eb-*-linux*) targ_defvec=bfd_elf32_shblin_vec + targ_selvecs=bfd_elf32_shlin_vec ;; sh*-*-linux*) targ_defvec=bfd_elf32_shlin_vec + targ_selvecs=bfd_elf32_shblin_vec ;; #ifdef BFD64 diff -Nurpa binutils-2.13/bfd/config.in binutils-2.13.1/bfd/config.in --- binutils-2.13/bfd/config.in 2002-05-13 09:33:29.000000000 -0400 +++ binutils-2.13.1/bfd/config.in 2002-10-30 11:29:40.000000000 -0500 @@ -1,4 +1,4 @@ -/* config.in. Generated automatically from configure.in by autoheader. */ +/* config.in. Generated automatically from configure.in by autoheader 2.13. */ /* Define if using alloca.c. */ #undef C_ALLOCA @@ -160,15 +160,9 @@ /* Define if you have the header file. */ #undef HAVE_SYS_PROCFS_H -/* Define if you have the header file. */ -#undef HAVE_SYS_STAT_H - /* Define if you have the header file. */ #undef HAVE_SYS_TIME_H -/* Define if you have the header file. */ -#undef HAVE_SYS_TYPES_H - /* Define if you have the header file. */ #undef HAVE_TIME_H diff -Nurpa binutils-2.13/bfd/configure binutils-2.13.1/bfd/configure --- binutils-2.13/bfd/configure 2002-08-05 16:45:25.000000000 -0400 +++ binutils-2.13.1/bfd/configure 2002-11-07 13:51:57.000000000 -0500 @@ -1118,7 +1118,7 @@ fi PACKAGE=bfd -VERSION=2.13 +VERSION=2.13.1 if test "`cd $srcdir && pwd`" != "`pwd`" && test -f $srcdir/config.status; then { echo "configure: error: source directory already configured; run "make distclean" there first" 1>&2; exit 1; } @@ -1770,7 +1770,7 @@ else if { (eval echo configure:1771: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; }; then for file in conftest.*; do case $file in - *.c | *.o | *.obj) ;; + *.$ac_ext | *.c | *.o | *.obj) ;; *) ac_cv_exeext=`echo $file | sed -e s/conftest//` ;; esac done @@ -2414,7 +2414,7 @@ else if { (eval echo configure:2415: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; }; then for file in conftest.*; do case $file in - *.c | *.o | *.obj) ;; + *.$ac_ext | *.c | *.o | *.obj) ;; *) ac_cv_exeext=`echo $file | sed -e s/conftest//` ;; esac done @@ -2661,7 +2661,7 @@ else fi -ALL_LINGUAS="fr tr ja es sv" +ALL_LINGUAS="fr tr ja es sv da" echo $ac_n "checking how to run the C preprocessor""... $ac_c" 1>&6 echo "configure:2667: checking how to run the C preprocessor" >&5 # On Suns, sometimes $CPP names a directory. @@ -3291,7 +3291,7 @@ EOF fi -for ac_hdr in stdlib.h unistd.h sys/stat.h sys/types.h +for ac_hdr in unistd.h do ac_safe=`echo "$ac_hdr" | sed 'y%./+-%__p_%'` echo $ac_n "checking for $ac_hdr""... $ac_c" 1>&6 @@ -3423,24 +3423,11 @@ else #include #include -#if HAVE_SYS_TYPES_H -# include -#endif - -#if HAVE_STDLIB_H -# include -#endif - -#if HAVE_SYS_STAT_H -# include -#endif - -#if HAVE_UNISTD_H -# include -#endif - /* This mess was copied from the GNU getpagesize.h. */ #ifndef HAVE_GETPAGESIZE +# ifdef HAVE_UNISTD_H +# include +# endif /* Assume that all systems that can run configure have sys/param.h. */ # ifndef HAVE_SYS_PARAM_H @@ -3548,7 +3535,7 @@ main() } EOF -if { (eval echo configure:3552: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext} && (./conftest; exit) 2>/dev/null +if { (eval echo configure:3539: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext} && (./conftest; exit) 2>/dev/null then ac_cv_func_mmap_fixed_mapped=yes else @@ -3576,17 +3563,17 @@ unistd.h values.h sys/param.h do ac_safe=`echo "$ac_hdr" | sed 'y%./+-%__p_%'` echo $ac_n "checking for $ac_hdr""... $ac_c" 1>&6 -echo "configure:3580: checking for $ac_hdr" >&5 +echo "configure:3567: checking for $ac_hdr" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:3590: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:3577: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out | grep -v "^conftest.${ac_ext}\$"` if test -z "$ac_err"; then rm -rf conftest* @@ -3616,12 +3603,12 @@ done __argz_count __argz_stringify __argz_next do echo $ac_n "checking for $ac_func""... $ac_c" 1>&6 -echo "configure:3620: checking for $ac_func" >&5 +echo "configure:3607: checking for $ac_func" >&5 if eval "test \"`echo '$''{'ac_cv_func_$ac_func'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:3635: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_func_$ac_func=yes" else @@ -3673,12 +3660,12 @@ done for ac_func in stpcpy do echo $ac_n "checking for $ac_func""... $ac_c" 1>&6 -echo "configure:3677: checking for $ac_func" >&5 +echo "configure:3664: checking for $ac_func" >&5 if eval "test \"`echo '$''{'ac_cv_func_$ac_func'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:3692: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_func_$ac_func=yes" else @@ -3735,19 +3722,19 @@ EOF if test $ac_cv_header_locale_h = yes; then echo $ac_n "checking for LC_MESSAGES""... $ac_c" 1>&6 -echo "configure:3739: checking for LC_MESSAGES" >&5 +echo "configure:3726: checking for LC_MESSAGES" >&5 if eval "test \"`echo '$''{'am_cv_val_LC_MESSAGES'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < int main() { return LC_MESSAGES ; return 0; } EOF -if { (eval echo configure:3751: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:3738: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* am_cv_val_LC_MESSAGES=yes else @@ -3768,7 +3755,7 @@ EOF fi fi echo $ac_n "checking whether NLS is requested""... $ac_c" 1>&6 -echo "configure:3772: checking whether NLS is requested" >&5 +echo "configure:3759: checking whether NLS is requested" >&5 # Check whether --enable-nls or --disable-nls was given. if test "${enable_nls+set}" = set; then enableval="$enable_nls" @@ -3788,7 +3775,7 @@ fi EOF echo $ac_n "checking whether included gettext is requested""... $ac_c" 1>&6 -echo "configure:3792: checking whether included gettext is requested" >&5 +echo "configure:3779: checking whether included gettext is requested" >&5 # Check whether --with-included-gettext or --without-included-gettext was given. if test "${with_included_gettext+set}" = set; then withval="$with_included_gettext" @@ -3807,17 +3794,17 @@ fi ac_safe=`echo "libintl.h" | sed 'y%./+-%__p_%'` echo $ac_n "checking for libintl.h""... $ac_c" 1>&6 -echo "configure:3811: checking for libintl.h" >&5 +echo "configure:3798: checking for libintl.h" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:3821: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:3808: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out | grep -v "^conftest.${ac_ext}\$"` if test -z "$ac_err"; then rm -rf conftest* @@ -3834,19 +3821,19 @@ fi if eval "test \"`echo '$ac_cv_header_'$ac_safe`\" = yes"; then echo "$ac_t""yes" 1>&6 echo $ac_n "checking for gettext in libc""... $ac_c" 1>&6 -echo "configure:3838: checking for gettext in libc" >&5 +echo "configure:3825: checking for gettext in libc" >&5 if eval "test \"`echo '$''{'gt_cv_func_gettext_libc'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < int main() { return (int) gettext ("") ; return 0; } EOF -if { (eval echo configure:3850: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:3837: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* gt_cv_func_gettext_libc=yes else @@ -3862,7 +3849,7 @@ echo "$ac_t""$gt_cv_func_gettext_libc" 1 if test "$gt_cv_func_gettext_libc" != "yes"; then echo $ac_n "checking for bindtextdomain in -lintl""... $ac_c" 1>&6 -echo "configure:3866: checking for bindtextdomain in -lintl" >&5 +echo "configure:3853: checking for bindtextdomain in -lintl" >&5 ac_lib_var=`echo intl'_'bindtextdomain | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -3870,7 +3857,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lintl $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:3872: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -3897,19 +3884,19 @@ fi if eval "test \"`echo '$ac_cv_lib_'$ac_lib_var`\" = yes"; then echo "$ac_t""yes" 1>&6 echo $ac_n "checking for gettext in libintl""... $ac_c" 1>&6 -echo "configure:3901: checking for gettext in libintl" >&5 +echo "configure:3888: checking for gettext in libintl" >&5 if eval "test \"`echo '$''{'gt_cv_func_gettext_libintl'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:3900: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* gt_cv_func_gettext_libintl=yes else @@ -3937,7 +3924,7 @@ EOF # Extract the first word of "msgfmt", so it can be a program name with args. set dummy msgfmt; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:3941: checking for $ac_word" >&5 +echo "configure:3928: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_path_MSGFMT'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -3971,12 +3958,12 @@ fi for ac_func in dcgettext do echo $ac_n "checking for $ac_func""... $ac_c" 1>&6 -echo "configure:3975: checking for $ac_func" >&5 +echo "configure:3962: checking for $ac_func" >&5 if eval "test \"`echo '$''{'ac_cv_func_$ac_func'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:3990: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_func_$ac_func=yes" else @@ -4026,7 +4013,7 @@ done # Extract the first word of "gmsgfmt", so it can be a program name with args. set dummy gmsgfmt; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:4030: checking for $ac_word" >&5 +echo "configure:4017: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_path_GMSGFMT'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -4062,7 +4049,7 @@ fi # Extract the first word of "xgettext", so it can be a program name with args. set dummy xgettext; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:4066: checking for $ac_word" >&5 +echo "configure:4053: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_path_XGETTEXT'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -4094,7 +4081,7 @@ else fi cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:4093: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* CATOBJEXT=.gmo DATADIRNAME=share @@ -4134,7 +4121,7 @@ fi # Extract the first word of "msgfmt", so it can be a program name with args. set dummy msgfmt; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:4138: checking for $ac_word" >&5 +echo "configure:4125: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_path_MSGFMT'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -4168,7 +4155,7 @@ fi # Extract the first word of "gmsgfmt", so it can be a program name with args. set dummy gmsgfmt; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:4172: checking for $ac_word" >&5 +echo "configure:4159: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_path_GMSGFMT'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -4204,7 +4191,7 @@ fi # Extract the first word of "xgettext", so it can be a program name with args. set dummy xgettext; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:4208: checking for $ac_word" >&5 +echo "configure:4195: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_path_XGETTEXT'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -4294,7 +4281,7 @@ fi LINGUAS= else echo $ac_n "checking for catalogs to be installed""... $ac_c" 1>&6 -echo "configure:4298: checking for catalogs to be installed" >&5 +echo "configure:4285: checking for catalogs to be installed" >&5 NEW_LINGUAS= for lang in ${LINGUAS=$ALL_LINGUAS}; do case "$ALL_LINGUAS" in @@ -4322,17 +4309,17 @@ echo "configure:4298: checking for catal if test "$CATOBJEXT" = ".cat"; then ac_safe=`echo "linux/version.h" | sed 'y%./+-%__p_%'` echo $ac_n "checking for linux/version.h""... $ac_c" 1>&6 -echo "configure:4326: checking for linux/version.h" >&5 +echo "configure:4313: checking for linux/version.h" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:4336: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:4323: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out | grep -v "^conftest.${ac_ext}\$"` if test -z "$ac_err"; then rm -rf conftest* @@ -4410,7 +4397,7 @@ fi # SVR4 /usr/ucb/install, which tries to use the nonexistent group "staff" # ./install, which can be erroneously created by make from ./install.sh. echo $ac_n "checking for a BSD compatible install""... $ac_c" 1>&6 -echo "configure:4414: checking for a BSD compatible install" >&5 +echo "configure:4401: checking for a BSD compatible install" >&5 if test -z "$INSTALL"; then if eval "test \"`echo '$''{'ac_cv_path_install'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -4493,7 +4480,7 @@ if test "x$cross_compiling" = "xno"; the EXEEXT_FOR_BUILD='$(EXEEXT)' else echo $ac_n "checking for build system executable suffix""... $ac_c" 1>&6 -echo "configure:4497: checking for build system executable suffix" >&5 +echo "configure:4484: checking for build system executable suffix" >&5 if eval "test \"`echo '$''{'bfd_cv_build_exeext'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -4521,17 +4508,17 @@ for ac_hdr in stddef.h string.h strings. do ac_safe=`echo "$ac_hdr" | sed 'y%./+-%__p_%'` echo $ac_n "checking for $ac_hdr""... $ac_c" 1>&6 -echo "configure:4525: checking for $ac_hdr" >&5 +echo "configure:4512: checking for $ac_hdr" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:4535: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:4522: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out | grep -v "^conftest.${ac_ext}\$"` if test -z "$ac_err"; then rm -rf conftest* @@ -4561,17 +4548,17 @@ for ac_hdr in fcntl.h sys/file.h sys/tim do ac_safe=`echo "$ac_hdr" | sed 'y%./+-%__p_%'` echo $ac_n "checking for $ac_hdr""... $ac_c" 1>&6 -echo "configure:4565: checking for $ac_hdr" >&5 +echo "configure:4552: checking for $ac_hdr" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:4575: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:4562: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out | grep -v "^conftest.${ac_ext}\$"` if test -z "$ac_err"; then rm -rf conftest* @@ -4598,12 +4585,12 @@ fi done echo $ac_n "checking whether time.h and sys/time.h may both be included""... $ac_c" 1>&6 -echo "configure:4602: checking whether time.h and sys/time.h may both be included" >&5 +echo "configure:4589: checking whether time.h and sys/time.h may both be included" >&5 if eval "test \"`echo '$''{'ac_cv_header_time'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < #include @@ -4612,7 +4599,7 @@ int main() { struct tm *tp; ; return 0; } EOF -if { (eval echo configure:4616: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:4603: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* ac_cv_header_time=yes else @@ -4637,12 +4624,12 @@ for ac_hdr in dirent.h sys/ndir.h sys/di do ac_safe=`echo "$ac_hdr" | sed 'y%./+-%__p_%'` echo $ac_n "checking for $ac_hdr that defines DIR""... $ac_c" 1>&6 -echo "configure:4641: checking for $ac_hdr that defines DIR" >&5 +echo "configure:4628: checking for $ac_hdr that defines DIR" >&5 if eval "test \"`echo '$''{'ac_cv_header_dirent_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < #include <$ac_hdr> @@ -4650,7 +4637,7 @@ int main() { DIR *dirp = 0; ; return 0; } EOF -if { (eval echo configure:4654: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:4641: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* eval "ac_cv_header_dirent_$ac_safe=yes" else @@ -4675,7 +4662,7 @@ done # Two versions of opendir et al. are in -ldir and -lx on SCO Xenix. if test $ac_header_dirent = dirent.h; then echo $ac_n "checking for opendir in -ldir""... $ac_c" 1>&6 -echo "configure:4679: checking for opendir in -ldir" >&5 +echo "configure:4666: checking for opendir in -ldir" >&5 ac_lib_var=`echo dir'_'opendir | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -4683,7 +4670,7 @@ else ac_save_LIBS="$LIBS" LIBS="-ldir $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:4685: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -4716,7 +4703,7 @@ fi else echo $ac_n "checking for opendir in -lx""... $ac_c" 1>&6 -echo "configure:4720: checking for opendir in -lx" >&5 +echo "configure:4707: checking for opendir in -lx" >&5 ac_lib_var=`echo x'_'opendir | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -4724,7 +4711,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lx $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:4726: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -4760,12 +4747,12 @@ fi for ac_func in fcntl getpagesize setitimer sysconf fdopen getuid getgid do echo $ac_n "checking for $ac_func""... $ac_c" 1>&6 -echo "configure:4764: checking for $ac_func" >&5 +echo "configure:4751: checking for $ac_func" >&5 if eval "test \"`echo '$''{'ac_cv_func_$ac_func'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:4779: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_func_$ac_func=yes" else @@ -4823,12 +4810,12 @@ EOF esac echo $ac_n "checking whether strstr must be declared""... $ac_c" 1>&6 -echo "configure:4827: checking whether strstr must be declared" >&5 +echo "configure:4814: checking whether strstr must be declared" >&5 if eval "test \"`echo '$''{'bfd_cv_decl_needed_strstr'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < @@ -4849,7 +4836,7 @@ int main() { char *(*pfn) = (char *(*)) strstr ; return 0; } EOF -if { (eval echo configure:4853: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:4840: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* bfd_cv_decl_needed_strstr=no else @@ -4870,12 +4857,12 @@ EOF fi echo $ac_n "checking whether malloc must be declared""... $ac_c" 1>&6 -echo "configure:4874: checking whether malloc must be declared" >&5 +echo "configure:4861: checking whether malloc must be declared" >&5 if eval "test \"`echo '$''{'bfd_cv_decl_needed_malloc'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < @@ -4896,7 +4883,7 @@ int main() { char *(*pfn) = (char *(*)) malloc ; return 0; } EOF -if { (eval echo configure:4900: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:4887: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* bfd_cv_decl_needed_malloc=no else @@ -4917,12 +4904,12 @@ EOF fi echo $ac_n "checking whether realloc must be declared""... $ac_c" 1>&6 -echo "configure:4921: checking whether realloc must be declared" >&5 +echo "configure:4908: checking whether realloc must be declared" >&5 if eval "test \"`echo '$''{'bfd_cv_decl_needed_realloc'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < @@ -4943,7 +4930,7 @@ int main() { char *(*pfn) = (char *(*)) realloc ; return 0; } EOF -if { (eval echo configure:4947: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:4934: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* bfd_cv_decl_needed_realloc=no else @@ -4964,12 +4951,12 @@ EOF fi echo $ac_n "checking whether free must be declared""... $ac_c" 1>&6 -echo "configure:4968: checking whether free must be declared" >&5 +echo "configure:4955: checking whether free must be declared" >&5 if eval "test \"`echo '$''{'bfd_cv_decl_needed_free'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < @@ -4990,7 +4977,7 @@ int main() { char *(*pfn) = (char *(*)) free ; return 0; } EOF -if { (eval echo configure:4994: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:4981: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* bfd_cv_decl_needed_free=no else @@ -5011,12 +4998,12 @@ EOF fi echo $ac_n "checking whether getenv must be declared""... $ac_c" 1>&6 -echo "configure:5015: checking whether getenv must be declared" >&5 +echo "configure:5002: checking whether getenv must be declared" >&5 if eval "test \"`echo '$''{'bfd_cv_decl_needed_getenv'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < @@ -5037,7 +5024,7 @@ int main() { char *(*pfn) = (char *(*)) getenv ; return 0; } EOF -if { (eval echo configure:5041: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:5028: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* bfd_cv_decl_needed_getenv=no else @@ -5224,16 +5211,16 @@ if test "${target}" = "${host}"; then # Not all versions of AIX with -DAIX_CORE_DUMPX_CORE # have c_impl as a member of struct core_dumpx echo $ac_n "checking for c_impl in struct core_dumpx""... $ac_c" 1>&6 -echo "configure:5228: checking for c_impl in struct core_dumpx" >&5 +echo "configure:5215: checking for c_impl in struct core_dumpx" >&5 cat > conftest.$ac_ext < int main() { struct core_dumpx c; c.c_impl = 0; ; return 0; } EOF -if { (eval echo configure:5237: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:5224: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* cat >> confdefs.h <<\EOF #define HAVE_ST_C_IMPL 1 @@ -5301,17 +5288,17 @@ rm -f conftest* do ac_safe=`echo "$ac_hdr" | sed 'y%./+-%__p_%'` echo $ac_n "checking for $ac_hdr""... $ac_c" 1>&6 -echo "configure:5305: checking for $ac_hdr" >&5 +echo "configure:5292: checking for $ac_hdr" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:5315: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:5302: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out | grep -v "^conftest.${ac_ext}\$"` if test -z "$ac_err"; then rm -rf conftest* @@ -5339,12 +5326,12 @@ done if test "$ac_cv_header_sys_procfs_h" = yes; then echo $ac_n "checking for prstatus_t in sys/procfs.h""... $ac_c" 1>&6 -echo "configure:5343: checking for prstatus_t in sys/procfs.h" >&5 +echo "configure:5330: checking for prstatus_t in sys/procfs.h" >&5 if eval "test \"`echo '$''{'bfd_cv_have_sys_procfs_type_prstatus_t'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:5344: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* bfd_cv_have_sys_procfs_type_prstatus_t=yes else @@ -5375,12 +5362,12 @@ EOF echo "$ac_t""$bfd_cv_have_sys_procfs_type_prstatus_t" 1>&6 echo $ac_n "checking for prstatus32_t in sys/procfs.h""... $ac_c" 1>&6 -echo "configure:5379: checking for prstatus32_t in sys/procfs.h" >&5 +echo "configure:5366: checking for prstatus32_t in sys/procfs.h" >&5 if eval "test \"`echo '$''{'bfd_cv_have_sys_procfs_type_prstatus32_t'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:5380: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* bfd_cv_have_sys_procfs_type_prstatus32_t=yes else @@ -5411,12 +5398,12 @@ EOF echo "$ac_t""$bfd_cv_have_sys_procfs_type_prstatus32_t" 1>&6 echo $ac_n "checking for prstatus_t.pr_who in sys/procfs.h""... $ac_c" 1>&6 -echo "configure:5415: checking for prstatus_t.pr_who in sys/procfs.h" >&5 +echo "configure:5402: checking for prstatus_t.pr_who in sys/procfs.h" >&5 if eval "test \"`echo '$''{'bfd_cv_have_sys_procfs_type_member_prstatus_t_pr_who'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:5416: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* bfd_cv_have_sys_procfs_type_member_prstatus_t_pr_who=yes else @@ -5447,12 +5434,12 @@ EOF echo "$ac_t""$bfd_cv_have_sys_procfs_type_member_prstatus_t_pr_who" 1>&6 echo $ac_n "checking for prstatus32_t.pr_who in sys/procfs.h""... $ac_c" 1>&6 -echo "configure:5451: checking for prstatus32_t.pr_who in sys/procfs.h" >&5 +echo "configure:5438: checking for prstatus32_t.pr_who in sys/procfs.h" >&5 if eval "test \"`echo '$''{'bfd_cv_have_sys_procfs_type_member_prstatus32_t_pr_who'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:5452: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* bfd_cv_have_sys_procfs_type_member_prstatus32_t_pr_who=yes else @@ -5483,12 +5470,12 @@ EOF echo "$ac_t""$bfd_cv_have_sys_procfs_type_member_prstatus32_t_pr_who" 1>&6 echo $ac_n "checking for pstatus_t in sys/procfs.h""... $ac_c" 1>&6 -echo "configure:5487: checking for pstatus_t in sys/procfs.h" >&5 +echo "configure:5474: checking for pstatus_t in sys/procfs.h" >&5 if eval "test \"`echo '$''{'bfd_cv_have_sys_procfs_type_pstatus_t'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:5488: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* bfd_cv_have_sys_procfs_type_pstatus_t=yes else @@ -5519,12 +5506,12 @@ EOF echo "$ac_t""$bfd_cv_have_sys_procfs_type_pstatus_t" 1>&6 echo $ac_n "checking for pxstatus_t in sys/procfs.h""... $ac_c" 1>&6 -echo "configure:5523: checking for pxstatus_t in sys/procfs.h" >&5 +echo "configure:5510: checking for pxstatus_t in sys/procfs.h" >&5 if eval "test \"`echo '$''{'bfd_cv_have_sys_procfs_type_pxstatus_t'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:5524: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* bfd_cv_have_sys_procfs_type_pxstatus_t=yes else @@ -5555,12 +5542,12 @@ EOF echo "$ac_t""$bfd_cv_have_sys_procfs_type_pxstatus_t" 1>&6 echo $ac_n "checking for pstatus32_t in sys/procfs.h""... $ac_c" 1>&6 -echo "configure:5559: checking for pstatus32_t in sys/procfs.h" >&5 +echo "configure:5546: checking for pstatus32_t in sys/procfs.h" >&5 if eval "test \"`echo '$''{'bfd_cv_have_sys_procfs_type_pstatus32_t'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:5560: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* bfd_cv_have_sys_procfs_type_pstatus32_t=yes else @@ -5591,12 +5578,12 @@ EOF echo "$ac_t""$bfd_cv_have_sys_procfs_type_pstatus32_t" 1>&6 echo $ac_n "checking for prpsinfo_t in sys/procfs.h""... $ac_c" 1>&6 -echo "configure:5595: checking for prpsinfo_t in sys/procfs.h" >&5 +echo "configure:5582: checking for prpsinfo_t in sys/procfs.h" >&5 if eval "test \"`echo '$''{'bfd_cv_have_sys_procfs_type_prpsinfo_t'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:5596: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* bfd_cv_have_sys_procfs_type_prpsinfo_t=yes else @@ -5627,12 +5614,12 @@ EOF echo "$ac_t""$bfd_cv_have_sys_procfs_type_prpsinfo_t" 1>&6 echo $ac_n "checking for prpsinfo32_t in sys/procfs.h""... $ac_c" 1>&6 -echo "configure:5631: checking for prpsinfo32_t in sys/procfs.h" >&5 +echo "configure:5618: checking for prpsinfo32_t in sys/procfs.h" >&5 if eval "test \"`echo '$''{'bfd_cv_have_sys_procfs_type_prpsinfo32_t'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:5632: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* bfd_cv_have_sys_procfs_type_prpsinfo32_t=yes else @@ -5663,12 +5650,12 @@ EOF echo "$ac_t""$bfd_cv_have_sys_procfs_type_prpsinfo32_t" 1>&6 echo $ac_n "checking for psinfo_t in sys/procfs.h""... $ac_c" 1>&6 -echo "configure:5667: checking for psinfo_t in sys/procfs.h" >&5 +echo "configure:5654: checking for psinfo_t in sys/procfs.h" >&5 if eval "test \"`echo '$''{'bfd_cv_have_sys_procfs_type_psinfo_t'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:5668: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* bfd_cv_have_sys_procfs_type_psinfo_t=yes else @@ -5699,12 +5686,12 @@ EOF echo "$ac_t""$bfd_cv_have_sys_procfs_type_psinfo_t" 1>&6 echo $ac_n "checking for psinfo32_t in sys/procfs.h""... $ac_c" 1>&6 -echo "configure:5703: checking for psinfo32_t in sys/procfs.h" >&5 +echo "configure:5690: checking for psinfo32_t in sys/procfs.h" >&5 if eval "test \"`echo '$''{'bfd_cv_have_sys_procfs_type_psinfo32_t'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:5704: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* bfd_cv_have_sys_procfs_type_psinfo32_t=yes else @@ -5735,12 +5722,12 @@ EOF echo "$ac_t""$bfd_cv_have_sys_procfs_type_psinfo32_t" 1>&6 echo $ac_n "checking for lwpstatus_t in sys/procfs.h""... $ac_c" 1>&6 -echo "configure:5739: checking for lwpstatus_t in sys/procfs.h" >&5 +echo "configure:5726: checking for lwpstatus_t in sys/procfs.h" >&5 if eval "test \"`echo '$''{'bfd_cv_have_sys_procfs_type_lwpstatus_t'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:5740: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* bfd_cv_have_sys_procfs_type_lwpstatus_t=yes else @@ -5771,12 +5758,12 @@ EOF echo "$ac_t""$bfd_cv_have_sys_procfs_type_lwpstatus_t" 1>&6 echo $ac_n "checking for lwpxstatus_t in sys/procfs.h""... $ac_c" 1>&6 -echo "configure:5775: checking for lwpxstatus_t in sys/procfs.h" >&5 +echo "configure:5762: checking for lwpxstatus_t in sys/procfs.h" >&5 if eval "test \"`echo '$''{'bfd_cv_have_sys_procfs_type_lwpxstatus_t'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:5776: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* bfd_cv_have_sys_procfs_type_lwpxstatus_t=yes else @@ -5807,12 +5794,12 @@ EOF echo "$ac_t""$bfd_cv_have_sys_procfs_type_lwpxstatus_t" 1>&6 echo $ac_n "checking for lwpstatus_t.pr_context in sys/procfs.h""... $ac_c" 1>&6 -echo "configure:5811: checking for lwpstatus_t.pr_context in sys/procfs.h" >&5 +echo "configure:5798: checking for lwpstatus_t.pr_context in sys/procfs.h" >&5 if eval "test \"`echo '$''{'bfd_cv_have_sys_procfs_type_member_lwpstatus_t_pr_context'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:5812: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* bfd_cv_have_sys_procfs_type_member_lwpstatus_t_pr_context=yes else @@ -5843,12 +5830,12 @@ EOF echo "$ac_t""$bfd_cv_have_sys_procfs_type_member_lwpstatus_t_pr_context" 1>&6 echo $ac_n "checking for lwpstatus_t.pr_reg in sys/procfs.h""... $ac_c" 1>&6 -echo "configure:5847: checking for lwpstatus_t.pr_reg in sys/procfs.h" >&5 +echo "configure:5834: checking for lwpstatus_t.pr_reg in sys/procfs.h" >&5 if eval "test \"`echo '$''{'bfd_cv_have_sys_procfs_type_member_lwpstatus_t_pr_reg'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:5848: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* bfd_cv_have_sys_procfs_type_member_lwpstatus_t_pr_reg=yes else @@ -5879,12 +5866,12 @@ EOF echo "$ac_t""$bfd_cv_have_sys_procfs_type_member_lwpstatus_t_pr_reg" 1>&6 echo $ac_n "checking for win32_pstatus_t in sys/procfs.h""... $ac_c" 1>&6 -echo "configure:5883: checking for win32_pstatus_t in sys/procfs.h" >&5 +echo "configure:5870: checking for win32_pstatus_t in sys/procfs.h" >&5 if eval "test \"`echo '$''{'bfd_cv_have_sys_procfs_type_win32_pstatus_t'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:5884: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* bfd_cv_have_sys_procfs_type_win32_pstatus_t=yes else @@ -6074,8 +6061,8 @@ do bfd_elf32_hppa_linux_vec) tb="$tb elf32-hppa.lo elf32.lo $elf" ;; bfd_elf32_hppa_vec) tb="$tb elf32-hppa.lo elf32.lo $elf" ;; bfd_elf32_i370_vec) tb="$tb elf32-i370.lo elf32.lo $elf" ;; + bfd_elf32_i386_freebsd_vec) tb="$tb elf32-i386-fbsd.lo elf32.lo $elf" ;; bfd_elf32_i386_vec) tb="$tb elf32-i386.lo elf32.lo $elf" ;; - bfd_elf32_i386qnx_vec) tb="$tb elf32-i386qnx.lo elf32.lo $elf" ;; bfd_elf32_i860_little_vec) tb="$tb elf32-i860.lo elf32.lo $elf" ;; bfd_elf32_i860_vec) tb="$tb elf32-i860.lo elf32.lo $elf" ;; bfd_elf32_i960_vec) tb="$tb elf32-i960.lo elf32.lo $elf" ;; @@ -6122,6 +6109,7 @@ do bfd_elf32_v850_vec) tb="$tb elf32-v850.lo elf32.lo $elf" ;; bfd_elf32_vax_vec) tb="$tb elf32-vax.lo elf32.lo $elf" ;; bfd_elf32_xstormy16_vec) tb="$tb elf32-xstormy16.lo elf32.lo $elf" ;; + bfd_elf64_alpha_freebsd_vec) tb="$tb elf64-alpha-fbsd.lo elf64.lo $elf"; target_size=64 ;; bfd_elf64_alpha_vec) tb="$tb elf64-alpha.lo elf64.lo $elf"; target_size=64 ;; bfd_elf64_big_generic_vec) tb="$tb elf64-gen.lo elf64.lo $elf"; target_size=64 ;; bfd_elf64_bigmips_vec) tb="$tb elf64-mips.lo elf64.lo elfxx-mips.lo elf32.lo $elf ecofflink.lo"; target_size=64 ;; @@ -6321,10 +6309,10 @@ case ${host64}-${target64}-${want64} in if test -n "$GCC" ; then bad_64bit_gcc=no; echo $ac_n "checking for gcc version with buggy 64-bit support""... $ac_c" 1>&6 -echo "configure:6325: checking for gcc version with buggy 64-bit support" >&5 +echo "configure:6313: checking for gcc version with buggy 64-bit support" >&5 # Add more tests for gcc versions with non-working 64-bit support here. cat > conftest.$ac_ext <&6 -echo "configure:6373: checking for $ac_hdr" >&5 +echo "configure:6361: checking for $ac_hdr" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:6383: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:6371: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out | grep -v "^conftest.${ac_ext}\$"` if test -z "$ac_err"; then rm -rf conftest* @@ -6408,12 +6396,12 @@ done for ac_func in getpagesize do echo $ac_n "checking for $ac_func""... $ac_c" 1>&6 -echo "configure:6412: checking for $ac_func" >&5 +echo "configure:6400: checking for $ac_func" >&5 if eval "test \"`echo '$''{'ac_cv_func_$ac_func'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:6428: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_func_$ac_func=yes" else @@ -6461,7 +6449,7 @@ fi done echo $ac_n "checking for working mmap""... $ac_c" 1>&6 -echo "configure:6465: checking for working mmap" >&5 +echo "configure:6453: checking for working mmap" >&5 if eval "test \"`echo '$''{'ac_cv_func_mmap_fixed_mapped'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -6469,7 +6457,7 @@ else ac_cv_func_mmap_fixed_mapped=no else cat > conftest.$ac_ext < #include -#if HAVE_SYS_TYPES_H -# include -#endif - -#if HAVE_STDLIB_H -# include -#endif - -#if HAVE_SYS_STAT_H -# include -#endif - -#if HAVE_UNISTD_H -# include -#endif - /* This mess was copied from the GNU getpagesize.h. */ #ifndef HAVE_GETPAGESIZE +# ifdef HAVE_UNISTD_H +# include +# endif /* Assume that all systems that can run configure have sys/param.h. */ # ifndef HAVE_SYS_PARAM_H @@ -6622,7 +6597,7 @@ main() } EOF -if { (eval echo configure:6626: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext} && (./conftest; exit) 2>/dev/null +if { (eval echo configure:6601: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext} && (./conftest; exit) 2>/dev/null then ac_cv_func_mmap_fixed_mapped=yes else @@ -6647,12 +6622,12 @@ fi for ac_func in madvise mprotect do echo $ac_n "checking for $ac_func""... $ac_c" 1>&6 -echo "configure:6651: checking for $ac_func" >&5 +echo "configure:6626: checking for $ac_func" >&5 if eval "test \"`echo '$''{'ac_cv_func_$ac_func'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:6654: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_func_$ac_func=yes" else diff -Nurpa binutils-2.13/bfd/configure.in binutils-2.13.1/bfd/configure.in --- binutils-2.13/bfd/configure.in 2002-08-05 16:45:25.000000000 -0400 +++ binutils-2.13.1/bfd/configure.in 2002-11-07 13:52:04.000000000 -0500 @@ -7,7 +7,7 @@ AC_INIT(libbfd.c) AC_CANONICAL_SYSTEM AC_ISC_POSIX -AM_INIT_AUTOMAKE(bfd, 2.13) +AM_INIT_AUTOMAKE(bfd, 2.13.1) # Uncomment the next line to remove the date from the reported bfd version is_release=y @@ -109,7 +109,7 @@ bfd_default_target_size=32 AC_PROG_CC -ALL_LINGUAS="fr tr ja es sv" +ALL_LINGUAS="fr tr ja es sv da" CY_GNU_GETTEXT # Permit host specific settings. @@ -575,8 +575,8 @@ do bfd_elf32_hppa_linux_vec) tb="$tb elf32-hppa.lo elf32.lo $elf" ;; bfd_elf32_hppa_vec) tb="$tb elf32-hppa.lo elf32.lo $elf" ;; bfd_elf32_i370_vec) tb="$tb elf32-i370.lo elf32.lo $elf" ;; + bfd_elf32_i386_freebsd_vec) tb="$tb elf32-i386-fbsd.lo elf32.lo $elf" ;; bfd_elf32_i386_vec) tb="$tb elf32-i386.lo elf32.lo $elf" ;; - bfd_elf32_i386qnx_vec) tb="$tb elf32-i386qnx.lo elf32.lo $elf" ;; bfd_elf32_i860_little_vec) tb="$tb elf32-i860.lo elf32.lo $elf" ;; bfd_elf32_i860_vec) tb="$tb elf32-i860.lo elf32.lo $elf" ;; bfd_elf32_i960_vec) tb="$tb elf32-i960.lo elf32.lo $elf" ;; @@ -623,6 +623,7 @@ do bfd_elf32_v850_vec) tb="$tb elf32-v850.lo elf32.lo $elf" ;; bfd_elf32_vax_vec) tb="$tb elf32-vax.lo elf32.lo $elf" ;; bfd_elf32_xstormy16_vec) tb="$tb elf32-xstormy16.lo elf32.lo $elf" ;; + bfd_elf64_alpha_freebsd_vec) tb="$tb elf64-alpha-fbsd.lo elf64.lo $elf"; target_size=64 ;; bfd_elf64_alpha_vec) tb="$tb elf64-alpha.lo elf64.lo $elf"; target_size=64 ;; bfd_elf64_big_generic_vec) tb="$tb elf64-gen.lo elf64.lo $elf"; target_size=64 ;; bfd_elf64_bigmips_vec) tb="$tb elf64-mips.lo elf64.lo elfxx-mips.lo elf32.lo $elf ecofflink.lo"; target_size=64 ;; diff -Nurpa binutils-2.13/bfd/doc/ChangeLog binutils-2.13.1/bfd/doc/ChangeLog --- binutils-2.13/bfd/doc/ChangeLog 2002-06-08 04:50:44.000000000 -0400 +++ binutils-2.13.1/bfd/doc/ChangeLog 2002-09-23 18:08:56.000000000 -0400 @@ -1,3 +1,14 @@ +2002-09-23 Daniel Jacobowitz + + Merge from mainline: + 2002-08-28 John David Anglin + * chew.c (paramstuff, outputdots, perform, bang and usage): Remove + void from function definitions. + +2002-08-13 Alan Modra + + * header.sed: Strip tabs. + 2002-06-08 Alan Modra * Makefile.am: Fix quote style in last change. diff -Nurpa binutils-2.13/bfd/doc/Makefile.in binutils-2.13.1/bfd/doc/Makefile.in --- binutils-2.13/bfd/doc/Makefile.in 2002-06-08 04:50:44.000000000 -0400 +++ binutils-2.13.1/bfd/doc/Makefile.in 2002-11-07 11:57:35.000000000 -0500 @@ -1,6 +1,6 @@ -# Makefile.in generated automatically by automake 1.4-p5 from Makefile.am +# Makefile.in generated automatically by automake 1.4 from Makefile.am -# Copyright (C) 1994, 1995-8, 1999, 2001 Free Software Foundation, Inc. +# Copyright (C) 1994, 1995-8, 1999 Free Software Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. @@ -330,7 +330,7 @@ uninstall-info: else ii=; fi; \ list='$(INFO_DEPS)'; \ for file in $$list; do \ - test -z "$$ii" \ + test -z "$ii" \ || install-info --info-dir=$(DESTDIR)$(infodir) --remove $$file; \ done @$(NORMAL_UNINSTALL) diff -Nurpa binutils-2.13/bfd/doc/bfd.info binutils-2.13.1/bfd/doc/bfd.info --- binutils-2.13/bfd/doc/bfd.info 2002-08-05 16:47:08.000000000 -0400 +++ binutils-2.13.1/bfd/doc/bfd.info 2002-10-30 12:02:37.000000000 -0500 @@ -18,14 +18,14 @@ section entitled "GNU Free Documentation  Indirect: bfd.info-1: 686 -bfd.info-2: 39781 -bfd.info-3: 87238 -bfd.info-4: 103035 -bfd.info-5: 144731 -bfd.info-6: 192970 -bfd.info-7: 230016 -bfd.info-8: 269585 -bfd.info-9: 288007 +bfd.info-2: 39886 +bfd.info-3: 87343 +bfd.info-4: 103140 +bfd.info-5: 144920 +bfd.info-6: 193159 +bfd.info-7: 230205 +bfd.info-8: 269773 +bfd.info-9: 288195  Tag Table: (Indirect) @@ -37,59 +37,59 @@ Node: What BFD Version 2 Can Do4547 Node: BFD information loss5857 Node: Canonical format8380 Node: BFD front end12741 -Node: Memory Usage33879 -Node: Initialization35102 -Node: Sections35479 -Node: Section Input35957 -Node: Section Output37313 -Node: typedef asection39781 -Node: section prototypes57826 -Node: Symbols64964 -Node: Reading Symbols66554 -Node: Writing Symbols67728 -Node: Mini Symbols69418 -Node: typedef asymbol70383 -Node: symbol handling functions75425 -Node: Archives80090 -Node: Formats83708 -Node: Relocations86518 -Node: typedef arelent87238 -Node: howto manager103035 -Node: Core Files141747 -Node: Targets142768 -Node: bfd_target144731 -Node: Architectures164805 -Node: Opening and Closing181093 -Node: Internal185490 -Node: File Caching192970 -Node: Linker Functions195749 -Node: Creating a Linker Hash Table197415 -Node: Adding Symbols to the Hash Table199143 -Node: Differing file formats200033 -Node: Adding symbols from an object file201766 -Node: Adding symbols from an archive203902 -Node: Performing the Final Link206301 -Node: Information provided by the linker207532 -Node: Relocating the section contents208668 -Node: Writing the symbol table210405 -Node: Hash Tables212999 -Node: Creating and Freeing a Hash Table214190 -Node: Looking Up or Entering a String215347 -Node: Traversing a Hash Table216589 -Node: Deriving a New Hash Table Type217367 -Node: Define the Derived Structures218422 -Node: Write the Derived Creation Routine219488 -Node: Write Other Derived Routines222187 -Node: BFD back ends223487 -Node: What to Put Where223753 -Node: aout223891 -Node: coff230016 -Node: elf254749 -Node: mmo255586 -Node: File layout256509 -Node: Symbol-table262147 -Node: mmo section mapping265942 -Node: GNU Free Documentation License269585 -Node: Index288007 +Node: Memory Usage33984 +Node: Initialization35207 +Node: Sections35584 +Node: Section Input36062 +Node: Section Output37418 +Node: typedef asection39886 +Node: section prototypes57931 +Node: Symbols65069 +Node: Reading Symbols66659 +Node: Writing Symbols67833 +Node: Mini Symbols69523 +Node: typedef asymbol70488 +Node: symbol handling functions75530 +Node: Archives80195 +Node: Formats83813 +Node: Relocations86623 +Node: typedef arelent87343 +Node: howto manager103140 +Node: Core Files141936 +Node: Targets142957 +Node: bfd_target144920 +Node: Architectures164994 +Node: Opening and Closing181282 +Node: Internal185679 +Node: File Caching193159 +Node: Linker Functions195938 +Node: Creating a Linker Hash Table197604 +Node: Adding Symbols to the Hash Table199332 +Node: Differing file formats200222 +Node: Adding symbols from an object file201955 +Node: Adding symbols from an archive204091 +Node: Performing the Final Link206490 +Node: Information provided by the linker207721 +Node: Relocating the section contents208857 +Node: Writing the symbol table210594 +Node: Hash Tables213188 +Node: Creating and Freeing a Hash Table214379 +Node: Looking Up or Entering a String215536 +Node: Traversing a Hash Table216778 +Node: Deriving a New Hash Table Type217556 +Node: Define the Derived Structures218611 +Node: Write the Derived Creation Routine219677 +Node: Write Other Derived Routines222376 +Node: BFD back ends223676 +Node: What to Put Where223942 +Node: aout224080 +Node: coff230205 +Node: elf254937 +Node: mmo255774 +Node: File layout256697 +Node: Symbol-table262335 +Node: mmo section mapping266130 +Node: GNU Free Documentation License269773 +Node: Index288195  End Tag Table diff -Nurpa binutils-2.13/bfd/doc/bfd.info-1 binutils-2.13.1/bfd/doc/bfd.info-1 --- binutils-2.13/bfd/doc/bfd.info-1 2002-08-05 16:47:08.000000000 -0400 +++ binutils-2.13.1/bfd/doc/bfd.info-1 2002-10-30 12:02:37.000000000 -0500 @@ -395,6 +395,9 @@ major data about the file and pointers t /* Symbol table for output BFD (with symcount entries). */ struct symbol_cache_entry **outsymbols; + /* Used for slurped dynamic symbol tables. */ + unsigned int dynsymcount; + /* Pointer to structure which contains architecture information. */ const struct bfd_arch_info *arch_info; @@ -895,12 +898,12 @@ Stuff which should be documented: ................... *Synopsis* - boolean bfd_alt_mach_code(bfd *abfd, int index); + boolean bfd_alt_mach_code(bfd *abfd, int alternative); *Description* When more than one machine code number is available for the same machine type, this function can be used to switch between the preferred -one (index == 0) and any others. Currently, only ELF supports this -feature, with up to two alternate machine codes. +one (alternative == 0) and any others. Currently, only ELF supports +this feature, with up to two alternate machine codes. * Menu: diff -Nurpa binutils-2.13/bfd/doc/bfd.info-4 binutils-2.13.1/bfd/doc/bfd.info-4 --- binutils-2.13/bfd/doc/bfd.info-4 2002-08-05 16:47:08.000000000 -0400 +++ binutils-2.13.1/bfd/doc/bfd.info-4 2002-10-30 12:02:37.000000000 -0500 @@ -336,6 +336,9 @@ attributes. - : BFD_RELOC_386_RELATIVE - : BFD_RELOC_386_GOTOFF - : BFD_RELOC_386_GOTPC + - : BFD_RELOC_386_TLS_TPOFF + - : BFD_RELOC_386_TLS_IE + - : BFD_RELOC_386_TLS_GOTIE - : BFD_RELOC_386_TLS_LE - : BFD_RELOC_386_TLS_GD - : BFD_RELOC_386_TLS_LDM diff -Nurpa binutils-2.13/bfd/doc/bfd.info-7 binutils-2.13.1/bfd/doc/bfd.info-7 --- binutils-2.13/bfd/doc/bfd.info-7 2002-08-05 16:47:08.000000000 -0400 +++ binutils-2.13.1/bfd/doc/bfd.info-7 2002-10-30 12:02:37.000000000 -0500 @@ -394,7 +394,7 @@ The hidden information for an `asymbol' struct coff_link_hash_entry *, struct internal_syment *, bfd_vma *)); - boolean (*_bfd_coff_adjust_symndx)\ + boolean (*_bfd_coff_adjust_symndx) PARAMS ((bfd *, struct bfd_link_info *, bfd *, asection *, struct internal_reloc *, boolean *)); diff -Nurpa binutils-2.13/bfd/doc/bfd.info-9 binutils-2.13.1/bfd/doc/bfd.info-9 --- binutils-2.13/bfd/doc/bfd.info-9 2002-08-05 16:47:08.000000000 -0400 +++ binutils-2.13.1/bfd/doc/bfd.info-9 2002-10-30 12:02:37.000000000 -0500 @@ -176,11 +176,14 @@ Index * BFD_RELOC_386_TLS_DTPMOD32: howto manager. * BFD_RELOC_386_TLS_DTPOFF32: howto manager. * BFD_RELOC_386_TLS_GD: howto manager. +* BFD_RELOC_386_TLS_GOTIE: howto manager. +* BFD_RELOC_386_TLS_IE: howto manager. * BFD_RELOC_386_TLS_IE_32: howto manager. * BFD_RELOC_386_TLS_LDM: howto manager. * BFD_RELOC_386_TLS_LDO_32: howto manager. * BFD_RELOC_386_TLS_LE: howto manager. * BFD_RELOC_386_TLS_LE_32: howto manager. +* BFD_RELOC_386_TLS_TPOFF: howto manager. * BFD_RELOC_386_TLS_TPOFF32: howto manager. * BFD_RELOC_390_12: howto manager. * BFD_RELOC_390_COPY: howto manager. diff -Nurpa binutils-2.13/bfd/doc/bfdt.texi binutils-2.13.1/bfd/doc/bfdt.texi --- binutils-2.13/bfd/doc/bfdt.texi 2002-08-05 16:43:45.000000000 -0400 +++ binutils-2.13.1/bfd/doc/bfdt.texi 2002-10-30 12:02:37.000000000 -0500 @@ -104,6 +104,9 @@ struct _bfd /* Symbol table for output BFD (with symcount entries). */ struct symbol_cache_entry **outsymbols; + /* Used for slurped dynamic symbol tables. */ + unsigned int dynsymcount; + /* Pointer to structure which contains architecture information. */ const struct bfd_arch_info *arch_info; @@ -661,12 +664,12 @@ extern bfd_byte *bfd_get_relocated_secti @subsubsection @code{bfd_alt_mach_code} @strong{Synopsis} @example -boolean bfd_alt_mach_code(bfd *abfd, int index); +boolean bfd_alt_mach_code(bfd *abfd, int alternative); @end example @strong{Description}@* When more than one machine code number is available for the same machine type, this function can be used to switch between -the preferred one (index == 0) and any others. Currently, +the preferred one (alternative == 0) and any others. Currently, only ELF supports this feature, with up to two alternate machine codes. diff -Nurpa binutils-2.13/bfd/doc/chew.c binutils-2.13.1/bfd/doc/chew.c --- binutils-2.13/bfd/doc/chew.c 2002-05-25 08:50:18.000000000 -0400 +++ binutils-2.13.1/bfd/doc/chew.c 2002-09-23 18:08:56.000000000 -0400 @@ -485,7 +485,7 @@ print_stack_level () */ static void -paramstuff (void) +paramstuff () { unsigned int openp; unsigned int fname; @@ -626,7 +626,7 @@ manglecomments () /* Mod tos so that only lines with leading dots remain */ static void -outputdots (void) +outputdots () { unsigned int idx = 0; string_type out; @@ -1261,7 +1261,7 @@ lookup_word (word) } static void -perform (void) +perform () { tos = stack; @@ -1412,7 +1412,7 @@ compile (string) } static void -bang (void) +bang () { *(long *) ((isp[0])) = isp[-1]; isp -= 2; @@ -1487,7 +1487,7 @@ read_in (str, file) } static void -usage (void) +usage () { fprintf (stderr, "usage: -[d|i|g] file\n"); exit (33); diff -Nurpa binutils-2.13/bfd/doc/coffcode.texi binutils-2.13.1/bfd/doc/coffcode.texi --- binutils-2.13/bfd/doc/coffcode.texi 2002-08-05 16:43:45.000000000 -0400 +++ binutils-2.13.1/bfd/doc/coffcode.texi 2002-10-30 12:02:37.000000000 -0500 @@ -398,7 +398,7 @@ typedef struct struct coff_link_hash_entry *, struct internal_syment *, bfd_vma *)); - boolean (*_bfd_coff_adjust_symndx)\ + boolean (*_bfd_coff_adjust_symndx) PARAMS ((bfd *, struct bfd_link_info *, bfd *, asection *, struct internal_reloc *, boolean *)); diff -Nurpa binutils-2.13/bfd/doc/header.sed binutils-2.13.1/bfd/doc/header.sed --- binutils-2.13/bfd/doc/header.sed 2001-10-01 10:03:36.000000000 -0400 +++ binutils-2.13.1/bfd/doc/header.sed 2002-08-12 22:39:04.000000000 -0400 @@ -1,3 +1,4 @@ +s|[ ][ ]*| |g s|\(.*\) [^ ]*header.sed.*|\1| s|[^ ]*/||g s|^ *|"| diff -Nurpa binutils-2.13/bfd/doc/reloc.texi binutils-2.13.1/bfd/doc/reloc.texi --- binutils-2.13/bfd/doc/reloc.texi 2002-08-05 16:43:45.000000000 -0400 +++ binutils-2.13.1/bfd/doc/reloc.texi 2002-10-30 12:02:37.000000000 -0500 @@ -804,6 +804,9 @@ MIPS ELF relocations. @deffnx {} BFD_RELOC_386_RELATIVE @deffnx {} BFD_RELOC_386_GOTOFF @deffnx {} BFD_RELOC_386_GOTPC +@deffnx {} BFD_RELOC_386_TLS_TPOFF +@deffnx {} BFD_RELOC_386_TLS_IE +@deffnx {} BFD_RELOC_386_TLS_GOTIE @deffnx {} BFD_RELOC_386_TLS_LE @deffnx {} BFD_RELOC_386_TLS_GD @deffnx {} BFD_RELOC_386_TLS_LDM diff -Nurpa binutils-2.13/bfd/dwarf2.c binutils-2.13.1/bfd/dwarf2.c --- binutils-2.13/bfd/dwarf2.c 2002-06-27 07:51:42.000000000 -0400 +++ binutils-2.13.1/bfd/dwarf2.c 2002-10-28 13:45:43.000000000 -0500 @@ -13,21 +13,21 @@ based on Fred Fish's (Cygnus Support) implementation of DWARF 1 support in dwarfread.c -This file is part of BFD. + This file is part of BFD. -This program is free software; you can redistribute it and/or modify -it under the terms of the GNU General Public License as published by -the Free Software Foundation; either version 2 of the License, or (at -your option) any later version. - -This program is distributed in the hope that it will be useful, but -WITHOUT ANY WARRANTY; without even the implied warranty of -MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU -General Public License for more details. - -You should have received a copy of the GNU General Public License -along with this program; if not, write to the Free Software -Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. */ + This program is free software; you can redistribute it and/or modify + it under the terms of the GNU General Public License as published by + the Free Software Foundation; either version 2 of the License, or (at + your option) any later version. + + This program is distributed in the hope that it will be useful, but + WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + General Public License for more details. + + You should have received a copy of the GNU General Public License + along with this program; if not, write to the Free Software + Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. */ #include "bfd.h" #include "sysdep.h" @@ -402,7 +402,7 @@ read_indirect_string (unit, buf, bytes_r return NULL; } - buf = stash->dwarf_str_buffer + offset; + buf = stash->dwarf_str_buffer + offset; if (*buf == '\0') return NULL; return buf; @@ -578,7 +578,8 @@ read_abbrevs (abfd, offset, stash) /* Read in abbrev header. */ cur_abbrev->number = abbrev_number; - cur_abbrev->tag = read_unsigned_leb128 (abfd, abbrev_ptr, &bytes_read); + cur_abbrev->tag = (enum dwarf_tag) + read_unsigned_leb128 (abfd, abbrev_ptr, &bytes_read); abbrev_ptr += bytes_read; cur_abbrev->has_children = read_1_byte (abfd, abbrev_ptr); abbrev_ptr += 1; @@ -601,8 +602,10 @@ read_abbrevs (abfd, offset, stash) return 0; } - cur_abbrev->attrs[cur_abbrev->num_attrs].name = abbrev_name; - cur_abbrev->attrs[cur_abbrev->num_attrs++].form = abbrev_form; + cur_abbrev->attrs[cur_abbrev->num_attrs].name + = (enum dwarf_attribute) abbrev_name; + cur_abbrev->attrs[cur_abbrev->num_attrs++].form + = (enum dwarf_form) abbrev_form; abbrev_name = read_unsigned_leb128 (abfd, abbrev_ptr, &bytes_read); abbrev_ptr += bytes_read; abbrev_form = read_unsigned_leb128 (abfd, abbrev_ptr, &bytes_read); @@ -614,7 +617,7 @@ read_abbrevs (abfd, offset, stash) abbrevs[hash_number] = cur_abbrev; /* Get next abbreviation. - Under Irix6 the abbreviations for a compilation unit are not + Under Irix6 the abbreviations for a compilation unit are not always properly terminated with an abbrev number of 0. Exit loop if we encounter an abbreviation which we have already read (which means we are about to read the abbreviations @@ -646,7 +649,7 @@ read_attribute_value (attr, form, unit, struct dwarf_block *blk; bfd_size_type amt; - attr->form = form; + attr->form = (enum dwarf_form) form; switch (form) { @@ -806,7 +809,8 @@ struct line_info_table char* comp_dir; char** dirs; struct fileinfo* files; - struct line_info* last_line; + struct line_info* last_line; /* largest VMA */ + struct line_info* lcl_head; /* local head; used in 'add_line_info' */ }; struct funcinfo @@ -817,6 +821,11 @@ struct funcinfo bfd_vma high; }; +/* add_line_info: adds a new entry to the line_info list in the + line_info_table, ensuring that the list is sorted. Note that the + line_info list is sorted from highest to lowest VMA (with possible + duplicates); that is, line_info->prev_line always accesses an equal + or smaller VMA. */ static void add_line_info (table, address, filename, line, column, end_sequence) struct line_info_table* table; @@ -829,9 +838,72 @@ add_line_info (table, address, filename, bfd_size_type amt = sizeof (struct line_info); struct line_info* info = (struct line_info*) bfd_alloc (table->abfd, amt); - info->prev_line = table->last_line; - table->last_line = info; + /* Find the correct location for 'info'. Normally we will receive + new line_info data 1) in order and 2) with increasing VMAs. + However some compilers break the rules (cf. decode_line_info) and + so we include some heuristics for quickly finding the correct + location for 'info'. In particular, these heuristics optimize for + the common case in which the VMA sequence that we receive is a + list of locally sorted VMAs such as + p...z a...j (where a < j < p < z) + + Note: table->lcl_head is used to head an *actual* or *possible* + sequence within the list (such as a...j) that is not directly + headed by table->last_line + + Note: we may receive duplicate entries from 'decode_line_info'. */ + + while (1) + if (!table->last_line + || address >= table->last_line->address) + { + /* Normal case: add 'info' to the beginning of the list */ + info->prev_line = table->last_line; + table->last_line = info; + + /* lcl_head: initialize to head a *possible* sequence at the end. */ + if (!table->lcl_head) + table->lcl_head = info; + break; + } + else if (!table->lcl_head->prev_line + && table->lcl_head->address > address) + { + /* Abnormal but easy: lcl_head is 1) at the *end* of the line + list and 2) the head of 'info'. */ + info->prev_line = NULL; + table->lcl_head->prev_line = info; + break; + } + else if (table->lcl_head->prev_line + && table->lcl_head->address > address + && address >= table->lcl_head->prev_line->address) + { + /* Abnormal but easy: lcl_head is 1) in the *middle* of the line + list and 2) the head of 'info'. */ + info->prev_line = table->lcl_head->prev_line; + table->lcl_head->prev_line = info; + break; + } + else + { + /* Abnormal and hard: Neither 'last_line' nor 'lcl_head' are valid + heads for 'info'. Reset 'lcl_head' and repeat. */ + struct line_info* li2 = table->last_line; /* always non-NULL */ + struct line_info* li1 = li2->prev_line; + + while (li1) + { + if (li2->address > address && address >= li1->address) + break; + + li2 = li1; /* always non-NULL */ + li1 = li1->prev_line; + } + table->lcl_head = li2; + } + /* Set member data of 'info'. */ info->address = address; info->filename = filename; info->line = line; @@ -856,13 +928,18 @@ concat_filename (table, file) filename = table->files[file - 1].name; if (IS_ABSOLUTE_PATH(filename)) return filename; - else { char* dirname = (table->files[file - 1].dir ? table->dirs[table->files[file - 1].dir - 1] : table->comp_dir); - return (char*) concat (dirname, "/", filename, NULL); + + /* Not all tools set DW_AT_comp_dir, so dirname may be unknown. The + best we can do is return the filename part. */ + if (dirname == NULL) + return filename; + else + return (char*) concat (dirname, "/", filename, NULL); } } @@ -903,7 +980,8 @@ arange_add (unit, low_pc, high_pc) } /* Need to allocate a new arange and insert it into the arange list. */ - arange = bfd_zalloc (unit->abfd, (bfd_size_type) sizeof (*arange)); + arange = (struct arange *) + bfd_zalloc (unit->abfd, (bfd_size_type) sizeof (*arange)); arange->low = low_pc; arange->high = high_pc; @@ -977,6 +1055,7 @@ decode_line_info (unit, stash) table->files = NULL; table->last_line = NULL; + table->lcl_head = NULL; line_ptr = stash->dwarf_line_buffer + unit->line_offset; @@ -1079,13 +1158,19 @@ decode_line_info (unit, stash) { /* State machine registers. */ bfd_vma address = 0; - char* filename = concat_filename (table, 1); + char * filename = concat_filename (table, 1); unsigned int line = 1; unsigned int column = 0; int is_stmt = lh.default_is_stmt; int basic_block = 0; - int end_sequence = 0, need_low_pc = 1; - bfd_vma low_pc = 0; + int end_sequence = 0; + /* eraxxon@alumni.rice.edu: Against the DWARF2 specs, some + compilers generate address sequences that are wildly out of + order using DW_LNE_set_address (e.g. Intel C++ 6.0 compiler + for ia64-Linux). Thus, to determine the low and high + address, we must compare on every DW_LNS_copy, etc. */ + bfd_vma low_pc = 0; + bfd_vma high_pc = 0; /* Decode the table. */ while (! end_sequence) @@ -1094,7 +1179,8 @@ decode_line_info (unit, stash) line_ptr += 1; if (op_code >= lh.opcode_base) - { /* Special operand. */ + { + /* Special operand. */ adj_opcode = op_code - lh.opcode_base; address += (adj_opcode / lh.line_range) * lh.minimum_instruction_length; @@ -1102,30 +1188,30 @@ decode_line_info (unit, stash) /* Append row to matrix using current values. */ add_line_info (table, address, filename, line, column, 0); basic_block = 1; - if (need_low_pc) - { - need_low_pc = 0; - low_pc = address; - } + if (low_pc == 0 || address < low_pc) + low_pc = address; + if (address > high_pc) + high_pc = address; } else switch (op_code) { case DW_LNS_extended_op: - line_ptr += 1; /* Ignore length. */ + /* Ignore length. */ + line_ptr += 1; extended_op = read_1_byte (abfd, line_ptr); line_ptr += 1; + switch (extended_op) { case DW_LNE_end_sequence: end_sequence = 1; add_line_info (table, address, filename, line, column, end_sequence); - if (need_low_pc) - { - need_low_pc = 0; - low_pc = address; - } - arange_add (unit, low_pc, address); + if (low_pc == 0 || address < low_pc) + low_pc = address; + if (address > high_pc) + high_pc = address; + arange_add (unit, low_pc, high_pc); break; case DW_LNE_set_address: address = read_address (unit, line_ptr); @@ -1164,11 +1250,10 @@ decode_line_info (unit, stash) case DW_LNS_copy: add_line_info (table, address, filename, line, column, 0); basic_block = 0; - if (need_low_pc) - { - need_low_pc = 0; - low_pc = address; - } + if (low_pc == 0 || address < low_pc) + low_pc = address; + if (address > high_pc) + high_pc = address; break; case DW_LNS_advance_pc: address += lh.minimum_instruction_length @@ -1183,8 +1268,8 @@ decode_line_info (unit, stash) { unsigned int file; - /* The file and directory tables are 0 based, the references - are 1 based. */ + /* The file and directory tables are 0 + based, the references are 1 based. */ file = read_unsigned_leb128 (abfd, line_ptr, &bytes_read); line_ptr += bytes_read; filename = concat_filename (table, file); @@ -1209,8 +1294,9 @@ decode_line_info (unit, stash) line_ptr += 2; break; default: - { /* Unknown standard opcode, ignore it. */ + { int i; + /* Unknown standard opcode, ignore it. */ for (i = 0; i < lh.standard_opcode_lengths[op_code]; i++) { (void) read_unsigned_leb128 (abfd, line_ptr, &bytes_read); @@ -1229,10 +1315,7 @@ decode_line_info (unit, stash) LINENUMBER_PTR, are pointers to the objects to be filled in. */ static boolean -lookup_address_in_line_info_table (table, - addr, - function, - filename_ptr, +lookup_address_in_line_info_table (table, addr, function, filename_ptr, linenumber_ptr) struct line_info_table* table; bfd_vma addr; @@ -1240,19 +1323,31 @@ lookup_address_in_line_info_table (table const char **filename_ptr; unsigned int *linenumber_ptr; { + /* Note: table->last_line should be a descendingly sorted list. */ struct line_info* next_line = table->last_line; - struct line_info* each_line; + struct line_info* each_line = NULL; + *filename_ptr = NULL; if (!next_line) return false; each_line = next_line->prev_line; + /* Check for large addresses */ + if (addr > next_line->address) + each_line = NULL; /* ensure we skip over the normal case */ + + /* Normal case: search the list; save */ while (each_line && next_line) { - if (!each_line->end_sequence - && addr >= each_line->address && addr < next_line->address) + /* If we have an address match, save this info. This allows us + to return as good as results as possible for strange debugging + info. */ + boolean addr_match = false; + if (each_line->address <= addr && addr <= next_line->address) { + addr_match = true; + /* If this line appears to span functions, and addr is in the later function, return the first line of that function instead of the last line of the earlier one. This check is for GCC @@ -1269,16 +1364,22 @@ lookup_address_in_line_info_table (table *filename_ptr = each_line->filename; *linenumber_ptr = each_line->line; } - return true; } + + if (addr_match && !each_line->end_sequence) + return true; /* we have definitely found what we want */ + next_line = each_line; each_line = each_line->prev_line; } - /* At this point each_line is NULL but next_line is not. If we found the - containing function in this compilation unit, return the first line we - have a number for. This is also for compatibility with GCC 2.95. */ - if (function != NULL) + /* At this point each_line is NULL but next_line is not. If we found + a candidate end-of-sequence point in the loop above, we can return + that (compatibility with a bug in the Intel compiler); otherwise, + assuming that we found the containing function for this address in + this compilation unit, return the first line we have a number for + (compatibility with GCC 2.95). */ + if (*filename_ptr == NULL && function != NULL) { *filename_ptr = next_line->filename; *linenumber_ptr = next_line->line; @@ -1293,9 +1394,7 @@ lookup_address_in_line_info_table (table /* If ADDR is within TABLE, set FUNCTIONNAME_PTR, and return true. */ static boolean -lookup_address_in_function_table (table, - addr, - function_ptr, +lookup_address_in_function_table (table, addr, function_ptr, functionname_ptr) struct funcinfo* table; bfd_vma addr; @@ -1638,18 +1737,18 @@ comp_unit_contains_address (unit, addr) struct arange *arange; if (unit->error) - return 0; + return false; arange = &unit->arange; do { if (addr >= arange->low && addr < arange->high) - return 1; + return true; arange = arange->next; } while (arange); - return 0; + return false; } /* If UNIT contains ADDR, set the output parameters to the values for @@ -1661,9 +1760,8 @@ comp_unit_contains_address (unit, addr) false otherwise. */ static boolean -comp_unit_find_nearest_line (unit, addr, - filename_ptr, functionname_ptr, linenumber_ptr, - stash) +comp_unit_find_nearest_line (unit, addr, filename_ptr, functionname_ptr, + linenumber_ptr, stash) struct comp_unit* unit; bfd_vma addr; const char **filename_ptr; @@ -1695,7 +1793,7 @@ comp_unit_find_nearest_line (unit, addr, } if (unit->first_child_die_ptr < unit->end_ptr - && ! scan_unit_for_functions (unit)) + && ! scan_unit_for_functions (unit)) { unit->error = 1; return false; @@ -1703,26 +1801,23 @@ comp_unit_find_nearest_line (unit, addr, } function = NULL; - func_p = lookup_address_in_function_table (unit->function_table, - addr, - &function, - functionname_ptr); - line_p = lookup_address_in_line_info_table (unit->line_table, - addr, - function, - filename_ptr, + func_p = lookup_address_in_function_table (unit->function_table, addr, + &function, functionname_ptr); + line_p = lookup_address_in_line_info_table (unit->line_table, addr, + function, filename_ptr, linenumber_ptr); - return line_p || func_p; + return (boolean) (line_p || func_p); } -/* Locate a section in a BFD containing debugging info. The search starts from the - section after AFTER_SEC, or from the first section in the BFD if AFTER_SEC is - NULL. The search works by examining the names of the sections. There are two - permissiable names. The first is .debug_info. This is the standard DWARF2 name. - The second is a prefix .gnu.linkonce.wi. This is a variation on the .debug_info - section which has a checksum describing the contents appended onto the name. This - allows the linker to identify and discard duplicate debugging sections for - different compilation units. */ +/* Locate a section in a BFD containing debugging info. The search starts + from the section after AFTER_SEC, or from the first section in the BFD if + AFTER_SEC is NULL. The search works by examining the names of the + sections. There are two permissiable names. The first is .debug_info. + This is the standard DWARF2 name. The second is a prefix .gnu.linkonce.wi. + This is a variation on the .debug_info section which has a checksum + describing the contents appended onto the name. This allows the linker to + identify and discard duplicate debugging sections for different + compilation units. */ #define DWARF2_DEBUG_INFO ".debug_info" #define GNU_LINKONCE_INFO ".gnu.linkonce.wi." @@ -1761,8 +1856,7 @@ find_debug_info (abfd, after_sec) boolean _bfd_dwarf2_find_nearest_line (abfd, section, symbols, offset, filename_ptr, functionname_ptr, - linenumber_ptr, - addr_size, pinfo) + linenumber_ptr, addr_size, pinfo) bfd *abfd; asection *section; asymbol **symbols; @@ -1819,7 +1913,7 @@ _bfd_dwarf2_find_nearest_line (abfd, sec return false; /* There can be more than one DWARF2 info section in a BFD these days. - Read them all in and produce one large stash. We do this in two + Read them all in and produce one large stash. We do this in two passes - in the first pass we just accumulate the section sizes. In the second pass we read in the section's contents. The allows us to avoid reallocing the data as we add sections to the stash. */ @@ -1902,13 +1996,20 @@ _bfd_dwarf2_find_nearest_line (abfd, sec length = read_8_bytes (abfd, stash->info_ptr + 4); stash->info_ptr += 8; } + else if (length == 0) + { + /* Handle (non-standard) 64-bit DWARF2 formats. */ + offset_size = 8; + length = read_4_bytes (abfd, stash->info_ptr + 4); + stash->info_ptr += 4; + } } else length = read_8_bytes (abfd, stash->info_ptr); stash->info_ptr += addr_size; if (length > 0) - { + { each = parse_comp_unit (abfd, stash, length, offset_size); stash->info_ptr += length; diff -Nurpa binutils-2.13/bfd/ecoff.c binutils-2.13.1/bfd/ecoff.c --- binutils-2.13/bfd/ecoff.c 2002-06-25 04:47:31.000000000 -0400 +++ binutils-2.13.1/bfd/ecoff.c 2002-10-11 04:56:13.000000000 -0400 @@ -553,7 +553,9 @@ _bfd_ecoff_slurp_symbolic_info (abfd, ig UPDATE_RAW_END (cbDnOffset, idnMax, backend->debug_swap.external_dnr_size); UPDATE_RAW_END (cbPdOffset, ipdMax, backend->debug_swap.external_pdr_size); UPDATE_RAW_END (cbSymOffset, isymMax, backend->debug_swap.external_sym_size); - UPDATE_RAW_END (cbOptOffset, ioptMax, backend->debug_swap.external_opt_size); + /* eraxxon@alumni.rice.edu: ioptMax refers to the size of the + optimization symtab, not the number of entries */ + UPDATE_RAW_END (cbOptOffset, ioptMax, sizeof (char)); UPDATE_RAW_END (cbAuxOffset, iauxMax, sizeof (union aux_ext)); UPDATE_RAW_END (cbSsOffset, issMax, sizeof (char)); UPDATE_RAW_END (cbSsExtOffset, issExtMax, sizeof (char)); @@ -3289,8 +3291,6 @@ _bfd_ecoff_archive_p (abfd) char armag[SARMAG + 1]; bfd_size_type amt; - tdata_hold = abfd->tdata.aout_ar_data; - if (bfd_bread ((PTR) armag, (bfd_size_type) SARMAG, abfd) != SARMAG) { if (bfd_get_error () != bfd_error_system_call) @@ -3304,15 +3304,13 @@ _bfd_ecoff_archive_p (abfd) return NULL; } - /* We are setting bfd_ardata(abfd) here, but since bfd_ardata - involves a cast, we can't do it as the left operand of - assignment. */ - amt = sizeof (struct artdata); - abfd->tdata.aout_ar_data = (struct artdata *) bfd_zalloc (abfd, amt); + tdata_hold = bfd_ardata (abfd); + amt = sizeof (struct artdata); + bfd_ardata (abfd) = (struct artdata *) bfd_zalloc (abfd, amt); if (bfd_ardata (abfd) == (struct artdata *) NULL) { - abfd->tdata.aout_ar_data = tdata_hold; + bfd_ardata (abfd) = tdata_hold; return (const bfd_target *) NULL; } @@ -3327,7 +3325,7 @@ _bfd_ecoff_archive_p (abfd) || ! _bfd_ecoff_slurp_extended_name_table (abfd)) { bfd_release (abfd, bfd_ardata (abfd)); - abfd->tdata.aout_ar_data = tdata_hold; + bfd_ardata (abfd) = tdata_hold; return (const bfd_target *) NULL; } @@ -3345,22 +3343,23 @@ _bfd_ecoff_archive_p (abfd) first = bfd_openr_next_archived_file (abfd, (bfd *) NULL); if (first != NULL) { - boolean fail; - first->target_defaulted = false; - fail = false; if (bfd_check_format (first, bfd_object) && first->xvec != abfd->xvec) { +#if 0 + /* We ought to close `first' here, but we can't, because + we have no way to remove it from the archive cache. + It's close to impossible to figure out when we can + release bfd_ardata. FIXME. */ (void) bfd_close (first); bfd_release (abfd, bfd_ardata (abfd)); - abfd->tdata.aout_ar_data = tdata_hold; - bfd_set_error (bfd_error_wrong_format); +#endif + bfd_set_error (bfd_error_wrong_object_format); + bfd_ardata (abfd) = tdata_hold; return NULL; } - - /* We ought to close first here, but we can't, because we - have no way to remove it from the archive cache. FIXME. */ + /* And we ought to close `first' here too. */ } } @@ -3838,7 +3837,7 @@ ecoff_link_add_externals (abfd, info, ex = backend->debug_swap.swap_ext_in; bfd_size_type external_ext_size = backend->debug_swap.external_ext_size; unsigned long ext_count; - struct ecoff_link_hash_entry **sym_hash; + struct bfd_link_hash_entry **sym_hash; char *ext_ptr; char *ext_end; bfd_size_type amt; @@ -3847,10 +3846,10 @@ ecoff_link_add_externals (abfd, info, ex amt = ext_count; amt *= sizeof (struct bfd_link_hash_entry *); - sym_hash = (struct ecoff_link_hash_entry **) bfd_alloc (abfd, amt); + sym_hash = (struct bfd_link_hash_entry **) bfd_alloc (abfd, amt); if (!sym_hash) return false; - ecoff_data (abfd)->sym_hashes = sym_hash; + ecoff_data (abfd)->sym_hashes = (struct ecoff_link_hash_entry **) sym_hash; ext_ptr = (char *) external_ext; ext_end = ext_ptr + ext_count * external_ext_size; @@ -3981,15 +3980,13 @@ ecoff_link_add_externals (abfd, info, ex name = ssext + esym.asym.iss; - h = NULL; if (! (_bfd_generic_link_add_one_symbol (info, abfd, name, (flagword) (esym.weakext ? BSF_WEAK : BSF_GLOBAL), - section, value, (const char *) NULL, true, true, - (struct bfd_link_hash_entry **) &h))) + section, value, (const char *) NULL, true, true, sym_hash))) return false; - *sym_hash = h; + h = (struct ecoff_link_hash_entry *) *sym_hash; /* If we are building an ECOFF hash table, save the external symbol information. */ diff -Nurpa binutils-2.13/bfd/elf-bfd.h binutils-2.13.1/bfd/elf-bfd.h --- binutils-2.13/bfd/elf-bfd.h 2002-07-30 14:19:42.000000000 -0400 +++ binutils-2.13.1/bfd/elf-bfd.h 2002-11-07 11:57:33.000000000 -0500 @@ -717,7 +717,8 @@ struct elf_backend_data newly created and plt/got refcounts and dynamic indices should not be copied. */ void (*elf_backend_copy_indirect_symbol) - PARAMS ((struct elf_link_hash_entry *, struct elf_link_hash_entry *)); + PARAMS ((struct elf_backend_data *, struct elf_link_hash_entry *, + struct elf_link_hash_entry *)); /* Modify any information related to dynamic linking such that the symbol is not exported. */ @@ -769,22 +770,6 @@ struct elf_backend_data boolean (*elf_backend_write_section) PARAMS ((bfd *, asection *, bfd_byte *)); - /* This function, if defined, sets up the file positions for non PT_LOAD - segments, especially for segments containing non-allocated sections. */ - void (*set_nonloadable_filepos) - PARAMS ((bfd *, Elf_Internal_Phdr *)); - - /* This function, if defined, returns true if the section is contained - within the segment. File positions are compared. */ - boolean (*is_contained_by_filepos) - PARAMS ((asection *, Elf_Internal_Phdr *)); - - /* This function, if defined, returns true if copy_private_bfd_data - should be called. It provides a way of overriding default - test conditions in _bfd_elf_copy_private_section_data. */ - boolean (*copy_private_bfd_data_p) - PARAMS ((bfd *, asection *, bfd *, asection *)); - /* The level of IRIX compatibility we're striving for. MIPS ELF specific function. */ irix_compat_t (*elf_backend_mips_irix_compat) @@ -1271,7 +1256,8 @@ extern struct bfd_hash_entry *_bfd_elf_l extern struct bfd_link_hash_table *_bfd_elf_link_hash_table_create PARAMS ((bfd *)); extern void _bfd_elf_link_hash_copy_indirect - PARAMS ((struct elf_link_hash_entry *, struct elf_link_hash_entry *)); + PARAMS ((struct elf_backend_data *, struct elf_link_hash_entry *, + struct elf_link_hash_entry *)); extern void _bfd_elf_link_hash_hide_symbol PARAMS ((struct bfd_link_info *, struct elf_link_hash_entry *, boolean)); extern boolean _bfd_elf_link_hash_table_init diff -Nurpa binutils-2.13/bfd/elf-eh-frame.c binutils-2.13.1/bfd/elf-eh-frame.c --- binutils-2.13/bfd/elf-eh-frame.c 2002-05-14 20:18:56.000000000 -0400 +++ binutils-2.13.1/bfd/elf-eh-frame.c 2002-10-31 04:33:40.000000000 -0500 @@ -414,7 +414,7 @@ _bfd_elf_discard_section_eh_frame (abfd, /* 64-bit .eh_frame is not supported. */ goto free_no_table; buf += 4; - if ((buf - ehbuf) + hdr.length > sec->_raw_size) + if ((bfd_size_type) (buf - ehbuf) + hdr.length > sec->_raw_size) /* CIE/FDE not contained fully in this .eh_frame input section. */ goto free_no_table; @@ -627,11 +627,11 @@ _bfd_elf_discard_section_eh_frame (abfd, goto free_no_table; if ((*reloc_symbol_deleted_p) (buf - ehbuf, cookie)) { - cookie->rel = rel; /* This is a FDE against discarded section, it should be deleted. */ new_size -= hdr.length + 4; sec_info->entry[sec_info->count].removed = 1; + memset (rel, 0, sizeof (*rel)); } else { diff -Nurpa binutils-2.13/bfd/elf.c binutils-2.13.1/bfd/elf.c --- binutils-2.13/bfd/elf.c 2002-07-30 14:19:42.000000000 -0400 +++ binutils-2.13.1/bfd/elf.c 2002-11-07 11:57:33.000000000 -0500 @@ -371,7 +371,7 @@ bfd_elf_get_elf_syms (ibfd, symtab_hdr, { Elf_Internal_Shdr *shndx_hdr; PTR alloc_ext; - const PTR esym; + const bfd_byte *esym; Elf_External_Sym_Shndx *alloc_extshndx; Elf_External_Sym_Shndx *shndx; Elf_Internal_Sym *isym; @@ -1418,10 +1418,12 @@ _bfd_elf_link_hash_newfunc (entry, table old indirect symbol. Also used for copying flags to a weakdef. */ void -_bfd_elf_link_hash_copy_indirect (dir, ind) +_bfd_elf_link_hash_copy_indirect (bed, dir, ind) + struct elf_backend_data *bed; struct elf_link_hash_entry *dir, *ind; { bfd_signed_vma tmp; + bfd_signed_vma lowest_valid = bed->can_refcount; /* Copy down any references that we may have already seen to the symbol which just became indirect. */ @@ -1439,22 +1441,22 @@ _bfd_elf_link_hash_copy_indirect (dir, i /* Copy over the global and procedure linkage table refcount entries. These may have been already set up by a check_relocs routine. */ tmp = dir->got.refcount; - if (tmp <= 0) + if (tmp < lowest_valid) { dir->got.refcount = ind->got.refcount; ind->got.refcount = tmp; } else - BFD_ASSERT (ind->got.refcount <= 0); + BFD_ASSERT (ind->got.refcount < lowest_valid); tmp = dir->plt.refcount; - if (tmp <= 0) + if (tmp < lowest_valid) { dir->plt.refcount = ind->plt.refcount; ind->plt.refcount = tmp; } else - BFD_ASSERT (ind->plt.refcount <= 0); + BFD_ASSERT (ind->plt.refcount < lowest_valid); if (dir->dynindx == -1) { @@ -3315,8 +3317,9 @@ map_sections_to_segments (abfd) } else if (! writable && (hdr->flags & SEC_READONLY) == 0 - && (BFD_ALIGN (last_hdr->lma + last_hdr->_raw_size, maxpagesize) - == hdr->lma)) + && (((last_hdr->lma + last_hdr->_raw_size - 1) + & ~(maxpagesize - 1)) + != (hdr->lma & ~(maxpagesize - 1)))) { /* We don't want to put a writable section in a read only segment, unless they are on the same page in memory @@ -3957,11 +3960,6 @@ Error: First section in segment (%s) sta } } - /* If additional nonloadable filepos adjustments are required, - do them now. */ - if (bed->set_nonloadable_filepos) - (*bed->set_nonloadable_filepos) (abfd, phdrs); - /* Clear out any program headers we allocated but did not use. */ for (; count < alloc; count++, p++) { @@ -4557,13 +4555,6 @@ copy_private_bfd_data (ibfd, obfd) && (section->lma + section->_raw_size \ <= SEGMENT_END (segment, base))) - /* Returns true if the given section is contained within the - given segment. Filepos addresses are compared in an elf - backend function. */ -#define IS_CONTAINED_BY_FILEPOS(sec, seg, bed) \ - (bed->is_contained_by_filepos \ - && (*bed->is_contained_by_filepos) (sec, seg)) - /* Special case: corefile "NOTE" section containing regs, prpsinfo etc. */ #define IS_COREFILE_NOTE(p, s) \ (p->p_type == PT_NOTE \ @@ -4599,9 +4590,7 @@ copy_private_bfd_data (ibfd, obfd) ? IS_CONTAINED_BY_LMA (section, segment, segment->p_paddr) \ : IS_CONTAINED_BY_VMA (section, segment)) \ && (section->flags & SEC_ALLOC) != 0) \ - || IS_COREFILE_NOTE (segment, section) \ - || (IS_CONTAINED_BY_FILEPOS (section, segment, bed) \ - && (section->flags & SEC_ALLOC) == 0)) \ + || IS_COREFILE_NOTE (segment, section)) \ && section->output_section != NULL \ && ! section->segment_mark) @@ -4846,7 +4835,6 @@ copy_private_bfd_data (ibfd, obfd) /* Match up the physical address of the segment with the LMA address of the output section. */ if (IS_CONTAINED_BY_LMA (output_section, segment, map->p_paddr) - || IS_CONTAINED_BY_FILEPOS (section, segment, bed) || IS_COREFILE_NOTE (segment, section) || (bed->want_p_paddr_set_to_zero && IS_CONTAINED_BY_VMA (output_section, segment)) @@ -5083,7 +5071,6 @@ copy_private_bfd_data (ibfd, obfd) #undef SEGMENT_END #undef IS_CONTAINED_BY_VMA #undef IS_CONTAINED_BY_LMA -#undef IS_CONTAINED_BY_FILEPOS #undef IS_COREFILE_NOTE #undef IS_SOLARIS_PT_INTERP #undef INCLUDE_SECTION_IN_SEGMENT @@ -5109,20 +5096,7 @@ _bfd_elf_copy_private_section_data (ibfd || obfd->xvec->flavour != bfd_target_elf_flavour) return true; - /* Copy over private BFD data if it has not already been copied. - This must be done here, rather than in the copy_private_bfd_data - entry point, because the latter is called after the section - contents have been set, which means that the program headers have - already been worked out. The backend function provides a way to - override the test conditions and code path for the call to - copy_private_bfd_data. */ - if (bed->copy_private_bfd_data_p) - { - if ((*bed->copy_private_bfd_data_p) (ibfd, isec, obfd, osec)) - if (! copy_private_bfd_data (ibfd, obfd)) - return false; - } - else if (elf_tdata (obfd)->segment_map == NULL && elf_tdata (ibfd)->phdr != NULL) + if (elf_tdata (obfd)->segment_map == NULL && elf_tdata (ibfd)->phdr != NULL) { asection *s; @@ -5570,7 +5544,11 @@ _bfd_elf_canonicalize_dynamic_symtab (ab asymbol **alocation; { struct elf_backend_data *bed = get_elf_backend_data (abfd); - return bed->s->slurp_symbol_table (abfd, alocation, true); + long symcount = bed->s->slurp_symbol_table (abfd, alocation, true); + + if (symcount >= 0) + bfd_get_dynamic_symcount (abfd) = symcount; + return symcount; } /* Return the size required for the dynamic reloc entries. Any @@ -6039,7 +6017,7 @@ _bfd_elf_find_nearest_line (abfd, sectio functionname_ptr, line_ptr, &elf_tdata (abfd)->line_info)) return false; - if (found) + if (found && (*functionname_ptr || *line_ptr)) return true; if (symbols == NULL) diff -Nurpa binutils-2.13/bfd/elf32-arm.h binutils-2.13.1/bfd/elf32-arm.h --- binutils-2.13/bfd/elf32-arm.h 2002-07-07 05:10:40.000000000 -0400 +++ binutils-2.13.1/bfd/elf32-arm.h 2002-10-11 04:56:13.000000000 -0400 @@ -423,6 +423,7 @@ record_arm_to_thumb_glue (link_info, h) asection * s; char * tmp_name; struct elf_link_hash_entry * myh; + struct bfd_link_hash_entry * bh; struct elf32_arm_link_hash_table * globals; bfd_vma val; @@ -456,11 +457,11 @@ record_arm_to_thumb_glue (link_info, h) /* The only trick here is using hash_table->arm_glue_size as the value. Even though the section isn't allocated yet, this is where we will be putting it. */ + bh = NULL; val = globals->arm_glue_size + 1; _bfd_generic_link_add_one_symbol (link_info, globals->bfd_of_glue_owner, tmp_name, BSF_GLOBAL, s, val, - NULL, true, false, - (struct bfd_link_hash_entry **) &myh); + NULL, true, false, &bh); free (tmp_name); @@ -478,6 +479,7 @@ record_thumb_to_arm_glue (link_info, h) asection *s; char *tmp_name; struct elf_link_hash_entry *myh; + struct bfd_link_hash_entry *bh; struct elf32_arm_link_hash_table *hash_table; char bind; bfd_vma val; @@ -509,13 +511,14 @@ record_thumb_to_arm_glue (link_info, h) return; } + bh = NULL; val = hash_table->thumb_glue_size + 1; _bfd_generic_link_add_one_symbol (link_info, hash_table->bfd_of_glue_owner, tmp_name, BSF_GLOBAL, s, val, - NULL, true, false, - (struct bfd_link_hash_entry **) &myh); + NULL, true, false, &bh); /* If we mark it 'Thumb', the disassembler will do a better job. */ + myh = (struct elf_link_hash_entry *) bh; bind = ELF_ST_BIND (myh->type); myh->type = ELF_ST_INFO (bind, STT_ARM_TFUNC); @@ -532,13 +535,11 @@ record_thumb_to_arm_glue (link_info, h) sprintf (tmp_name, CHANGE_TO_ARM, name); - myh = NULL; - + bh = NULL; val = hash_table->thumb_glue_size + 4, _bfd_generic_link_add_one_symbol (link_info, hash_table->bfd_of_glue_owner, tmp_name, BSF_LOCAL, s, val, - NULL, true, false, - (struct bfd_link_hash_entry **) &myh); + NULL, true, false, &bh); free (tmp_name); @@ -2958,16 +2959,22 @@ elf32_arm_adjust_dynamic_symbol (info, h if (h->type == STT_FUNC || (h->elf_link_hash_flags & ELF_LINK_HASH_NEEDS_PLT) != 0) { + /* If we link a program (not a DSO), we'll get rid of unnecessary + PLT entries; we point to the actual symbols -- even for pic + relocs, because a program built with -fpic should have the same + result as one built without -fpic, specifically considering weak + symbols. + FIXME: m68k and i386 differ here, for unclear reasons. */ if (! info->shared - && (h->elf_link_hash_flags & ELF_LINK_HASH_DEF_DYNAMIC) == 0 - && (h->elf_link_hash_flags & ELF_LINK_HASH_REF_DYNAMIC) == 0) + && (h->elf_link_hash_flags & ELF_LINK_HASH_DEF_DYNAMIC) == 0) { /* This case can occur if we saw a PLT32 reloc in an input - file, but the symbol was never referred to by a dynamic - object. In such a case, we don't actually need to build - a procedure linkage table, and we can just do a PC32 - reloc instead. */ + file, but the symbol was not defined by a dynamic object. + In such a case, we don't actually need to build a + procedure linkage table, and we can just do a PC32 reloc + instead. */ BFD_ASSERT ((h->elf_link_hash_flags & ELF_LINK_HASH_NEEDS_PLT) != 0); + h->elf_link_hash_flags &= ~ELF_LINK_HASH_NEEDS_PLT; return true; } diff -Nurpa binutils-2.13/bfd/elf32-cris.c binutils-2.13.1/bfd/elf32-cris.c --- binutils-2.13/bfd/elf32-cris.c 2002-07-12 11:54:57.000000000 -0400 +++ binutils-2.13.1/bfd/elf32-cris.c 2002-08-15 01:37:11.000000000 -0400 @@ -2935,7 +2935,8 @@ elf_cris_discard_excess_program_dynamics functions; doing this for all symbols would presumably not introduce new problems. Of course we don't do this if we're exporting all dynamic symbols. */ - if (! info->export_dynamic) + if (! info->export_dynamic + && (h->root.elf_link_hash_flags & ELF_LINK_HASH_REF_DYNAMIC) == 0) { h->root.dynindx = -1; _bfd_elf_strtab_delref (elf_hash_table (info)->dynstr, diff -Nurpa binutils-2.13/bfd/elf32-h8300.c binutils-2.13.1/bfd/elf32-h8300.c --- binutils-2.13/bfd/elf32-h8300.c 2002-07-07 05:10:39.000000000 -0400 +++ binutils-2.13.1/bfd/elf32-h8300.c 2002-09-23 18:12:39.000000000 -0400 @@ -782,7 +782,7 @@ elf32_h8_relax_section (abfd, sec, link_ Elf_Internal_Sym *isym; asection *sym_sec; - isym = isymbuf + ELF64_R_SYM (irel->r_info); + isym = isymbuf + ELF32_R_SYM (irel->r_info); sym_sec = bfd_section_from_elf_index (abfd, isym->st_shndx); symval = (isym->st_value + sym_sec->output_section->vma diff -Nurpa binutils-2.13/bfd/elf32-hppa.c binutils-2.13.1/bfd/elf32-hppa.c --- binutils-2.13/bfd/elf32-hppa.c 2002-07-07 05:10:40.000000000 -0400 +++ binutils-2.13.1/bfd/elf32-hppa.c 2002-08-21 21:34:15.000000000 -0400 @@ -327,7 +327,8 @@ static boolean elf32_hppa_create_dynamic PARAMS ((bfd *, struct bfd_link_info *)); static void elf32_hppa_copy_indirect_symbol - PARAMS ((struct elf_link_hash_entry *, struct elf_link_hash_entry *)); + PARAMS ((struct elf_backend_data *, struct elf_link_hash_entry *, + struct elf_link_hash_entry *)); static boolean elf32_hppa_check_relocs PARAMS ((bfd *, struct bfd_link_info *, @@ -1145,7 +1146,8 @@ elf32_hppa_create_dynamic_sections (abfd /* Copy the extra info we tack onto an elf_link_hash_entry. */ static void -elf32_hppa_copy_indirect_symbol (dir, ind) +elf32_hppa_copy_indirect_symbol (bed, dir, ind) + struct elf_backend_data *bed; struct elf_link_hash_entry *dir, *ind; { struct elf32_hppa_link_hash_entry *edir, *eind; @@ -1189,7 +1191,7 @@ elf32_hppa_copy_indirect_symbol (dir, in eind->dyn_relocs = NULL; } - _bfd_elf_link_hash_copy_indirect (dir, ind); + _bfd_elf_link_hash_copy_indirect (bed, dir, ind); } /* Look through the relocs for a section during the first phase, and diff -Nurpa binutils-2.13/bfd/elf32-i386-fbsd.c binutils-2.13.1/bfd/elf32-i386-fbsd.c --- binutils-2.13/bfd/elf32-i386-fbsd.c 1969-12-31 19:00:00.000000000 -0500 +++ binutils-2.13.1/bfd/elf32-i386-fbsd.c 2002-09-23 18:12:40.000000000 -0400 @@ -0,0 +1,56 @@ +/* Intel IA-32 specific support for 32-bit ELF on FreeBSD. + Copyright 2002 Free Software Foundation, Inc. + +This file is part of BFD, the Binary File Descriptor library. + +This program is free software; you can redistribute it and/or modify +it under the terms of the GNU General Public License as published by +the Free Software Foundation; either version 2 of the License, or +(at your option) any later version. + +This program is distributed in the hope that it will be useful, +but WITHOUT ANY WARRANTY; without even the implied warranty of +MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +GNU General Public License for more details. + +You should have received a copy of the GNU General Public License +along with this program; if not, write to the Free Software +Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. */ + +#define TARGET_LITTLE_SYM bfd_elf32_i386_freebsd_vec +#define TARGET_LITTLE_NAME "elf32-i386-freebsd" +#define ELF_ARCH bfd_arch_i386 +#define ELF_MACHINE_CODE EM_386 +#define ELF_MAXPAGESIZE 0x1000 + +#include "bfd.h" +#include "sysdep.h" +#include "elf-bfd.h" + +/* The kernel recognizes executables as valid only if they carry a + "FreeBSD" label in the ELF header. So we put this label on all + executables and (for simplicity) also all other object files. */ + +static void elf_i386_post_process_headers + PARAMS ((bfd *, struct bfd_link_info *)); + +static void +elf_i386_post_process_headers (abfd, link_info) + bfd * abfd; + struct bfd_link_info * link_info ATTRIBUTE_UNUSED; +{ + Elf_Internal_Ehdr * i_ehdrp; /* ELF file header, internal form. */ + + i_ehdrp = elf_elfheader (abfd); + + /* Put an ABI label supported by FreeBSD >= 4.1. */ + i_ehdrp->e_ident[EI_OSABI] = ELFOSABI_FREEBSD; +#ifdef OLD_FREEBSD_ABI_LABEL + /* The ABI label supported by FreeBSD <= 4.0 is quite nonstandard. */ + memcpy (&i_ehdrp->e_ident[EI_ABIVERSION], "FreeBSD", 8); +#endif +} + +#define elf_backend_post_process_headers elf_i386_post_process_headers + +#include "elf32-i386.c" diff -Nurpa binutils-2.13/bfd/elf32-i386.c binutils-2.13.1/bfd/elf32-i386.c --- binutils-2.13/bfd/elf32-i386.c 2002-08-01 11:09:59.000000000 -0400 +++ binutils-2.13.1/bfd/elf32-i386.c 2002-11-07 11:57:33.000000000 -0500 @@ -45,7 +45,8 @@ static boolean create_got_section static boolean elf_i386_create_dynamic_sections PARAMS((bfd *, struct bfd_link_info *)); static void elf_i386_copy_indirect_symbol - PARAMS ((struct elf_link_hash_entry *, struct elf_link_hash_entry *)); + PARAMS ((struct elf_backend_data *, struct elf_link_hash_entry *, + struct elf_link_hash_entry *)); static int elf_i386_tls_transition PARAMS ((struct bfd_link_info *, int, int)); @@ -132,9 +133,18 @@ static reloc_howto_type elf_howto_table[ R_386_ext_offset is the value to subtract from a reloc type of R_386_16 thru R_386_PC8 to form an index into this table. */ #define R_386_standard ((unsigned int) R_386_GOTPC + 1) -#define R_386_ext_offset ((unsigned int) R_386_TLS_LE - R_386_standard) +#define R_386_ext_offset ((unsigned int) R_386_TLS_TPOFF - R_386_standard) - /* The remaining relocs are a GNU extension. */ + /* These relocs are a GNU extension. */ + HOWTO(R_386_TLS_TPOFF, 0, 2, 32, false, 0, complain_overflow_bitfield, + bfd_elf_generic_reloc, "R_386_TLS_TPOFF", + true, 0xffffffff, 0xffffffff, false), + HOWTO(R_386_TLS_IE, 0, 2, 32, false, 0, complain_overflow_bitfield, + bfd_elf_generic_reloc, "R_386_TLS_IE", + true, 0xffffffff, 0xffffffff, false), + HOWTO(R_386_TLS_GOTIE, 0, 2, 32, false, 0, complain_overflow_bitfield, + bfd_elf_generic_reloc, "R_386_TLS_GOTIE", + true, 0xffffffff, 0xffffffff, false), HOWTO(R_386_TLS_LE, 0, 2, 32, false, 0, complain_overflow_bitfield, bfd_elf_generic_reloc, "R_386_TLS_LE", true, 0xffffffff, 0xffffffff, false), @@ -278,7 +288,19 @@ elf_i386_reloc_type_lookup (abfd, code) TRACE ("BFD_RELOC_386_GOTPC"); return &elf_howto_table[(unsigned int) R_386_GOTPC ]; - /* The remaining relocs are a GNU extension. */ + /* These relocs are a GNU extension. */ + case BFD_RELOC_386_TLS_TPOFF: + TRACE ("BFD_RELOC_386_TLS_TPOFF"); + return &elf_howto_table[(unsigned int) R_386_TLS_TPOFF - R_386_ext_offset]; + + case BFD_RELOC_386_TLS_IE: + TRACE ("BFD_RELOC_386_TLS_IE"); + return &elf_howto_table[(unsigned int) R_386_TLS_IE - R_386_ext_offset]; + + case BFD_RELOC_386_TLS_GOTIE: + TRACE ("BFD_RELOC_386_TLS_GOTIE"); + return &elf_howto_table[(unsigned int) R_386_TLS_GOTIE - R_386_ext_offset]; + case BFD_RELOC_386_TLS_LE: TRACE ("BFD_RELOC_386_TLS_LE"); return &elf_howto_table[(unsigned int) R_386_TLS_LE - R_386_ext_offset]; @@ -563,9 +585,14 @@ struct elf_i386_link_hash_entry /* Track dynamic relocs copied for this symbol. */ struct elf_i386_dyn_relocs *dyn_relocs; - enum { - GOT_UNKNOWN = 0, GOT_NORMAL, GOT_TLS_GD, GOT_TLS_IE - } tls_type; +#define GOT_UNKNOWN 0 +#define GOT_NORMAL 1 +#define GOT_TLS_GD 2 +#define GOT_TLS_IE 4 +#define GOT_TLS_IE_POS 5 +#define GOT_TLS_IE_NEG 6 +#define GOT_TLS_IE_BOTH 7 + unsigned char tls_type; }; #define elf_i386_hash_entry(ent) ((struct elf_i386_link_hash_entry *)(ent)) @@ -767,7 +794,8 @@ elf_i386_create_dynamic_sections (dynobj /* Copy the extra info we tack onto an elf_link_hash_entry. */ static void -elf_i386_copy_indirect_symbol (dir, ind) +elf_i386_copy_indirect_symbol (bed, dir, ind) + struct elf_backend_data *bed; struct elf_link_hash_entry *dir, *ind; { struct elf_i386_link_hash_entry *edir, *eind; @@ -815,7 +843,7 @@ elf_i386_copy_indirect_symbol (dir, ind) edir->tls_type = eind->tls_type; eind->tls_type = GOT_UNKNOWN; } - _bfd_elf_link_hash_copy_indirect (dir, ind); + _bfd_elf_link_hash_copy_indirect (bed, dir, ind); } static int @@ -834,6 +862,11 @@ elf_i386_tls_transition (info, r_type, i if (is_local) return R_386_TLS_LE_32; return R_386_TLS_IE_32; + case R_386_TLS_IE: + case R_386_TLS_GOTIE: + if (is_local) + return R_386_TLS_LE_32; + return r_type; case R_386_TLS_LDM: return R_386_TLS_LE_32; } @@ -895,10 +928,34 @@ elf_i386_check_relocs (abfd, info, sec, switch (r_type) { + case R_386_TLS_LDM: + htab->tls_ldm_got.refcount += 1; + goto create_got; + + case R_386_PLT32: + /* This symbol requires a procedure linkage table entry. We + actually build the entry in adjust_dynamic_symbol, + because this might be a case of linking PIC code which is + never referenced by a dynamic object, in which case we + don't need to generate a procedure linkage table entry + after all. */ + + /* If this is a local symbol, we resolve it directly without + creating a procedure linkage table entry. */ + if (h == NULL) + continue; + + h->elf_link_hash_flags |= ELF_LINK_HASH_NEEDS_PLT; + h->plt.refcount += 1; + break; + case R_386_TLS_IE_32: + case R_386_TLS_IE: + case R_386_TLS_GOTIE: if (info->shared) info->flags |= DF_STATIC_TLS; - /* FALLTHROUGH */ + /* Fall through */ + case R_386_GOT32: case R_386_TLS_GD: /* This symbol requires a global offset table entry. */ @@ -910,7 +967,17 @@ elf_i386_check_relocs (abfd, info, sec, default: case R_386_GOT32: tls_type = GOT_NORMAL; break; case R_386_TLS_GD: tls_type = GOT_TLS_GD; break; - case R_386_TLS_IE_32: tls_type = GOT_TLS_IE; break; + case R_386_TLS_IE_32: + if (ELF32_R_TYPE (rel->r_info) == r_type) + tls_type = GOT_TLS_IE_NEG; + else + /* If this is a GD->IE transition, we may use either of + R_386_TLS_TPOFF and R_386_TLS_TPOFF32. */ + tls_type = GOT_TLS_IE; + break; + case R_386_TLS_IE: + case R_386_TLS_GOTIE: + tls_type = GOT_TLS_IE_POS; break; } if (h != NULL) @@ -942,18 +1009,22 @@ elf_i386_check_relocs (abfd, info, sec, old_tls_type = elf_i386_local_got_tls_type (abfd) [r_symndx]; } + if ((old_tls_type & GOT_TLS_IE) && (tls_type & GOT_TLS_IE)) + tls_type |= old_tls_type; /* If a TLS symbol is accessed using IE at least once, there is no point to use dynamic model for it. */ - if (old_tls_type != tls_type && old_tls_type != GOT_UNKNOWN - && (old_tls_type != GOT_TLS_GD || tls_type != GOT_TLS_IE)) + else if (old_tls_type != tls_type && old_tls_type != GOT_UNKNOWN + && (old_tls_type != GOT_TLS_GD + || (tls_type & GOT_TLS_IE) == 0)) { - if (old_tls_type == GOT_TLS_IE && tls_type == GOT_TLS_GD) - tls_type = GOT_TLS_IE; + if ((old_tls_type & GOT_TLS_IE) && tls_type == GOT_TLS_GD) + tls_type = old_tls_type; else { (*_bfd_error_handler) (_("%s: `%s' accessed both as normal and thread local symbol"), - bfd_archive_filename (abfd), h->root.root.string); + bfd_archive_filename (abfd), + h ? h->root.root.string : ""); return false; } } @@ -978,28 +1049,15 @@ elf_i386_check_relocs (abfd, info, sec, if (!create_got_section (htab->elf.dynobj, info)) return false; } - break; - - case R_386_TLS_LDM: - htab->tls_ldm_got.refcount += 1; - goto create_got; - - case R_386_PLT32: - /* This symbol requires a procedure linkage table entry. We - actually build the entry in adjust_dynamic_symbol, - because this might be a case of linking PIC code which is - never referenced by a dynamic object, in which case we - don't need to generate a procedure linkage table entry - after all. */ - - /* If this is a local symbol, we resolve it directly without - creating a procedure linkage table entry. */ - if (h == NULL) - continue; + if (r_type != R_386_TLS_IE) + break; + /* Fall through */ - h->elf_link_hash_flags |= ELF_LINK_HASH_NEEDS_PLT; - h->plt.refcount += 1; - break; + case R_386_TLS_LE_32: + case R_386_TLS_LE: + if (!info->shared) + break; + /* Fall through */ case R_386_32: case R_386_PC32: @@ -1159,16 +1217,6 @@ elf_i386_check_relocs (abfd, info, sec, return false; break; - case R_386_TLS_LE_32: - case R_386_TLS_LE: - if (info->shared) - { - (*_bfd_error_handler) (_("%s: TLS local exec code cannot be linked into shared objects"), - bfd_archive_filename (abfd)); - return false; - } - break; - default: break; } @@ -1231,6 +1279,7 @@ elf_i386_gc_sweep_hook (abfd, info, sec, bfd_signed_vma *local_got_refcounts; const Elf_Internal_Rela *rel, *relend; unsigned long r_symndx; + int r_type; struct elf_link_hash_entry *h; elf_section_data (sec)->local_dynrel = NULL; @@ -1241,9 +1290,10 @@ elf_i386_gc_sweep_hook (abfd, info, sec, relend = relocs + sec->reloc_count; for (rel = relocs; rel < relend; rel++) - switch (elf_i386_tls_transition (info, ELF32_R_TYPE (rel->r_info), - ELF32_R_SYM (rel->r_info) - >= symtab_hdr->sh_info)) + switch ((r_type = elf_i386_tls_transition (info, + ELF32_R_TYPE (rel->r_info), + ELF32_R_SYM (rel->r_info) + >= symtab_hdr->sh_info))) { case R_386_TLS_LDM: if (elf_i386_hash_table (info)->tls_ldm_got.refcount > 0) @@ -1252,6 +1302,8 @@ elf_i386_gc_sweep_hook (abfd, info, sec, case R_386_TLS_GD: case R_386_TLS_IE_32: + case R_386_TLS_IE: + case R_386_TLS_GOTIE: case R_386_GOT32: r_symndx = ELF32_R_SYM (rel->r_info); if (r_symndx >= symtab_hdr->sh_info) @@ -1265,7 +1317,15 @@ elf_i386_gc_sweep_hook (abfd, info, sec, if (local_got_refcounts[r_symndx] > 0) local_got_refcounts[r_symndx] -= 1; } - break; + if (r_type != R_386_TLS_IE) + break; + /* Fall through */ + + case R_386_TLS_LE_32: + case R_386_TLS_LE: + if (!info->shared) + break; + /* Fall through */ case R_386_32: case R_386_PC32: @@ -1551,12 +1611,12 @@ allocate_dynrelocs (h, inf) h->elf_link_hash_flags &= ~ELF_LINK_HASH_NEEDS_PLT; } - /* If R_386_TLS_IE_32 symbol is now local to the binary, + /* If R_386_TLS_{IE_32,IE,GOTIE} symbol is now local to the binary, make it a R_386_TLS_LE_32 requiring no TLS entry. */ if (h->got.refcount > 0 && !info->shared && h->dynindx == -1 - && elf_i386_hash_entry(h)->tls_type == GOT_TLS_IE) + && (elf_i386_hash_entry(h)->tls_type & GOT_TLS_IE)) h->got.offset = (bfd_vma) -1; else if (h->got.refcount > 0) { @@ -1577,13 +1637,18 @@ allocate_dynrelocs (h, inf) h->got.offset = s->_raw_size; s->_raw_size += 4; /* R_386_TLS_GD needs 2 consecutive GOT slots. */ - if (tls_type == GOT_TLS_GD) + if (tls_type == GOT_TLS_GD || tls_type == GOT_TLS_IE_BOTH) s->_raw_size += 4; dyn = htab->elf.dynamic_sections_created; /* R_386_TLS_IE_32 needs one dynamic relocation, - R_386_TLS_GD needs one if local symbol and two if global. */ - if ((tls_type == GOT_TLS_GD && h->dynindx == -1) - || tls_type == GOT_TLS_IE) + R_386_TLS_IE resp. R_386_TLS_GOTIE needs one dynamic relocation, + (but if both R_386_TLS_IE_32 and R_386_TLS_IE is present, we + need two), R_386_TLS_GD needs one if local symbol and two if + global. */ + if (tls_type == GOT_TLS_IE_BOTH) + htab->srelgot->_raw_size += 2 * sizeof (Elf32_External_Rel); + else if ((tls_type == GOT_TLS_GD && h->dynindx == -1) + || (tls_type & GOT_TLS_IE)) htab->srelgot->_raw_size += sizeof (Elf32_External_Rel); else if (tls_type == GOT_TLS_GD) htab->srelgot->_raw_size += 2 * sizeof (Elf32_External_Rel); @@ -1784,12 +1849,18 @@ elf_i386_size_dynamic_sections (output_b { *local_got = s->_raw_size; s->_raw_size += 4; - if (*local_tls_type == GOT_TLS_GD) + if (*local_tls_type == GOT_TLS_GD + || *local_tls_type == GOT_TLS_IE_BOTH) s->_raw_size += 4; if (info->shared || *local_tls_type == GOT_TLS_GD - || *local_tls_type == GOT_TLS_IE) - srel->_raw_size += sizeof (Elf32_External_Rel); + || (*local_tls_type & GOT_TLS_IE)) + { + if (*local_tls_type == GOT_TLS_IE_BOTH) + srel->_raw_size += 2 * sizeof (Elf32_External_Rel); + else + srel->_raw_size += sizeof (Elf32_External_Rel); + } } else *local_got = (bfd_vma) -1; @@ -1960,7 +2031,9 @@ static bfd_vma dtpoff_base (info) struct bfd_link_info *info; { - BFD_ASSERT (elf_hash_table (info)->tls_segment != NULL); + /* If tls_segment is NULL, we should have signalled an error already. */ + if (elf_hash_table (info)->tls_segment == NULL) + return 0; return elf_hash_table (info)->tls_segment->start; } @@ -1975,7 +2048,9 @@ tpoff (info, address) struct elf_link_tls_segment *tls_segment = elf_hash_table (info)->tls_segment; - BFD_ASSERT (tls_segment != NULL); + /* If tls_segment is NULL, we should have signalled an error already. */ + if (tls_segment == NULL) + return 0; return (align_power (tls_segment->size, tls_segment->align) + tls_segment->start - address); } @@ -2416,8 +2491,29 @@ elf_i386_relocate_section (output_bfd, i } break; + case R_386_TLS_IE: + if (info->shared) + { + Elf_Internal_Rel outrel; + asection *sreloc; + Elf32_External_Rel *loc; + + outrel.r_offset = rel->r_offset + + input_section->output_section->vma + + input_section->output_offset; + outrel.r_info = ELF32_R_INFO (0, R_386_RELATIVE); + sreloc = elf_section_data (input_section)->sreloc; + if (sreloc == NULL) + abort (); + loc = (Elf32_External_Rel *) sreloc->contents; + loc += sreloc->reloc_count++; + bfd_elf32_swap_reloc_out (output_bfd, &outrel, loc); + } + /* Fall through */ + case R_386_TLS_GD: case R_386_TLS_IE_32: + case R_386_TLS_GOTIE: r_type = elf_i386_tls_transition (info, r_type, h == NULL); tls_type = GOT_UNKNOWN; if (h == NULL && local_got_offsets) @@ -2425,11 +2521,18 @@ elf_i386_relocate_section (output_bfd, i else if (h != NULL) { tls_type = elf_i386_hash_entry(h)->tls_type; - if (!info->shared && h->dynindx == -1 && tls_type == GOT_TLS_IE) + if (!info->shared && h->dynindx == -1 && (tls_type & GOT_TLS_IE)) r_type = R_386_TLS_LE_32; } - if (r_type == R_386_TLS_GD && tls_type == GOT_TLS_IE) - r_type = R_386_TLS_IE_32; + if (tls_type == GOT_TLS_IE) + tls_type = GOT_TLS_IE_NEG; + if (r_type == R_386_TLS_GD) + { + if (tls_type == GOT_TLS_IE_POS) + r_type = R_386_TLS_GOTIE; + else if (tls_type & GOT_TLS_IE) + r_type = R_386_TLS_IE_32; + } if (r_type == R_386_TLS_LE_32) { @@ -2497,27 +2600,81 @@ elf_i386_relocate_section (output_bfd, i rel++; continue; } - else + else if (ELF32_R_TYPE (rel->r_info) == R_386_TLS_IE) { unsigned int val, type; /* IE->LE transition: - Originally it can be either: + Originally it can be one of: + movl foo, %eax + movl foo, %reg + addl foo, %reg + We change it into: + movl $foo, %eax + movl $foo, %reg + addl $foo, %reg. */ + BFD_ASSERT (rel->r_offset >= 1); + val = bfd_get_8 (input_bfd, contents + rel->r_offset - 1); + BFD_ASSERT (rel->r_offset + 4 <= input_section->_raw_size); + if (val == 0xa1) + { + /* movl foo, %eax. */ + bfd_put_8 (output_bfd, 0xb8, contents + rel->r_offset - 1); + } + else + { + BFD_ASSERT (rel->r_offset >= 2); + type = bfd_get_8 (input_bfd, contents + rel->r_offset - 2); + switch (type) + { + case 0x8b: + /* movl */ + BFD_ASSERT ((val & 0xc7) == 0x05); + bfd_put_8 (output_bfd, 0xc7, + contents + rel->r_offset - 2); + bfd_put_8 (output_bfd, + 0xc0 | ((val >> 3) & 7), + contents + rel->r_offset - 1); + break; + case 0x03: + /* addl */ + BFD_ASSERT ((val & 0xc7) == 0x05); + bfd_put_8 (output_bfd, 0x81, + contents + rel->r_offset - 2); + bfd_put_8 (output_bfd, + 0xc0 | ((val >> 3) & 7), + contents + rel->r_offset - 1); + break; + default: + BFD_FAIL (); + break; + } + } + bfd_put_32 (output_bfd, -tpoff (info, relocation), + contents + rel->r_offset); + continue; + } + else + { + unsigned int val, type; + + /* {IE_32,GOTIE}->LE transition: + Originally it can be one of: subl foo(%reg1), %reg2 - or movl foo(%reg1), %reg2 + addl foo(%reg1), %reg2 We change it into: subl $foo, %reg2 - or - movl $foo, %reg2 (6 byte form) */ + movl $foo, %reg2 (6 byte form) + addl $foo, %reg2. */ BFD_ASSERT (rel->r_offset >= 2); type = bfd_get_8 (input_bfd, contents + rel->r_offset - 2); val = bfd_get_8 (input_bfd, contents + rel->r_offset - 1); BFD_ASSERT (rel->r_offset + 4 <= input_section->_raw_size); + BFD_ASSERT ((val & 0xc0) == 0x80 && (val & 7) != 4); if (type == 0x8b) { /* movl */ - BFD_ASSERT ((val & 0xc0) == 0x80 && (val & 7) != 4); bfd_put_8 (output_bfd, 0xc7, contents + rel->r_offset - 2); bfd_put_8 (output_bfd, 0xc0 | ((val >> 3) & 7), @@ -2526,16 +2683,27 @@ elf_i386_relocate_section (output_bfd, i else if (type == 0x2b) { /* subl */ - BFD_ASSERT ((val & 0xc0) == 0x80 && (val & 7) != 4); bfd_put_8 (output_bfd, 0x81, contents + rel->r_offset - 2); bfd_put_8 (output_bfd, 0xe8 | ((val >> 3) & 7), contents + rel->r_offset - 1); } + else if (type == 0x03) + { + /* addl */ + bfd_put_8 (output_bfd, 0x81, + contents + rel->r_offset - 2); + bfd_put_8 (output_bfd, 0xc0 | ((val >> 3) & 7), + contents + rel->r_offset - 1); + } else BFD_FAIL (); - bfd_put_32 (output_bfd, tpoff (info, relocation), - contents + rel->r_offset); + if (ELF32_R_TYPE (rel->r_info) == R_386_TLS_GOTIE) + bfd_put_32 (output_bfd, -tpoff (info, relocation), + contents + rel->r_offset); + else + bfd_put_32 (output_bfd, tpoff (info, relocation), + contents + rel->r_offset); continue; } } @@ -2567,13 +2735,22 @@ elf_i386_relocate_section (output_bfd, i outrel.r_offset = (htab->sgot->output_section->vma + htab->sgot->output_offset + off); - bfd_put_32 (output_bfd, 0, - htab->sgot->contents + off); indx = h && h->dynindx != -1 ? h->dynindx : 0; if (r_type == R_386_TLS_GD) dr_type = R_386_TLS_DTPMOD32; + else if (tls_type == GOT_TLS_IE_POS) + dr_type = R_386_TLS_TPOFF; else dr_type = R_386_TLS_TPOFF32; + if (dr_type == R_386_TLS_TPOFF && indx == 0) + bfd_put_32 (output_bfd, relocation - dtpoff_base (info), + htab->sgot->contents + off); + else if (dr_type == R_386_TLS_TPOFF32 && indx == 0) + bfd_put_32 (output_bfd, dtpoff_base (info) - relocation, + htab->sgot->contents + off); + else + bfd_put_32 (output_bfd, 0, + htab->sgot->contents + off); outrel.r_info = ELF32_R_INFO (indx, dr_type); loc = (Elf32_External_Rel *) htab->srelgot->contents; loc += htab->srelgot->reloc_count++; @@ -2601,6 +2778,17 @@ elf_i386_relocate_section (output_bfd, i loc); } } + else if (tls_type == GOT_TLS_IE_BOTH) + { + bfd_put_32 (output_bfd, + indx == 0 ? relocation - dtpoff_base (info) : 0, + htab->sgot->contents + off + 4); + outrel.r_info = ELF32_R_INFO (indx, R_386_TLS_TPOFF); + outrel.r_offset += 4; + htab->srelgot->reloc_count++; + loc++; + bfd_elf32_swap_reloc_out (output_bfd, &outrel, loc); + } if (h != NULL) h->got.offset |= 1; @@ -2613,6 +2801,11 @@ elf_i386_relocate_section (output_bfd, i if (r_type == ELF32_R_TYPE (rel->r_info)) { relocation = htab->sgot->output_offset + off; + if ((r_type == R_386_TLS_IE || r_type == R_386_TLS_GOTIE) + && tls_type == GOT_TLS_IE_BOTH) + relocation += 4; + if (r_type == R_386_TLS_IE) + relocation += htab->sgot->output_section->vma; unresolved_reloc = false; } else @@ -2658,6 +2851,17 @@ elf_i386_relocate_section (output_bfd, i memcpy (contents + roff, "\x65\xa1\0\0\0\0\x2b\x80\0\0\0", 12); contents[roff + 7] = 0x80 | (val & 7); + /* If foo is used only with foo@gotntpoff(%reg) and + foo@indntpoff, but not with foo@gottpoff(%reg), change + subl $foo@gottpoff(%reg), %eax + into: + addl $foo@gotntpoff(%reg), %eax. */ + if (r_type == R_386_TLS_GOTIE) + { + contents[roff + 6] = 0x03; + if (tls_type == GOT_TLS_IE_BOTH) + off += 4; + } bfd_put_32 (output_bfd, htab->sgot->output_offset + off, contents + roff + 8); /* Skip R_386_PLT32. */ @@ -2733,11 +2937,42 @@ elf_i386_relocate_section (output_bfd, i break; case R_386_TLS_LE_32: - relocation = tpoff (info, relocation); - break; - case R_386_TLS_LE: - relocation = -tpoff (info, relocation); + if (info->shared) + { + Elf_Internal_Rel outrel; + asection *sreloc; + Elf32_External_Rel *loc; + int indx; + + outrel.r_offset = rel->r_offset + + input_section->output_section->vma + + input_section->output_offset; + if (h != NULL && h->dynindx != -1) + indx = h->dynindx; + else + indx = 0; + if (r_type == R_386_TLS_LE_32) + outrel.r_info = ELF32_R_INFO (indx, R_386_TLS_TPOFF32); + else + outrel.r_info = ELF32_R_INFO (indx, R_386_TLS_TPOFF); + sreloc = elf_section_data (input_section)->sreloc; + if (sreloc == NULL) + abort (); + loc = (Elf32_External_Rel *) sreloc->contents; + loc += sreloc->reloc_count++; + bfd_elf32_swap_reloc_out (output_bfd, &outrel, loc); + if (indx) + continue; + else if (r_type == R_386_TLS_LE_32) + relocation = dtpoff_base (info) - relocation; + else + relocation -= dtpoff_base (info); + } + else if (r_type == R_386_TLS_LE_32) + relocation = tpoff (info, relocation); + else + relocation = -tpoff (info, relocation); break; default: @@ -2750,12 +2985,15 @@ elf_i386_relocate_section (output_bfd, i if (unresolved_reloc && !((input_section->flags & SEC_DEBUGGING) != 0 && (h->elf_link_hash_flags & ELF_LINK_HASH_DEF_DYNAMIC) != 0)) - (*_bfd_error_handler) - (_("%s(%s+0x%lx): unresolvable relocation against symbol `%s'"), - bfd_archive_filename (input_bfd), - bfd_get_section_name (input_bfd, input_section), - (long) rel->r_offset, - h->root.root.string); + { + (*_bfd_error_handler) + (_("%s(%s+0x%lx): unresolvable relocation against symbol `%s'"), + bfd_archive_filename (input_bfd), + bfd_get_section_name (input_bfd, input_section), + (long) rel->r_offset, + h->root.root.string); + return false; + } r = _bfd_final_link_relocate (howto, input_bfd, input_section, contents, rel->r_offset, @@ -2894,7 +3132,7 @@ elf_i386_finish_dynamic_symbol (output_b if (h->got.offset != (bfd_vma) -1 && elf_i386_hash_entry(h)->tls_type != GOT_TLS_GD - && elf_i386_hash_entry(h)->tls_type != GOT_TLS_IE) + && (elf_i386_hash_entry(h)->tls_type & GOT_TLS_IE) == 0) { Elf_Internal_Rel rel; Elf32_External_Rel *loc; @@ -3109,11 +3347,13 @@ elf_i386_finish_dynamic_sections (output return true; } +#ifndef ELF_ARCH #define TARGET_LITTLE_SYM bfd_elf32_i386_vec #define TARGET_LITTLE_NAME "elf32-i386" #define ELF_ARCH bfd_arch_i386 #define ELF_MACHINE_CODE EM_386 #define ELF_MAXPAGESIZE 0x1000 +#endif /* ELF_ARCH */ #define elf_backend_can_gc_sections 1 #define elf_backend_can_refcount 1 @@ -3148,6 +3388,4 @@ elf_i386_finish_dynamic_sections (output #define elf_backend_relocate_section elf_i386_relocate_section #define elf_backend_size_dynamic_sections elf_i386_size_dynamic_sections -#ifndef ELF32_I386_C_INCLUDED #include "elf32-target.h" -#endif diff -Nurpa binutils-2.13/bfd/elf32-i386qnx.c binutils-2.13.1/bfd/elf32-i386qnx.c --- binutils-2.13/bfd/elf32-i386qnx.c 2002-06-02 21:57:09.000000000 -0400 +++ binutils-2.13.1/bfd/elf32-i386qnx.c 1969-12-31 19:00:00.000000000 -0500 @@ -1,111 +0,0 @@ -/* Intel 80386/80486 QNX specific support for 32-bit ELF - Copyright 2002 - Free Software Foundation, Inc. - -This file is part of BFD, the Binary File Descriptor library. - -This program is free software; you can redistribute it and/or modify -it under the terms of the GNU General Public License as published by -the Free Software Foundation; either version 2 of the License, or -(at your option) any later version. - -This program is distributed in the hope that it will be useful, -but WITHOUT ANY WARRANTY; without even the implied warranty of -MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the -GNU General Public License for more details. - -You should have received a copy of the GNU General Public License -along with this program; if not, write to the Free Software -Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. */ - -#define ELF32_I386_C_INCLUDED -#include "elf32-i386.c" - - /* Returns the end address of the segment + 1. */ -#define SEGMENT_END(segment, start) \ - (start + (segment->p_memsz > segment->p_filesz \ - ? segment->p_memsz : segment->p_filesz)) - -static boolean elf_i386qnx_copy_private_bfd_data_p - PARAMS ((bfd *, asection *, bfd *, asection *)); -static boolean elf_i386qnx_is_contained_by_filepos - PARAMS ((asection *, Elf_Internal_Phdr *)); -static void elf_i386qnx_set_nonloadable_filepos - PARAMS ((bfd *, Elf_Internal_Phdr *)); - -static boolean -elf_i386qnx_copy_private_bfd_data_p (ibfd, isec, obfd, osec) - bfd *ibfd; - asection *isec; - bfd *obfd; - asection *osec; -{ - /* We don't use these parameters, but another target might. */ - ibfd = ibfd; - obfd = obfd; - osec = osec; - return isec->next == NULL; -} - -static boolean -elf_i386qnx_is_contained_by_filepos (section, segment) - asection *section; - Elf_Internal_Phdr *segment; -{ - return ((bfd_vma) section->filepos >= segment->p_offset - && ((bfd_vma) section->filepos + section->_raw_size - <= SEGMENT_END (segment, segment->p_offset))); -} - -static void -elf_i386qnx_set_nonloadable_filepos (abfd, phdrs) - bfd *abfd; - Elf_Internal_Phdr *phdrs; -{ - struct elf_segment_map *m; - Elf_Internal_Phdr *p; - file_ptr off = 0; - - for (m = elf_tdata (abfd)->segment_map, p = phdrs; - m != NULL; - m = m->next, p++) - { - unsigned int i; - asection **secpp; - - for (i = 0, secpp = m->sections; i < m->count; i++, secpp++) - { - asection *sec; - - sec = *secpp; - - if (p->p_type == PT_LOAD) - off = sec->filepos; - else - { - if (i == 0) - { - if (sec->filepos) - p->p_offset = sec->filepos; - else - p->p_offset = off; - } - if (!sec->filepos) - { - off += sec->_raw_size; - p->p_filesz += sec->_raw_size; - } - } - } - } - return; -} - -#undef TARGET_LITTLE_SYM -#define TARGET_LITTLE_SYM bfd_elf32_i386qnx_vec - -#define elf_backend_set_nonloadable_filepos elf_i386qnx_set_nonloadable_filepos -#define elf_backend_is_contained_by_filepos elf_i386qnx_is_contained_by_filepos -#define elf_backend_copy_private_bfd_data_p elf_i386qnx_copy_private_bfd_data_p - -#include "elf32-target.h" diff -Nurpa binutils-2.13/bfd/elf32-m32r.c binutils-2.13.1/bfd/elf32-m32r.c --- binutils-2.13/bfd/elf32-m32r.c 2002-07-07 05:10:39.000000000 -0400 +++ binutils-2.13.1/bfd/elf32-m32r.c 2002-10-11 04:56:13.000000000 -0400 @@ -847,6 +847,7 @@ m32r_elf_add_symbol_hook (abfd, info, sy section already exists a new one is created that follows it which screws of _SDA_BASE_ address calcs because output_offset != 0. */ struct elf_link_hash_entry *h; + struct bfd_link_hash_entry *bh; asection *s = bfd_get_section_by_name (abfd, ".sdata"); /* The following code was cobbled from elf32-ppc.c and elflink.c. */ @@ -863,10 +864,10 @@ m32r_elf_add_symbol_hook (abfd, info, sy bfd_set_section_alignment (abfd, s, 2); } - h = (struct elf_link_hash_entry *) - bfd_link_hash_lookup (info->hash, "_SDA_BASE_", false, false, false); + bh = bfd_link_hash_lookup (info->hash, "_SDA_BASE_", + false, false, false); - if ((h == NULL || h->root.type == bfd_link_hash_undefined) + if ((bh == NULL || bh->type == bfd_link_hash_undefined) && !(_bfd_generic_link_add_one_symbol (info, abfd, "_SDA_BASE_", @@ -876,8 +877,9 @@ m32r_elf_add_symbol_hook (abfd, info, sy (const char *) NULL, false, get_elf_backend_data (abfd)->collect, - (struct bfd_link_hash_entry **) &h))) + &bh))) return false; + h = (struct elf_link_hash_entry *) bh; h->type = STT_OBJECT; } diff -Nurpa binutils-2.13/bfd/elf32-ppc.c binutils-2.13.1/bfd/elf32-ppc.c --- binutils-2.13/bfd/elf32-ppc.c 2002-07-01 04:06:44.000000000 -0400 +++ binutils-2.13.1/bfd/elf32-ppc.c 2002-09-23 18:12:40.000000000 -0400 @@ -2743,11 +2743,11 @@ ppc_elf_finish_dynamic_symbol (output_bf else { BFD_ASSERT ((h->got.offset & 1) == 0); - bfd_put_32 (output_bfd, (bfd_vma) 0, sgot->contents + h->got.offset); rela.r_info = ELF32_R_INFO (h->dynindx, R_PPC_GLOB_DAT); rela.r_addend = 0; } + bfd_put_32 (output_bfd, (bfd_vma) 0, sgot->contents + h->got.offset); bfd_elf32_swap_reloca_out (output_bfd, &rela, ((Elf32_External_Rela *) srela->contents + srela->reloc_count)); @@ -3287,13 +3287,19 @@ ppc_elf_relocate_section (output_bfd, in + sreloc->reloc_count)); ++sreloc->reloc_count; - /* This reloc will be computed at runtime, so there's no - need to do anything now, unless this is a RELATIVE - reloc in an unallocated section. */ - if (skip != -1 - || (input_section->flags & SEC_ALLOC) != 0 - || ELF32_R_TYPE (outrel.r_info) != R_PPC_RELATIVE) + if (skip == -1) continue; + + /* This reloc will be computed at runtime. We clear the memory + so that it contains predictable value. */ + if (! skip + && ((input_section->flags & SEC_ALLOC) != 0 + || ELF32_R_TYPE (outrel.r_info) != R_PPC_RELATIVE)) + { + relocation = howto->pc_relative ? outrel.r_offset : 0; + addend = 0; + break; + } } /* Arithmetic adjust relocations that aren't going into a @@ -3390,7 +3396,6 @@ ppc_elf_relocate_section (output_bfd, in off &= ~1; else { - bfd_put_32 (output_bfd, relocation, sgot->contents + off); if (info->shared) { @@ -3412,8 +3417,10 @@ ppc_elf_relocate_section (output_bfd, in srelgot->contents) + srelgot->reloc_count)); ++srelgot->reloc_count; + relocation = 0; } + bfd_put_32 (output_bfd, relocation, sgot->contents + off); local_got_offsets[r_symndx] |= 1; } diff -Nurpa binutils-2.13/bfd/elf32-s390.c binutils-2.13.1/bfd/elf32-s390.c --- binutils-2.13/bfd/elf32-s390.c 2002-07-11 01:33:28.000000000 -0400 +++ binutils-2.13.1/bfd/elf32-s390.c 2002-08-21 21:34:15.000000000 -0400 @@ -40,7 +40,8 @@ static boolean create_got_section static boolean elf_s390_create_dynamic_sections PARAMS((bfd *, struct bfd_link_info *)); static void elf_s390_copy_indirect_symbol - PARAMS ((struct elf_link_hash_entry *, struct elf_link_hash_entry *)); + PARAMS ((struct elf_backend_data *, struct elf_link_hash_entry *, + struct elf_link_hash_entry *)); static boolean elf_s390_check_relocs PARAMS ((bfd *, struct bfd_link_info *, asection *, const Elf_Internal_Rela *)); @@ -564,7 +565,8 @@ elf_s390_create_dynamic_sections (dynobj /* Copy the extra info we tack onto an elf_link_hash_entry. */ static void -elf_s390_copy_indirect_symbol (dir, ind) +elf_s390_copy_indirect_symbol (bed, dir, ind) + struct elf_backend_data *bed; struct elf_link_hash_entry *dir, *ind; { struct elf_s390_link_hash_entry *edir, *eind; @@ -606,7 +608,7 @@ elf_s390_copy_indirect_symbol (dir, ind) eind->dyn_relocs = NULL; } - _bfd_elf_link_hash_copy_indirect (dir, ind); + _bfd_elf_link_hash_copy_indirect (bed, dir, ind); } /* Look through the relocs for a section during the first phase, and diff -Nurpa binutils-2.13/bfd/elf32-sh.c binutils-2.13.1/bfd/elf32-sh.c --- binutils-2.13/bfd/elf32-sh.c 2002-07-07 05:10:39.000000000 -0400 +++ binutils-2.13.1/bfd/elf32-sh.c 2002-10-28 13:45:43.000000000 -0500 @@ -56,6 +56,9 @@ static boolean sh_elf_relocate_section static bfd_byte *sh_elf_get_relocated_section_contents PARAMS ((bfd *, struct bfd_link_info *, struct bfd_link_order *, bfd_byte *, boolean, asymbol **)); +static void sh_elf_copy_indirect_symbol + PARAMS ((struct elf_backend_data *, struct elf_link_hash_entry *, + struct elf_link_hash_entry *)); static boolean sh_elf_check_relocs PARAMS ((bfd *, struct bfd_link_info *, asection *, const Elf_Internal_Rela *)); @@ -75,6 +78,8 @@ static boolean sh_elf_finish_dynamic_sec static bfd_reloc_status_type sh_elf_reloc_loop PARAMS ((int, bfd *, asection *, bfd_byte *, bfd_vma, asection *, bfd_vma, bfd_vma)); +static boolean create_got_section + PARAMS((bfd *, struct bfd_link_info *)); static boolean sh_elf_create_dynamic_sections PARAMS ((bfd *, struct bfd_link_info *)); static asection * sh_elf_gc_mark_hook @@ -83,6 +88,10 @@ static asection * sh_elf_gc_mark_hook static boolean sh_elf_gc_sweep_hook PARAMS ((bfd *, struct bfd_link_info *, asection *, const Elf_Internal_Rela *)); +static boolean allocate_dynrelocs + PARAMS ((struct elf_link_hash_entry *, PTR)); +static boolean readonly_dynrelocs + PARAMS ((struct elf_link_hash_entry *, PTR)); static enum elf_reloc_type_class sh_elf_reloc_type_class PARAMS ((const Elf_Internal_Rela *)); #ifdef INCLUDE_SHMEDIA @@ -430,33 +439,33 @@ static reloc_howto_type sh_elf_howto_tab /* GNU extension to record C++ vtable hierarchy */ HOWTO (R_SH_GNU_VTINHERIT, /* type */ - 0, /* rightshift */ - 2, /* size (0 = byte, 1 = short, 2 = long) */ - 0, /* bitsize */ - false, /* pc_relative */ - 0, /* bitpos */ - complain_overflow_dont, /* complain_on_overflow */ - NULL, /* special_function */ - "R_SH_GNU_VTINHERIT", /* name */ - false, /* partial_inplace */ - 0, /* src_mask */ - 0, /* dst_mask */ - false), /* pcrel_offset */ + 0, /* rightshift */ + 2, /* size (0 = byte, 1 = short, 2 = long) */ + 0, /* bitsize */ + false, /* pc_relative */ + 0, /* bitpos */ + complain_overflow_dont, /* complain_on_overflow */ + NULL, /* special_function */ + "R_SH_GNU_VTINHERIT", /* name */ + false, /* partial_inplace */ + 0, /* src_mask */ + 0, /* dst_mask */ + false), /* pcrel_offset */ /* GNU extension to record C++ vtable member usage */ HOWTO (R_SH_GNU_VTENTRY, /* type */ - 0, /* rightshift */ - 2, /* size (0 = byte, 1 = short, 2 = long) */ - 0, /* bitsize */ - false, /* pc_relative */ - 0, /* bitpos */ - complain_overflow_dont, /* complain_on_overflow */ - _bfd_elf_rel_vtable_reloc_fn, /* special_function */ - "R_SH_GNU_VTENTRY", /* name */ - false, /* partial_inplace */ - 0, /* src_mask */ - 0, /* dst_mask */ - false), /* pcrel_offset */ + 0, /* rightshift */ + 2, /* size (0 = byte, 1 = short, 2 = long) */ + 0, /* bitsize */ + false, /* pc_relative */ + 0, /* bitpos */ + complain_overflow_dont, /* complain_on_overflow */ + _bfd_elf_rel_vtable_reloc_fn, /* special_function */ + "R_SH_GNU_VTENTRY", /* name */ + false, /* partial_inplace */ + 0, /* src_mask */ + 0, /* dst_mask */ + false), /* pcrel_offset */ /* 8 bit PC relative divided by 2 - but specified in a very odd way. */ HOWTO (R_SH_LOOP_START, /* type */ @@ -510,7 +519,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0xfc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in SHARI, SHLLI et al. */ HOWTO (R_SH_DIR6U, /* type */ @@ -525,7 +534,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0xfc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in BxxI, LDHI.L et al. */ HOWTO (R_SH_DIR6S, /* type */ @@ -540,7 +549,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0xfc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in ADDI, ANDI et al. */ HOWTO (R_SH_DIR10S, /* type */ @@ -555,9 +564,9 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0xffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ - /* Used in LD.UW, ST.W et al. */ + /* Used in LD.UW, ST.W et al. */ HOWTO (R_SH_DIR10SW, /* type */ 1, /* rightshift */ 2, /* size (0 = byte, 1 = short, 2 = long) */ @@ -570,9 +579,9 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0xffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ - /* Used in LD.L, FLD.S et al. */ + /* Used in LD.L, FLD.S et al. */ HOWTO (R_SH_DIR10SL, /* type */ 2, /* rightshift */ 2, /* size (0 = byte, 1 = short, 2 = long) */ @@ -585,7 +594,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0xffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in FLD.D, FST.P et al. */ HOWTO (R_SH_DIR10SQ, /* type */ @@ -600,7 +609,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0xffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ #else EMPTY_HOWTO (45), @@ -857,11 +866,11 @@ static reloc_howto_type sh_elf_howto_tab 10, /* bitpos */ complain_overflow_dont, /* complain_on_overflow */ bfd_elf_generic_reloc, /* special_function */ - "R_SH_GOT_LOW16", /* name */ + "R_SH_GOT_LOW16", /* name */ false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in MOVI and SHORI ((x >> 16) & 65536). */ HOWTO (R_SH_GOT_MEDLOW16, /* type */ @@ -876,7 +885,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in MOVI and SHORI ((x >> 32) & 65536). */ HOWTO (R_SH_GOT_MEDHI16, /* type */ @@ -891,7 +900,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in MOVI and SHORI ((x >> 48) & 65536). */ HOWTO (R_SH_GOT_HI16, /* type */ @@ -906,7 +915,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in MOVI and SHORI (x & 65536). */ HOWTO (R_SH_GOTPLT_LOW16, /* type */ @@ -917,11 +926,11 @@ static reloc_howto_type sh_elf_howto_tab 10, /* bitpos */ complain_overflow_dont, /* complain_on_overflow */ bfd_elf_generic_reloc, /* special_function */ - "R_SH_GOTPLT_LOW16", /* name */ + "R_SH_GOTPLT_LOW16", /* name */ false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in MOVI and SHORI ((x >> 16) & 65536). */ HOWTO (R_SH_GOTPLT_MEDLOW16, /* type */ @@ -936,7 +945,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in MOVI and SHORI ((x >> 32) & 65536). */ HOWTO (R_SH_GOTPLT_MEDHI16, /* type */ @@ -951,7 +960,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in MOVI and SHORI ((x >> 48) & 65536). */ HOWTO (R_SH_GOTPLT_HI16, /* type */ @@ -966,7 +975,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in MOVI and SHORI (x & 65536). */ HOWTO (R_SH_PLT_LOW16, /* type */ @@ -977,11 +986,11 @@ static reloc_howto_type sh_elf_howto_tab 10, /* bitpos */ complain_overflow_dont, /* complain_on_overflow */ bfd_elf_generic_reloc, /* special_function */ - "R_SH_PLT_LOW16", /* name */ + "R_SH_PLT_LOW16", /* name */ false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - true), /* pcrel_offset */ + true), /* pcrel_offset */ /* Used in MOVI and SHORI ((x >> 16) & 65536). */ HOWTO (R_SH_PLT_MEDLOW16, /* type */ @@ -996,7 +1005,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - true), /* pcrel_offset */ + true), /* pcrel_offset */ /* Used in MOVI and SHORI ((x >> 32) & 65536). */ HOWTO (R_SH_PLT_MEDHI16, /* type */ @@ -1011,7 +1020,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - true), /* pcrel_offset */ + true), /* pcrel_offset */ /* Used in MOVI and SHORI ((x >> 48) & 65536). */ HOWTO (R_SH_PLT_HI16, /* type */ @@ -1026,7 +1035,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - true), /* pcrel_offset */ + true), /* pcrel_offset */ /* Used in MOVI and SHORI (x & 65536). */ HOWTO (R_SH_GOTOFF_LOW16, /* type */ @@ -1037,11 +1046,11 @@ static reloc_howto_type sh_elf_howto_tab 10, /* bitpos */ complain_overflow_dont, /* complain_on_overflow */ bfd_elf_generic_reloc, /* special_function */ - "R_SH_GOTOFF_LOW16", /* name */ + "R_SH_GOTOFF_LOW16", /* name */ false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in MOVI and SHORI ((x >> 16) & 65536). */ HOWTO (R_SH_GOTOFF_MEDLOW16, /* type */ @@ -1056,7 +1065,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in MOVI and SHORI ((x >> 32) & 65536). */ HOWTO (R_SH_GOTOFF_MEDHI16, /* type */ @@ -1071,7 +1080,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in MOVI and SHORI ((x >> 48) & 65536). */ HOWTO (R_SH_GOTOFF_HI16, /* type */ @@ -1086,7 +1095,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in MOVI and SHORI (x & 65536). */ HOWTO (R_SH_GOTPC_LOW16, /* type */ @@ -1097,11 +1106,11 @@ static reloc_howto_type sh_elf_howto_tab 10, /* bitpos */ complain_overflow_dont, /* complain_on_overflow */ bfd_elf_generic_reloc, /* special_function */ - "R_SH_GOTPC_LOW16", /* name */ + "R_SH_GOTPC_LOW16", /* name */ false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - true), /* pcrel_offset */ + true), /* pcrel_offset */ /* Used in MOVI and SHORI ((x >> 16) & 65536). */ HOWTO (R_SH_GOTPC_MEDLOW16, /* type */ @@ -1116,7 +1125,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - true), /* pcrel_offset */ + true), /* pcrel_offset */ /* Used in MOVI and SHORI ((x >> 32) & 65536). */ HOWTO (R_SH_GOTPC_MEDHI16, /* type */ @@ -1131,7 +1140,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - true), /* pcrel_offset */ + true), /* pcrel_offset */ /* Used in MOVI and SHORI ((x >> 48) & 65536). */ HOWTO (R_SH_GOTPC_HI16, /* type */ @@ -1146,9 +1155,9 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - true), /* pcrel_offset */ + true), /* pcrel_offset */ - /* Used in LD.L, FLD.S et al. */ + /* Used in LD.L, FLD.S et al. */ HOWTO (R_SH_GOT10BY4, /* type */ 2, /* rightshift */ 2, /* size (0 = byte, 1 = short, 2 = long) */ @@ -1161,9 +1170,9 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0xffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ - /* Used in LD.L, FLD.S et al. */ + /* Used in LD.L, FLD.S et al. */ HOWTO (R_SH_GOTPLT10BY4, /* type */ 2, /* rightshift */ 2, /* size (0 = byte, 1 = short, 2 = long) */ @@ -1176,7 +1185,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0xffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in FLD.D, FST.P et al. */ HOWTO (R_SH_GOT10BY8, /* type */ @@ -1191,7 +1200,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0xffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in FLD.D, FST.P et al. */ HOWTO (R_SH_GOTPLT10BY8, /* type */ @@ -1206,7 +1215,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0xffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ HOWTO (R_SH_COPY64, /* type */ 0, /* rightshift */ @@ -1216,11 +1225,11 @@ static reloc_howto_type sh_elf_howto_tab 0, /* bitpos */ complain_overflow_dont, /* complain_on_overflow */ bfd_elf_generic_reloc, /* special_function */ - "R_SH_COPY64", /* name */ + "R_SH_COPY64", /* name */ false, /* partial_inplace */ 0, /* src_mask */ ((bfd_vma) 0) - 1, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ HOWTO (R_SH_GLOB_DAT64, /* type */ 0, /* rightshift */ @@ -1230,11 +1239,11 @@ static reloc_howto_type sh_elf_howto_tab 0, /* bitpos */ complain_overflow_dont, /* complain_on_overflow */ bfd_elf_generic_reloc, /* special_function */ - "R_SH_GLOB_DAT64", /* name */ + "R_SH_GLOB_DAT64", /* name */ false, /* partial_inplace */ 0, /* src_mask */ ((bfd_vma) 0) - 1, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ HOWTO (R_SH_JMP_SLOT64, /* type */ 0, /* rightshift */ @@ -1244,11 +1253,11 @@ static reloc_howto_type sh_elf_howto_tab 0, /* bitpos */ complain_overflow_dont, /* complain_on_overflow */ bfd_elf_generic_reloc, /* special_function */ - "R_SH_JMP_SLOT64", /* name */ + "R_SH_JMP_SLOT64", /* name */ false, /* partial_inplace */ 0, /* src_mask */ ((bfd_vma) 0) - 1, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ HOWTO (R_SH_RELATIVE64, /* type */ 0, /* rightshift */ @@ -1258,11 +1267,11 @@ static reloc_howto_type sh_elf_howto_tab 0, /* bitpos */ complain_overflow_dont, /* complain_on_overflow */ bfd_elf_generic_reloc, /* special_function */ - "R_SH_RELATIVE64", /* name */ + "R_SH_RELATIVE64", /* name */ false, /* partial_inplace */ 0, /* src_mask */ ((bfd_vma) 0) - 1, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ EMPTY_HOWTO (197), EMPTY_HOWTO (198), @@ -1363,7 +1372,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in SHORI. */ HOWTO (R_SH_IMMU16, /* type */ @@ -1378,7 +1387,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in MOVI and SHORI (x & 65536). */ HOWTO (R_SH_IMM_LOW16, /* type */ @@ -1389,11 +1398,11 @@ static reloc_howto_type sh_elf_howto_tab 10, /* bitpos */ complain_overflow_dont, /* complain_on_overflow */ bfd_elf_generic_reloc, /* special_function */ - "R_SH_IMM_LOW16", /* name */ + "R_SH_IMM_LOW16", /* name */ false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in MOVI and SHORI ((x - $) & 65536). */ HOWTO (R_SH_IMM_LOW16_PCREL, /* type */ @@ -1423,7 +1432,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in MOVI and SHORI (((x - $) >> 16) & 65536). */ HOWTO (R_SH_IMM_MEDLOW16_PCREL, /* type */ @@ -1453,7 +1462,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in MOVI and SHORI (((x - $) >> 32) & 65536). */ HOWTO (R_SH_IMM_MEDHI16_PCREL, /* type */ @@ -1483,7 +1492,7 @@ static reloc_howto_type sh_elf_howto_tab false, /* partial_inplace */ 0, /* src_mask */ 0x3fffc00, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* Used in MOVI and SHORI (((x - $) >> 48) & 65536). */ HOWTO (R_SH_IMM_HI16_PCREL, /* type */ @@ -1509,11 +1518,11 @@ static reloc_howto_type sh_elf_howto_tab 0, /* bitpos */ complain_overflow_dont, /* complain_on_overflow */ bfd_elf_generic_reloc, /* special_function */ - "R_SH_64", /* name */ + "R_SH_64", /* name */ false, /* partial_inplace */ 0, /* src_mask */ ((bfd_vma) 0) - 1, /* dst_mask */ - false), /* pcrel_offset */ + false), /* pcrel_offset */ /* For the .uaquad pseudo, (x - $). */ HOWTO (R_SH_64_PCREL, /* type */ @@ -1955,9 +1964,9 @@ sh_elf_relax_section (abfd, sec, link_in } /* The r_addend field of the R_SH_USES reloc will point us to - the register load. The 4 is because the r_addend field is - computed as though it were a jump offset, which are based - from 4 bytes after the jump instruction. */ + the register load. The 4 is because the r_addend field is + computed as though it were a jump offset, which are based + from 4 bytes after the jump instruction. */ laddr = irel->r_offset + 4 + irel->r_addend; if (laddr >= sec->_raw_size) { @@ -1969,7 +1978,7 @@ sh_elf_relax_section (abfd, sec, link_in insn = bfd_get_16 (abfd, contents + laddr); /* If the instruction is not mov.l NN,rN, we don't know what to - do. */ + do. */ if ((insn & 0xf000) != 0xd000) { ((*_bfd_error_handler) @@ -1996,8 +2005,8 @@ sh_elf_relax_section (abfd, sec, link_in } /* Get the reloc for the address from which the register is - being loaded. This reloc will tell us which function is - actually being called. */ + being loaded. This reloc will tell us which function is + actually being called. */ for (irelfn = internal_relocs; irelfn < irelend; irelfn++) if (irelfn->r_offset == paddr && ELF32_R_TYPE (irelfn->r_info) == (int) R_SH_DIR32) @@ -2054,8 +2063,8 @@ sh_elf_relax_section (abfd, sec, link_in && h->root.type != bfd_link_hash_defweak) { /* This appears to be a reference to an undefined - symbol. Just ignore it--it will be caught by the - regular reloc processing. */ + symbol. Just ignore it--it will be caught by the + regular reloc processing. */ continue; } @@ -2095,13 +2104,13 @@ sh_elf_relax_section (abfd, sec, link_in /* Replace the jsr with a bsr. */ /* Change the R_SH_USES reloc into an R_SH_IND12W reloc, and - replace the jsr with a bsr. */ + replace the jsr with a bsr. */ irel->r_info = ELF32_R_INFO (ELF32_R_SYM (irelfn->r_info), R_SH_IND12W); if (ELF32_R_SYM (irelfn->r_info) < symtab_hdr->sh_info) { /* If this needs to be changed because of future relaxing, - it will be handled here like other internal IND12W - relocs. */ + it will be handled here like other internal IND12W + relocs. */ bfd_put_16 (abfd, (bfd_vma) 0xb000 | ((foff >> 1) & 0xfff), contents + irel->r_offset); @@ -2109,13 +2118,13 @@ sh_elf_relax_section (abfd, sec, link_in else { /* We can't fully resolve this yet, because the external - symbol value may be changed by future relaxing. We let - the final link phase handle it. */ + symbol value may be changed by future relaxing. We let + the final link phase handle it. */ bfd_put_16 (abfd, (bfd_vma) 0xb000, contents + irel->r_offset); } /* See if there is another R_SH_USES reloc referring to the same - register load. */ + register load. */ for (irelscan = internal_relocs; irelscan < irelend; irelscan++) if (ELF32_R_TYPE (irelscan->r_info) == (int) R_SH_USES && laddr == irelscan->r_offset + 4 + irelscan->r_addend) @@ -2130,8 +2139,8 @@ sh_elf_relax_section (abfd, sec, link_in } /* Look for a R_SH_COUNT reloc on the location where the - function address is stored. Do this before deleting any - bytes, to avoid confusion about the address. */ + function address is stored. Do this before deleting any + bytes, to avoid confusion about the address. */ for (irelcount = internal_relocs; irelcount < irelend; irelcount++) if (irelcount->r_offset == paddr && ELF32_R_TYPE (irelcount->r_info) == (int) R_SH_COUNT) @@ -2142,8 +2151,8 @@ sh_elf_relax_section (abfd, sec, link_in goto error_return; /* That will change things, so, just in case it permits some - other function call to come within range, we should relax - again. Note that this is not required, and it may be slow. */ + other function call to come within range, we should relax + again. Note that this is not required, and it may be slow. */ *again = true; /* Now check whether we got a COUNT reloc. */ @@ -2156,7 +2165,7 @@ sh_elf_relax_section (abfd, sec, link_in } /* The number of uses is stored in the r_addend field. We've - just deleted one. */ + just deleted one. */ if (irelcount->r_addend == 0) { ((*_bfd_error_handler) (_("%s: 0x%lx: warning: bad count"), @@ -2168,8 +2177,8 @@ sh_elf_relax_section (abfd, sec, link_in --irelcount->r_addend; /* If there are no more uses, we can delete the address. Reload - the address from irelfn, in case it was changed by the - previous call to sh_elf_relax_delete_bytes. */ + the address from irelfn, in case it was changed by the + previous call to sh_elf_relax_delete_bytes. */ if (irelcount->r_addend == 0) { if (! sh_elf_relax_delete_bytes (abfd, sec, irelfn->r_offset, 4)) @@ -2355,7 +2364,7 @@ sh_elf_relax_delete_bytes (abfd, sec, ad (int) R_SH_NONE); /* If this is a PC relative reloc, see if the range it covers - includes the bytes we have deleted. */ + includes the bytes we have deleted. */ switch ((enum elf_sh_reloc_type) ELF32_R_TYPE (irel->r_info)) { default: @@ -2378,9 +2387,9 @@ sh_elf_relax_delete_bytes (abfd, sec, ad case R_SH_DIR32: /* If this reloc is against a symbol defined in this - section, and the symbol will not be adjusted below, we - must check the addend to see it will put the value in - range to be adjusted, and hence must be changed. */ + section, and the symbol will not be adjusted below, we + must check the addend to see it will put the value in + range to be adjusted, and hence must be changed. */ if (ELF32_R_SYM (irel->r_info) < symtab_hdr->sh_info) { isym = isymbuf + ELF32_R_SYM (irel->r_info); @@ -2572,8 +2581,8 @@ sh_elf_relax_delete_bytes (abfd, sec, ad continue; /* We always cache the relocs. Perhaps, if info->keep_memory is - false, we should free them, if we are permitted to, when we - leave sh_coff_relax_section. */ + false, we should free them, if we are permitted to, when we + leave sh_coff_relax_section. */ internal_relocs = (_bfd_elf32_link_read_relocs (abfd, o, (PTR) NULL, (Elf_Internal_Rela *) NULL, true)); @@ -2597,9 +2606,9 @@ sh_elf_relax_delete_bytes (abfd, sec, ad else { /* We always cache the section contents. - Perhaps, if info->keep_memory is false, we - should free them, if we are permitted to, - when we leave sh_coff_relax_section. */ + Perhaps, if info->keep_memory is false, we + should free them, if we are permitted to, + when we leave sh_coff_relax_section. */ ocontents = (bfd_byte *) bfd_malloc (o->_raw_size); if (ocontents == NULL) return false; @@ -2655,9 +2664,9 @@ sh_elf_relax_delete_bytes (abfd, sec, ad else { /* We always cache the section contents. - Perhaps, if info->keep_memory is false, we - should free them, if we are permitted to, - when we leave sh_coff_relax_section. */ + Perhaps, if info->keep_memory is false, we + should free them, if we are permitted to, + when we leave sh_coff_relax_section. */ ocontents = (bfd_byte *) bfd_malloc (o->_raw_size); if (ocontents == NULL) return false; @@ -2829,8 +2838,8 @@ sh_elf_swap_insns (abfd, sec, relocs, co int add; /* There are a few special types of relocs that we don't want to - adjust. These relocs do not apply to the instruction itself, - but are only associated with the address. */ + adjust. These relocs do not apply to the instruction itself, + but are only associated with the address. */ type = (enum elf_sh_reloc_type) ELF32_R_TYPE (irel->r_info); if (type == R_SH_ALIGN || type == R_SH_CODE @@ -2839,11 +2848,11 @@ sh_elf_swap_insns (abfd, sec, relocs, co continue; /* If an R_SH_USES reloc points to one of the addresses being - swapped, we must adjust it. It would be incorrect to do this - for a jump, though, since we want to execute both - instructions after the jump. (We have avoided swapping - around a label, so the jump will not wind up executing an - instruction it shouldn't). */ + swapped, we must adjust it. It would be incorrect to do this + for a jump, though, since we want to execute both + instructions after the jump. (We have avoided swapping + around a label, so the jump will not wind up executing an + instruction it shouldn't). */ if (type == R_SH_USES) { bfd_vma off; @@ -2902,11 +2911,11 @@ sh_elf_swap_insns (abfd, sec, relocs, co case R_SH_DIR8WPL: /* This reloc ignores the least significant 3 bits of - the program counter before adding in the offset. - This means that if ADDR is at an even address, the - swap will not affect the offset. If ADDR is an at an - odd address, then the instruction will be crossing a - four byte boundary, and must be adjusted. */ + the program counter before adding in the offset. + This means that if ADDR is at an even address, the + swap will not affect the offset. If ADDR is an at an + odd address, then the instruction will be crossing a + four byte boundary, and must be adjusted. */ if ((addr & 3) != 0) { insn = bfd_get_16 (abfd, loc); @@ -3348,22 +3357,23 @@ static const bfd_byte *elf_sh_pic_plt_en #endif /* The sh linker needs to keep track of the number of relocs that it - decides to copy in check_relocs for each symbol. This is so that - it can discard PC relative relocs if it doesn't need them when - linking with -Bsymbolic. We store the information in a field - extending the regular ELF linker hash table. */ - -/* This structure keeps track of the number of PC relative relocs we - have copied for a given symbol. */ - -struct elf_sh_pcrel_relocs_copied -{ - /* Next section. */ - struct elf_sh_pcrel_relocs_copied *next; - /* A section in dynobj. */ - asection *section; - /* Number of relocs copied in this section. */ + decides to copy as dynamic relocs in check_relocs for each symbol. + This is so that it can later discard them if they are found to be + unnecessary. We store the information in a field extending the + regular ELF linker hash table. */ + +struct elf_sh_dyn_relocs +{ + struct elf_sh_dyn_relocs *next; + + /* The input section of the reloc. */ + asection *sec; + + /* Total number of relocs copied for the input section. */ bfd_size_type count; + + /* Number of pc-relative relocs copied for the input section. */ + bfd_size_type pc_count; }; /* sh ELF linker hash entry. */ @@ -3376,8 +3386,10 @@ struct elf_sh_link_hash_entry bfd_vma datalabel_got_offset; #endif - /* Number of PC relative relocs copied for this symbol. */ - struct elf_sh_pcrel_relocs_copied *pcrel_relocs_copied; + /* Track dynamic relocs copied for this symbol. */ + struct elf_sh_dyn_relocs *dyn_relocs; + + bfd_signed_vma gotplt_refcount; }; /* sh ELF linker hash table. */ @@ -3385,12 +3397,19 @@ struct elf_sh_link_hash_entry struct elf_sh_link_hash_table { struct elf_link_hash_table root; -}; -/* Declare this now that the above structures are defined. */ + /* Short-cuts to get to dynamic linker sections. */ + asection *sgot; + asection *sgotplt; + asection *srelgot; + asection *splt; + asection *srelplt; + asection *sdynbss; + asection *srelbss; -static boolean sh_elf_discard_copies - PARAMS ((struct elf_sh_link_hash_entry *, PTR)); + /* Small local sym to section mapping cache. */ + struct sym_sec_cache sym_sec; +}; /* Traverse an sh ELF linker hash table. */ @@ -3431,7 +3450,11 @@ sh_elf_link_hash_newfunc (entry, table, table, string)); if (ret != (struct elf_sh_link_hash_entry *) NULL) { - ret->pcrel_relocs_copied = NULL; + struct elf_sh_link_hash_entry *eh; + + eh = (struct elf_sh_link_hash_entry *) ret; + eh->dyn_relocs = NULL; + eh->gotplt_refcount = 0; #ifdef INCLUDE_SHMEDIA ret->datalabel_got_offset = (bfd_vma) -1; #endif @@ -3460,9 +3483,51 @@ sh_elf_link_hash_table_create (abfd) return NULL; } + ret->sgot = NULL; + ret->sgotplt = NULL; + ret->srelgot = NULL; + ret->splt = NULL; + ret->srelplt = NULL; + ret->sdynbss = NULL; + ret->srelbss = NULL; + ret->sym_sec.abfd = NULL; + return &ret->root.root; } +/* Create .got, .gotplt, and .rela.got sections in DYNOBJ, and set up + shortcuts to them in our hash table. */ + +static boolean +create_got_section (dynobj, info) + bfd *dynobj; + struct bfd_link_info *info; +{ + struct elf_sh_link_hash_table *htab; + + if (! _bfd_elf_create_got_section (dynobj, info)) + return false; + + htab = sh_elf_hash_table (info); + htab->sgot = bfd_get_section_by_name (dynobj, ".got"); + htab->sgotplt = bfd_get_section_by_name (dynobj, ".got.plt"); + if (! htab->sgot || ! htab->sgotplt) + abort (); + + htab->srelgot = bfd_make_section (dynobj, ".rela.got"); + if (htab->srelgot == NULL + || ! bfd_set_section_flags (dynobj, htab->srelgot, + (SEC_ALLOC + | SEC_LOAD + | SEC_HAS_CONTENTS + | SEC_IN_MEMORY + | SEC_LINKER_CREATED + | SEC_READONLY)) + || ! bfd_set_section_alignment (dynobj, htab->srelgot, 2)) + return false; + return true; +} + /* Create dynamic sections when linking against a dynamic object. */ static boolean @@ -3470,6 +3535,7 @@ sh_elf_create_dynamic_sections (abfd, in bfd *abfd; struct bfd_link_info *info; { + struct elf_sh_link_hash_table *htab; flagword flags, pltflags; register asection *s; struct elf_backend_data *bed = get_elf_backend_data (abfd); @@ -3490,6 +3556,8 @@ sh_elf_create_dynamic_sections (abfd, in return false; } + htab = sh_elf_hash_table (info); + /* We need to create .plt, .rel[a].plt, .got, .got.plt, .dynbss, and .rel[a].bss sections. */ @@ -3504,6 +3572,7 @@ sh_elf_create_dynamic_sections (abfd, in pltflags |= SEC_READONLY; s = bfd_make_section (abfd, ".plt"); + htab->splt = s; if (s == NULL || ! bfd_set_section_flags (abfd, s, pltflags) || ! bfd_set_section_alignment (abfd, s, bed->plt_alignment)) @@ -3513,13 +3582,16 @@ sh_elf_create_dynamic_sections (abfd, in { /* Define the symbol _PROCEDURE_LINKAGE_TABLE_ at the start of the .plt section. */ - struct elf_link_hash_entry *h = NULL; + struct elf_link_hash_entry *h; + struct bfd_link_hash_entry *bh = NULL; + if (! (_bfd_generic_link_add_one_symbol (info, abfd, "_PROCEDURE_LINKAGE_TABLE_", BSF_GLOBAL, s, (bfd_vma) 0, (const char *) NULL, false, - get_elf_backend_data (abfd)->collect, - (struct bfd_link_hash_entry **) &h))) + get_elf_backend_data (abfd)->collect, &bh))) return false; + + h = (struct elf_link_hash_entry *) bh; h->elf_link_hash_flags |= ELF_LINK_HASH_DEF_REGULAR; h->type = STT_OBJECT; @@ -3530,12 +3602,13 @@ sh_elf_create_dynamic_sections (abfd, in s = bfd_make_section (abfd, bed->default_use_rela_p ? ".rela.plt" : ".rel.plt"); + htab->srelplt = s; if (s == NULL || ! bfd_set_section_flags (abfd, s, flags | SEC_READONLY) || ! bfd_set_section_alignment (abfd, s, ptralign)) return false; - if (! _bfd_elf_create_got_section (abfd, info)) + if (! create_got_section (abfd, info)) return false; { @@ -3571,6 +3644,7 @@ sh_elf_create_dynamic_sections (abfd, in initialize them at run time. The linker script puts the .dynbss section into the .bss section of the final image. */ s = bfd_make_section (abfd, ".dynbss"); + htab->sdynbss = s; if (s == NULL || ! bfd_set_section_flags (abfd, s, SEC_ALLOC)) return false; @@ -3591,6 +3665,7 @@ sh_elf_create_dynamic_sections (abfd, in s = bfd_make_section (abfd, (bed->default_use_rela_p ? ".rela.bss" : ".rel.bss")); + htab->srelbss = s; if (s == NULL || ! bfd_set_section_flags (abfd, s, flags | SEC_READONLY) || ! bfd_set_section_alignment (abfd, s, ptralign)) @@ -3612,6 +3687,9 @@ sh_elf_adjust_dynamic_symbol (info, h) struct bfd_link_info *info; struct elf_link_hash_entry *h; { + struct elf_sh_link_hash_table *htab; + struct elf_sh_link_hash_entry *eh; + struct elf_sh_dyn_relocs *p; bfd *dynobj; asection *s; unsigned int power_of_two; @@ -3635,66 +3713,26 @@ sh_elf_adjust_dynamic_symbol (info, h) if (h->type == STT_FUNC || (h->elf_link_hash_flags & ELF_LINK_HASH_NEEDS_PLT) != 0) { - if (! info->shared - && (h->elf_link_hash_flags & ELF_LINK_HASH_DEF_DYNAMIC) == 0 - && (h->elf_link_hash_flags & ELF_LINK_HASH_REF_DYNAMIC) == 0) + if (h->plt.refcount <= 0 + || (! info->shared + && (h->elf_link_hash_flags & ELF_LINK_HASH_DEF_DYNAMIC) == 0 + && (h->elf_link_hash_flags & ELF_LINK_HASH_REF_DYNAMIC) == 0 + && h->root.type != bfd_link_hash_undefweak + && h->root.type != bfd_link_hash_undefined)) { /* This case can occur if we saw a PLT reloc in an input file, but the symbol was never referred to by a dynamic object. In such a case, we don't actually need to build a procedure linkage table, and we can just do a REL32 reloc instead. */ - BFD_ASSERT ((h->elf_link_hash_flags & ELF_LINK_HASH_NEEDS_PLT) != 0); - return true; + h->plt.offset = (bfd_vma) -1; + h->elf_link_hash_flags &= ~ELF_LINK_HASH_NEEDS_PLT; } - /* Make sure this symbol is output as a dynamic symbol. */ - if (h->dynindx == -1) - { - if (! bfd_elf32_link_record_dynamic_symbol (info, h)) - return false; - } - - s = bfd_get_section_by_name (dynobj, ".plt"); - BFD_ASSERT (s != NULL); - - /* If this is the first .plt entry, make room for the special - first entry. */ - if (s->_raw_size == 0) - s->_raw_size += PLT_ENTRY_SIZE; - - /* If this symbol is not defined in a regular file, and we are - not generating a shared library, then set the symbol to this - location in the .plt. This is required to make function - pointers compare as equal between the normal executable and - the shared library. */ - if (! info->shared - && (h->elf_link_hash_flags & ELF_LINK_HASH_DEF_REGULAR) == 0) - { - h->root.u.def.section = s; - h->root.u.def.value = s->_raw_size; - } - - h->plt.offset = s->_raw_size; - - /* Make room for this entry. */ - s->_raw_size += elf_sh_sizeof_plt (info); - - /* We also need to make an entry in the .got.plt section, which - will be placed in the .got section by the linker script. */ - - s = bfd_get_section_by_name (dynobj, ".got.plt"); - BFD_ASSERT (s != NULL); - s->_raw_size += 4; - - /* We also need to make an entry in the .rela.plt section. */ - - s = bfd_get_section_by_name (dynobj, ".rela.plt"); - BFD_ASSERT (s != NULL); - s->_raw_size += sizeof (Elf32_External_Rela); - return true; } + else + h->plt.offset = (bfd_vma) -1; /* If this is a weak symbol, and there is a real definition, the processor independent code will have arranged for us to see the @@ -3723,6 +3761,30 @@ sh_elf_adjust_dynamic_symbol (info, h) if ((h->elf_link_hash_flags & ELF_LINK_NON_GOT_REF) == 0) return true; + /* If -z nocopyreloc was given, we won't generate them either. */ + if (info->nocopyreloc) + { + h->elf_link_hash_flags &= ~ELF_LINK_NON_GOT_REF; + return true; + } + + eh = (struct elf_sh_link_hash_entry *) h; + for (p = eh->dyn_relocs; p != NULL; p = p->next) + { + s = p->sec->output_section; + if (s != NULL && (s->flags & (SEC_READONLY | SEC_HAS_CONTENTS)) != 0) + break; + } + + /* If we didn't find any dynamic relocs in sections which needs the + copy reloc, then we'll be keeping the dynamic relocs and avoiding + the copy reloc. */ + if (p == NULL) + { + h->elf_link_hash_flags &= ~ELF_LINK_NON_GOT_REF; + return true; + } + /* We must allocate the symbol in our .dynbss section, which will become part of the .bss section of the executable. There will be an entry for this symbol in the .dynsym section. The dynamic @@ -3733,7 +3795,8 @@ sh_elf_adjust_dynamic_symbol (info, h) both the dynamic object and the regular object will refer to the same memory location for the variable. */ - s = bfd_get_section_by_name (dynobj, ".dynbss"); + htab = sh_elf_hash_table (info); + s = htab->sdynbss; BFD_ASSERT (s != NULL); /* We must generate a R_SH_COPY reloc to tell the dynamic linker to @@ -3744,7 +3807,7 @@ sh_elf_adjust_dynamic_symbol (info, h) { asection *srel; - srel = bfd_get_section_by_name (dynobj, ".rela.bss"); + srel = htab->srelbss; BFD_ASSERT (srel != NULL); srel->_raw_size += sizeof (Elf32_External_Rela); h->elf_link_hash_flags |= ELF_LINK_HASH_NEEDS_COPY; @@ -3757,8 +3820,7 @@ sh_elf_adjust_dynamic_symbol (info, h) power_of_two = 3; /* Apply the required alignment. */ - s->_raw_size = BFD_ALIGN (s->_raw_size, - (bfd_size_type) (1 << power_of_two)); + s->_raw_size = BFD_ALIGN (s->_raw_size, (bfd_size_type) (1 << power_of_two)); if (power_of_two > bfd_get_section_alignment (dynobj, s)) { if (! bfd_set_section_alignment (dynobj, s, power_of_two)) @@ -3775,6 +3837,250 @@ sh_elf_adjust_dynamic_symbol (info, h) return true; } +/* This is the condition under which sh_elf_finish_dynamic_symbol + will be called from elflink.h. If elflink.h doesn't call our + finish_dynamic_symbol routine, we'll need to do something about + initializing any .plt and .got entries in sh_elf_relocate_section. */ +#define WILL_CALL_FINISH_DYNAMIC_SYMBOL(DYN, INFO, H) \ + ((DYN) \ + && ((INFO)->shared \ + || ((H)->elf_link_hash_flags & ELF_LINK_FORCED_LOCAL) == 0) \ + && ((H)->dynindx != -1 \ + || ((H)->elf_link_hash_flags & ELF_LINK_FORCED_LOCAL) != 0)) + +/* Allocate space in .plt, .got and associated reloc sections for + dynamic relocs. */ + +static boolean +allocate_dynrelocs (h, inf) + struct elf_link_hash_entry *h; + PTR inf; +{ + struct bfd_link_info *info; + struct elf_sh_link_hash_table *htab; + struct elf_sh_link_hash_entry *eh; + struct elf_sh_dyn_relocs *p; + + if (h->root.type == bfd_link_hash_indirect) + return true; + + if (h->root.type == bfd_link_hash_warning) + /* When warning symbols are created, they **replace** the "real" + entry in the hash table, thus we never get to see the real + symbol in a hash traversal. So look at it now. */ + h = (struct elf_link_hash_entry *) h->root.u.i.link; + + info = (struct bfd_link_info *) inf; + htab = sh_elf_hash_table (info); + + eh = (struct elf_sh_link_hash_entry *) h; + if ((h->got.refcount > 0 + || (h->elf_link_hash_flags & ELF_LINK_FORCED_LOCAL)) + && eh->gotplt_refcount > 0) + { + /* The symbol has been forced local, or we have some direct got refs, + so treat all the gotplt refs as got refs. */ + h->got.refcount += eh->gotplt_refcount; + if (h->plt.refcount >= eh->gotplt_refcount) + h->plt.refcount -= eh->gotplt_refcount; + } + + if (htab->root.dynamic_sections_created + && h->plt.refcount > 0) + { + /* Make sure this symbol is output as a dynamic symbol. + Undefined weak syms won't yet be marked as dynamic. */ + if (h->dynindx == -1 + && (h->elf_link_hash_flags & ELF_LINK_FORCED_LOCAL) == 0) + { + if (! bfd_elf32_link_record_dynamic_symbol (info, h)) + return false; + } + + if (WILL_CALL_FINISH_DYNAMIC_SYMBOL (1, info, h)) + { + asection *s = htab->splt; + + /* If this is the first .plt entry, make room for the special + first entry. */ + if (s->_raw_size == 0) + s->_raw_size += PLT_ENTRY_SIZE; + + h->plt.offset = s->_raw_size; + + /* If this symbol is not defined in a regular file, and we are + not generating a shared library, then set the symbol to this + location in the .plt. This is required to make function + pointers compare as equal between the normal executable and + the shared library. */ + if (! info->shared + && (h->elf_link_hash_flags & ELF_LINK_HASH_DEF_REGULAR) == 0) + { + h->root.u.def.section = s; + h->root.u.def.value = h->plt.offset; + } + + /* Make room for this entry. */ + s->_raw_size += PLT_ENTRY_SIZE; + + /* We also need to make an entry in the .got.plt section, which + will be placed in the .got section by the linker script. */ + htab->sgotplt->_raw_size += 4; + + /* We also need to make an entry in the .rel.plt section. */ + htab->srelplt->_raw_size += sizeof (Elf32_External_Rela); + } + else + { + h->plt.offset = (bfd_vma) -1; + h->elf_link_hash_flags &= ~ELF_LINK_HASH_NEEDS_PLT; + } + } + else + { + h->plt.offset = (bfd_vma) -1; + h->elf_link_hash_flags &= ~ELF_LINK_HASH_NEEDS_PLT; + } + + if (h->got.refcount > 0) + { + asection *s; + boolean dyn; + + /* Make sure this symbol is output as a dynamic symbol. + Undefined weak syms won't yet be marked as dynamic. */ + if (h->dynindx == -1 + && (h->elf_link_hash_flags & ELF_LINK_FORCED_LOCAL) == 0) + { + if (! bfd_elf32_link_record_dynamic_symbol (info, h)) + return false; + } + + s = htab->sgot; +#ifdef INCLUDE_SHMEDIA + if (h->type == STT_DATALABEL) + { + struct elf_sh_link_hash_entry *hsh; + + h = (struct elf_link_hash_entry *) h->root.u.i.link; + hsh = (struct elf_sh_link_hash_entry *)h; + hsh->datalabel_got_offset = s->_raw_size; + } + else + h->got.offset = s->_raw_size; +#else + h->got.offset = s->_raw_size; +#endif + s->_raw_size += 4; + dyn = htab->root.dynamic_sections_created; + if (WILL_CALL_FINISH_DYNAMIC_SYMBOL (dyn, info, h)) + htab->srelgot->_raw_size += sizeof (Elf32_External_Rela); + } + else + h->got.offset = (bfd_vma) -1; + + if (eh->dyn_relocs == NULL) + return true; + + /* In the shared -Bsymbolic case, discard space allocated for + dynamic pc-relative relocs against symbols which turn out to be + defined in regular objects. For the normal shared case, discard + space for pc-relative relocs that have become local due to symbol + visibility changes. */ + + if (info->shared) + { + if ((h->elf_link_hash_flags & ELF_LINK_HASH_DEF_REGULAR) != 0 + && ((h->elf_link_hash_flags & ELF_LINK_FORCED_LOCAL) != 0 + || info->symbolic)) + { + struct elf_sh_dyn_relocs **pp; + + for (pp = &eh->dyn_relocs; (p = *pp) != NULL; ) + { + p->count -= p->pc_count; + p->pc_count = 0; + if (p->count == 0) + *pp = p->next; + else + pp = &p->next; + } + } + } + else + { + /* For the non-shared case, discard space for relocs against + symbols which turn out to need copy relocs or are not + dynamic. */ + + if ((h->elf_link_hash_flags & ELF_LINK_NON_GOT_REF) == 0 + && (((h->elf_link_hash_flags & ELF_LINK_HASH_DEF_DYNAMIC) != 0 + && (h->elf_link_hash_flags & ELF_LINK_HASH_DEF_REGULAR) == 0) + || (htab->root.dynamic_sections_created + && (h->root.type == bfd_link_hash_undefweak + || h->root.type == bfd_link_hash_undefined)))) + { + /* Make sure this symbol is output as a dynamic symbol. + Undefined weak syms won't yet be marked as dynamic. */ + if (h->dynindx == -1 + && (h->elf_link_hash_flags & ELF_LINK_FORCED_LOCAL) == 0) + { + if (! bfd_elf32_link_record_dynamic_symbol (info, h)) + return false; + } + + /* If that succeeded, we know we'll be keeping all the + relocs. */ + if (h->dynindx != -1) + goto keep; + } + + eh->dyn_relocs = NULL; + + keep: ; + } + + /* Finally, allocate space. */ + for (p = eh->dyn_relocs; p != NULL; p = p->next) + { + asection *sreloc = elf_section_data (p->sec)->sreloc; + sreloc->_raw_size += p->count * sizeof (Elf32_External_Rela); + } + + return true; +} + +/* Find any dynamic relocs that apply to read-only sections. */ + +static boolean +readonly_dynrelocs (h, inf) + struct elf_link_hash_entry *h; + PTR inf; +{ + struct elf_sh_link_hash_entry *eh; + struct elf_sh_dyn_relocs *p; + + if (h->root.type == bfd_link_hash_warning) + h = (struct elf_link_hash_entry *) h->root.u.i.link; + + eh = (struct elf_sh_link_hash_entry *) h; + for (p = eh->dyn_relocs; p != NULL; p = p->next) + { + asection *s = p->sec->output_section; + + if (s != NULL && (s->flags & SEC_READONLY) != 0) + { + struct bfd_link_info *info = (struct bfd_link_info *) inf; + + info->flags |= DF_TEXTREL; + + /* Not an error, just cut short the traversal. */ + return false; + } + } + return true; +} + /* Set the sizes of the dynamic sections. */ static boolean @@ -3782,15 +4088,17 @@ sh_elf_size_dynamic_sections (output_bfd bfd *output_bfd ATTRIBUTE_UNUSED; struct bfd_link_info *info; { + struct elf_sh_link_hash_table *htab; bfd *dynobj; asection *s; - boolean plt; boolean relocs; + bfd *ibfd; - dynobj = elf_hash_table (info)->dynobj; + htab = sh_elf_hash_table (info); + dynobj = htab->root.dynobj; BFD_ASSERT (dynobj != NULL); - if (elf_hash_table (info)->dynamic_sections_created) + if (htab->root.dynamic_sections_created) { /* Set the contents of the .interp section to the interpreter. */ if (! info->shared) @@ -3801,106 +4109,135 @@ sh_elf_size_dynamic_sections (output_bfd s->contents = (unsigned char *) ELF_DYNAMIC_INTERPRETER; } } - else - { - /* We may have created entries in the .rela.got section. - However, if we are not creating the dynamic sections, we will - not actually use these entries. Reset the size of .rela.got, - which will cause it to get stripped from the output file - below. */ - s = bfd_get_section_by_name (dynobj, ".rela.got"); - if (s != NULL) - s->_raw_size = 0; - } - - /* If this is a -Bsymbolic shared link, then we need to discard all - PC relative relocs against symbols defined in a regular object. - We allocated space for them in the check_relocs routine, but we - will not fill them in in the relocate_section routine. */ - if (info->shared && info->symbolic) - sh_elf_link_hash_traverse (sh_elf_hash_table (info), - sh_elf_discard_copies, - (PTR) NULL); - - /* The check_relocs and adjust_dynamic_symbol entry points have - determined the sizes of the various dynamic sections. Allocate - memory for them. */ - plt = false; - relocs = false; - for (s = dynobj->sections; s != NULL; s = s->next) - { - const char *name; - boolean strip; - - if ((s->flags & SEC_LINKER_CREATED) == 0) - continue; - /* It's OK to base decisions on the section name, because none - of the dynobj section names depend upon the input files. */ - name = bfd_get_section_name (dynobj, s); + /* Set up .got offsets for local syms, and space for local dynamic + relocs. */ + for (ibfd = info->input_bfds; ibfd != NULL; ibfd = ibfd->link_next) + { + bfd_signed_vma *local_got; + bfd_signed_vma *end_local_got; + bfd_size_type locsymcount; + Elf_Internal_Shdr *symtab_hdr; + asection *srel; - strip = false; + if (bfd_get_flavour (ibfd) != bfd_target_elf_flavour) + continue; - if (strcmp (name, ".plt") == 0) + for (s = ibfd->sections; s != NULL; s = s->next) { - if (s->_raw_size == 0) - { - /* Strip this section if we don't need it; see the - comment below. */ - strip = true; - } - else + struct elf_sh_dyn_relocs *p; + + for (p = ((struct elf_sh_dyn_relocs *) + elf_section_data (s)->local_dynrel); + p != NULL; + p = p->next) { - /* Remember whether there is a PLT. */ - plt = true; + if (! bfd_is_abs_section (p->sec) + && bfd_is_abs_section (p->sec->output_section)) + { + /* Input section has been discarded, either because + it is a copy of a linkonce section or due to + linker script /DISCARD/, so we'll be discarding + the relocs too. */ + } + else if (p->count != 0) + { + srel = elf_section_data (p->sec)->sreloc; + srel->_raw_size += p->count * sizeof (Elf32_External_Rela); + if ((p->sec->output_section->flags & SEC_READONLY) != 0) + info->flags |= DF_TEXTREL; + } } } - else if (strncmp (name, ".rela", 5) == 0) + + local_got = elf_local_got_refcounts (ibfd); + if (!local_got) + continue; + + symtab_hdr = &elf_tdata (ibfd)->symtab_hdr; + locsymcount = symtab_hdr->sh_info; +#ifdef INCLUDE_SHMEDIA + /* Count datalabel local GOT. */ + locsymcount *= 2; +#endif + end_local_got = local_got + locsymcount; + s = htab->sgot; + srel = htab->srelgot; + for (; local_got < end_local_got; ++local_got) { - if (s->_raw_size == 0) + if (*local_got > 0) { - /* If we don't need this section, strip it from the - output file. This is mostly to handle .rela.bss and - .rela.plt. We must create both sections in - create_dynamic_sections, because they must be created - before the linker maps input sections to output - sections. The linker does that before - adjust_dynamic_symbol is called, and it is that - function which decides whether anything needs to go - into these sections. */ - strip = true; + *local_got = s->_raw_size; + s->_raw_size += 4; + if (info->shared) + srel->_raw_size += sizeof (Elf32_External_Rela); } else - { - /* Remember whether there are any reloc sections other - than .rela.plt. */ - if (strcmp (name, ".rela.plt") != 0) - relocs = true; + *local_got = (bfd_vma) -1; + } + } - /* We use the reloc_count field as a counter if we need - to copy relocs into the output file. */ - s->reloc_count = 0; - } + /* Allocate global sym .plt and .got entries, and space for global + sym dynamic relocs. */ + elf_link_hash_traverse (&htab->root, allocate_dynrelocs, (PTR) info); + + /* We now have determined the sizes of the various dynamic sections. + Allocate memory for them. */ + relocs = false; + for (s = dynobj->sections; s != NULL; s = s->next) + { + if ((s->flags & SEC_LINKER_CREATED) == 0) + continue; + + if (s == htab->splt + || s == htab->sgot + || s == htab->sgotplt) + { + /* Strip this section if we don't need it; see the + comment below. */ } - else if (strncmp (name, ".got", 4) != 0) + else if (strncmp (bfd_get_section_name (dynobj, s), ".rela", 5) == 0) + { + if (s->_raw_size != 0 && s != htab->srelplt) + relocs = true; + + /* We use the reloc_count field as a counter if we need + to copy relocs into the output file. */ + s->reloc_count = 0; + } + else { /* It's not one of our sections, so don't allocate space. */ continue; } - if (strip) + if (s->_raw_size == 0) { + /* If we don't need this section, strip it from the + output file. This is mostly to handle .rela.bss and + .rela.plt. We must create both sections in + create_dynamic_sections, because they must be created + before the linker maps input sections to output + sections. The linker does that before + adjust_dynamic_symbol is called, and it is that + function which decides whether anything needs to go + into these sections. */ + _bfd_strip_section_from_output (info, s); continue; } - /* Allocate memory for the section contents. */ - s->contents = (bfd_byte *) bfd_alloc (dynobj, s->_raw_size); - if (s->contents == NULL && s->_raw_size != 0) + /* Allocate memory for the section contents. We use bfd_zalloc + here in case unused entries are not reclaimed before the + section's contents are written out. This should not happen, + but this way if it does, we get a R_SH_NONE reloc instead + of garbage. */ + s->contents = (bfd_byte *) bfd_zalloc (dynobj, s->_raw_size); + if (s->contents == NULL) return false; } - if (elf_hash_table (info)->dynamic_sections_created) + if (htab->root.dynamic_sections_created) { /* Add some entries to the .dynamic section. We fill in the values later, in sh_elf_finish_dynamic_sections, but we @@ -3912,64 +4249,44 @@ sh_elf_size_dynamic_sections (output_bfd if (! info->shared) { - if (!add_dynamic_entry (DT_DEBUG, 0)) + if (! add_dynamic_entry (DT_DEBUG, 0)) return false; } - if (plt) + if (htab->splt->_raw_size != 0) { - if (!add_dynamic_entry (DT_PLTGOT, 0) - || !add_dynamic_entry (DT_PLTRELSZ, 0) - || !add_dynamic_entry (DT_PLTREL, DT_RELA) - || !add_dynamic_entry (DT_JMPREL, 0)) + if (! add_dynamic_entry (DT_PLTGOT, 0) + || ! add_dynamic_entry (DT_PLTRELSZ, 0) + || ! add_dynamic_entry (DT_PLTREL, DT_RELA) + || ! add_dynamic_entry (DT_JMPREL, 0)) return false; } if (relocs) { - if (!add_dynamic_entry (DT_RELA, 0) - || !add_dynamic_entry (DT_RELASZ, 0) - || !add_dynamic_entry (DT_RELAENT, sizeof (Elf32_External_Rela))) + if (! add_dynamic_entry (DT_RELA, 0) + || ! add_dynamic_entry (DT_RELASZ, 0) + || ! add_dynamic_entry (DT_RELAENT, + sizeof (Elf32_External_Rela))) return false; - } - if ((info->flags & DF_TEXTREL) != 0) - { - if (!add_dynamic_entry (DT_TEXTREL, 0)) - return false; + /* If any dynamic relocs apply to a read-only section, + then we need a DT_TEXTREL entry. */ + if ((info->flags & DF_TEXTREL) == 0) + elf_link_hash_traverse (&htab->root, readonly_dynrelocs, + (PTR) info); + + if ((info->flags & DF_TEXTREL) != 0) + { + if (! add_dynamic_entry (DT_TEXTREL, 0)) + return false; + } } } #undef add_dynamic_entry return true; } - -/* This function is called via sh_elf_link_hash_traverse if we are - creating a shared object with -Bsymbolic. It discards the space - allocated to copy PC relative relocs against symbols which are - defined in regular objects. We allocated space for them in the - check_relocs routine, but we won't fill them in in the - relocate_section routine. */ - -static boolean -sh_elf_discard_copies (h, ignore) - struct elf_sh_link_hash_entry *h; - PTR ignore ATTRIBUTE_UNUSED; -{ - struct elf_sh_pcrel_relocs_copied *s; - - if (h->root.root.type == bfd_link_hash_warning) - h = (struct elf_sh_link_hash_entry *) h->root.root.u.i.link; - - /* We only discard relocs for symbols defined in a regular object. */ - if ((h->root.elf_link_hash_flags & ELF_LINK_HASH_DEF_REGULAR) == 0) - return true; - - for (s = h->pcrel_relocs_copied; s != NULL; s = s->next) - s->section->_raw_size -= s->count * sizeof (Elf32_External_Rela); - - return true; -} /* Relocate an SH ELF section. */ @@ -3985,6 +4302,7 @@ sh_elf_relocate_section (output_bfd, inf Elf_Internal_Sym *local_syms; asection **local_sections; { + struct elf_sh_link_hash_table *htab; Elf_Internal_Shdr *symtab_hdr; struct elf_link_hash_entry **sym_hashes; Elf_Internal_Rela *rel, *relend; @@ -3995,14 +4313,15 @@ sh_elf_relocate_section (output_bfd, inf asection *splt; asection *sreloc; + htab = sh_elf_hash_table (info); symtab_hdr = &elf_tdata (input_bfd)->symtab_hdr; sym_hashes = elf_sym_hashes (input_bfd); - dynobj = elf_hash_table (info)->dynobj; + dynobj = htab->root.dynobj; local_got_offsets = elf_local_got_offsets (input_bfd); - sgot = NULL; - sgotplt = NULL; - splt = NULL; + sgot = htab->sgot; + sgotplt = htab->sgotplt; + splt = htab->splt; sreloc = NULL; rel = relocs; @@ -4025,7 +4344,7 @@ sh_elf_relocate_section (output_bfd, inf r_type = ELF32_R_TYPE (rel->r_info); /* Many of the relocs are only used for relaxing, and are - handled entirely by the relaxation code. */ + handled entirely by the relaxation code. */ if (r_type > (int) R_SH_LAST_INVALID_RELOC && r_type < (int) R_SH_LOOP_START) continue; @@ -4050,7 +4369,7 @@ sh_elf_relocate_section (output_bfd, inf howto = sh_elf_howto_table + r_type; /* For relocs that aren't partial_inplace, we get the addend from - the relocation. */ + the relocation. */ if (! howto->partial_inplace) addend = rel->r_addend; @@ -4129,9 +4448,9 @@ sh_elf_relocate_section (output_bfd, inf return false; } - addend = bfd_get_32 (input_bfd, contents + rel->r_offset); - msec = sec; - addend = + addend = bfd_get_32 (input_bfd, contents + rel->r_offset); + msec = sec; + addend = _bfd_elf_rel_local_sym (output_bfd, sym, &msec, addend) - relocation; addend += msec->output_section->vma + msec->output_offset; @@ -4162,6 +4481,9 @@ sh_elf_relocate_section (output_bfd, inf if (h->root.type == bfd_link_hash_defined || h->root.type == bfd_link_hash_defweak) { + boolean dyn; + + dyn = htab->root.dynamic_sections_created; sec = h->root.u.def.section; /* In these cases, we don't need the relocation value. We check specially because in some obscure cases @@ -4182,7 +4504,7 @@ sh_elf_relocate_section (output_bfd, inf || r_type == R_SH_GOT_MEDLOW16 || r_type == R_SH_GOT_MEDHI16 || r_type == R_SH_GOT_HI16) - && elf_hash_table (info)->dynamic_sections_created + && WILL_CALL_FINISH_DYNAMIC_SYMBOL (dyn, info, h) && (! info->shared || (! info->symbolic && h->dynindx != -1) || (h->elf_link_hash_flags @@ -4197,15 +4519,17 @@ sh_elf_relocate_section (output_bfd, inf || (h->elf_link_hash_flags & ELF_LINK_HASH_DEF_REGULAR) == 0) && ((r_type == R_SH_DIR32 - && !(ELF_ST_VISIBILITY (h->other) == STV_INTERNAL - || ELF_ST_VISIBILITY (h->other) == STV_HIDDEN)) + && (h->elf_link_hash_flags + & ELF_LINK_FORCED_LOCAL) == 0) || r_type == R_SH_REL32) && ((input_section->flags & SEC_ALLOC) != 0 /* DWARF will emit R_SH_DIR32 relocations in its sections against symbols defined externally in shared libraries. We can't do anything with them here. */ - || (input_section->flags & SEC_DEBUGGING) != 0))) + || ((input_section->flags & SEC_DEBUGGING) != 0 + && (h->elf_link_hash_flags + & ELF_LINK_HASH_DEF_DYNAMIC) != 0)))) relocation = 0; else if (sec->output_section == NULL) { @@ -4228,14 +4552,17 @@ sh_elf_relocate_section (output_bfd, inf else if (h->root.type == bfd_link_hash_undefweak) relocation = 0; else if (info->shared - && (!info->symbolic || info->allow_shlib_undefined) - && !info->no_undefined) + && (! info->symbolic || info->allow_shlib_undefined) + && ! info->no_undefined + && ELF_ST_VISIBILITY (h->other) == STV_DEFAULT) relocation = 0; else { if (! ((*info->callbacks->undefined_symbol) (info, h->root.root.string, input_bfd, - input_section, rel->r_offset, true))) + input_section, rel->r_offset, + (!info->shared || info->no_undefined + || ELF_ST_VISIBILITY (h->other))))) return false; relocation = 0; } @@ -4416,8 +4743,7 @@ sh_elf_relocate_section (output_bfd, inf procedure linkage table. */ if (h == NULL - || ELF_ST_VISIBILITY (h->other) == STV_INTERNAL - || ELF_ST_VISIBILITY (h->other) == STV_HIDDEN + || (h->elf_link_hash_flags & ELF_LINK_FORCED_LOCAL) || ! info->shared || info->symbolic || h->dynindx == -1 @@ -4427,12 +4753,8 @@ sh_elf_relocate_section (output_bfd, inf /* Relocation is to the entry for this symbol in the global offset table extension for the procedure linkage table. */ - if (sgotplt == NULL) - { - sgotplt = bfd_get_section_by_name (dynobj, ".got.plt"); - BFD_ASSERT (sgotplt != NULL); - } + BFD_ASSERT (sgotplt != NULL); relocation = (sgotplt->output_offset + ((h->plt.offset / elf_sh_sizeof_plt (info) - 1 + 3) * 4)); @@ -4455,15 +4777,13 @@ sh_elf_relocate_section (output_bfd, inf #endif /* Relocation is to the entry for this symbol in the global offset table. */ - if (sgot == NULL) - { - sgot = bfd_get_section_by_name (dynobj, ".got"); - BFD_ASSERT (sgot != NULL); - } + + BFD_ASSERT (sgot != NULL); if (h != NULL) { bfd_vma off; + boolean dyn; off = h->got.offset; #ifdef INCLUDE_SHMEDIA @@ -4477,11 +4797,11 @@ sh_elf_relocate_section (output_bfd, inf #endif BFD_ASSERT (off != (bfd_vma) -1); - if (! elf_hash_table (info)->dynamic_sections_created + dyn = htab->root.dynamic_sections_created; + if (! WILL_CALL_FINISH_DYNAMIC_SYMBOL (dyn, info, h) || (info->shared && (info->symbolic || h->dynindx == -1 - || ELF_ST_VISIBILITY (h->other) == STV_INTERNAL - || ELF_ST_VISIBILITY (h->other) == STV_HIDDEN) + || (h->elf_link_hash_flags & ELF_LINK_FORCED_LOCAL)) && (h->elf_link_hash_flags & ELF_LINK_HASH_DEF_REGULAR))) { /* This is actually a static link, or it is a @@ -4585,7 +4905,7 @@ sh_elf_relocate_section (output_bfd, inf } #ifdef GOT_BIAS - relocation -= GOT_BIAS; + relocation -= GOT_BIAS; #endif goto final_link_relocate; @@ -4600,11 +4920,7 @@ sh_elf_relocate_section (output_bfd, inf /* Relocation is relative to the start of the global offset table. */ - if (sgot == NULL) - { - sgot = bfd_get_section_by_name (dynobj, ".got"); - BFD_ASSERT (sgot != NULL); - } + BFD_ASSERT (sgot != NULL); /* Note that sgot->output_offset is not involved in this calculation. We always want the start of .got. If we @@ -4630,12 +4946,7 @@ sh_elf_relocate_section (output_bfd, inf #endif /* Use global offset table as symbol value. */ - if (sgot == NULL) - { - sgot = bfd_get_section_by_name (dynobj, ".got"); - BFD_ASSERT (sgot != NULL); - } - + BFD_ASSERT (sgot != NULL); relocation = sgot->output_section->vma; #ifdef GOT_BIAS @@ -4661,8 +4972,7 @@ sh_elf_relocate_section (output_bfd, inf if (h == NULL) goto final_link_relocate; - if (ELF_ST_VISIBILITY (h->other) == STV_INTERNAL - || ELF_ST_VISIBILITY (h->other) == STV_HIDDEN) + if (h->elf_link_hash_flags & ELF_LINK_FORCED_LOCAL) goto final_link_relocate; if (h->plt.offset == (bfd_vma) -1) @@ -4673,12 +4983,7 @@ sh_elf_relocate_section (output_bfd, inf goto final_link_relocate; } - if (splt == NULL) - { - splt = bfd_get_section_by_name (dynobj, ".plt"); - BFD_ASSERT (splt != NULL); - } - + BFD_ASSERT (splt != NULL); relocation = (splt->output_section->vma + splt->output_offset + h->plt.offset); @@ -4896,18 +5201,194 @@ sh_elf_gc_mark_hook (sec, info, rel, h, static boolean sh_elf_gc_sweep_hook (abfd, info, sec, relocs) - bfd *abfd ATTRIBUTE_UNUSED; - struct bfd_link_info *info ATTRIBUTE_UNUSED; - asection *sec ATTRIBUTE_UNUSED; - const Elf_Internal_Rela *relocs ATTRIBUTE_UNUSED; + bfd *abfd; + struct bfd_link_info *info; + asection *sec; + const Elf_Internal_Rela *relocs; { - /* We use got and plt entries for sh, but it would seem that the - existing SH code does no sort of reference counting or whatnot on - its GOT and PLT entries, so it is not possible to garbage collect - them at this time. */ + Elf_Internal_Shdr *symtab_hdr; + struct elf_link_hash_entry **sym_hashes; + bfd_signed_vma *local_got_refcounts; + const Elf_Internal_Rela *rel, *relend; + unsigned long r_symndx; + struct elf_link_hash_entry *h; + struct elf_sh_link_hash_entry *eh; + + elf_section_data (sec)->local_dynrel = NULL; + + symtab_hdr = &elf_tdata (abfd)->symtab_hdr; + sym_hashes = elf_sym_hashes (abfd); + local_got_refcounts = elf_local_got_refcounts (abfd); + + relend = relocs + sec->reloc_count; + for (rel = relocs; rel < relend; rel++) + switch (ELF32_R_TYPE (rel->r_info)) + { + case R_SH_GOT32: + case R_SH_GOTOFF: + case R_SH_GOTPC: +#ifdef INCLUDE_SHMEDIA + case R_SH_GOT_LOW16: + case R_SH_GOT_MEDLOW16: + case R_SH_GOT_MEDHI16: + case R_SH_GOT_HI16: + case R_SH_GOT10BY4: + case R_SH_GOT10BY8: + case R_SH_GOTOFF_LOW16: + case R_SH_GOTOFF_MEDLOW16: + case R_SH_GOTOFF_MEDHI16: + case R_SH_GOTOFF_HI16: + case R_SH_GOTPC_LOW16: + case R_SH_GOTPC_MEDLOW16: + case R_SH_GOTPC_MEDHI16: + case R_SH_GOTPC_HI16: +#endif + r_symndx = ELF32_R_SYM (rel->r_info); + if (r_symndx >= symtab_hdr->sh_info) + { + h = sym_hashes[r_symndx - symtab_hdr->sh_info]; + if (h->got.refcount > 0) + h->got.refcount -= 1; + } + else if (local_got_refcounts != NULL) + { + if (local_got_refcounts[r_symndx] > 0) + local_got_refcounts[r_symndx] -= 1; + } + break; + + case R_SH_DIR32: + case R_SH_REL32: + r_symndx = ELF32_R_SYM (rel->r_info); + if (r_symndx >= symtab_hdr->sh_info) + { + struct elf_sh_link_hash_entry *eh; + struct elf_sh_dyn_relocs **pp; + struct elf_sh_dyn_relocs *p; + + h = sym_hashes[r_symndx - symtab_hdr->sh_info]; + + if (!info->shared && h->plt.refcount > 0) + h->plt.refcount -= 1; + + eh = (struct elf_sh_link_hash_entry *) h; + + for (pp = &eh->dyn_relocs; (p = *pp) != NULL; pp = &p->next) + if (p->sec == sec) + { + if (ELF32_R_TYPE (rel->r_info) == R_SH_REL32) + p->pc_count -= 1; + p->count -= 1; + if (p->count == 0) + *pp = p->next; + break; + } + } + break; + + case R_SH_PLT32: +#ifdef INCLUDE_SHMEDIA + case R_SH_PLT_LOW16: + case R_SH_PLT_MEDLOW16: + case R_SH_PLT_MEDHI16: + case R_SH_PLT_HI16: +#endif + r_symndx = ELF32_R_SYM (rel->r_info); + if (r_symndx >= symtab_hdr->sh_info) + { + h = sym_hashes[r_symndx - symtab_hdr->sh_info]; + if (h->plt.refcount > 0) + h->plt.refcount -= 1; + } + break; + + case R_SH_GOTPLT32: +#ifdef INCLUDE_SHMEDIA + case R_SH_GOTPLT_LOW16: + case R_SH_GOTPLT_MEDLOW16: + case R_SH_GOTPLT_MEDHI16: + case R_SH_GOTPLT_HI16: + case R_SH_GOTPLT10BY4: + case R_SH_GOTPLT10BY8: +#endif + r_symndx = ELF32_R_SYM (rel->r_info); + if (r_symndx >= symtab_hdr->sh_info) + { + h = sym_hashes[r_symndx - symtab_hdr->sh_info]; + eh = (struct elf_sh_link_hash_entry *) h; + if (eh->gotplt_refcount > 0) + { + eh->gotplt_refcount -= 1; + if (h->plt.refcount > 0) + h->plt.refcount -= 1; + } + else if (h->got.refcount > 0) + h->got.refcount -= 1; + } + else if (local_got_refcounts != NULL) + { + if (local_got_refcounts[r_symndx] > 0) + local_got_refcounts[r_symndx] -= 1; + } + break; + + default: + break; + } + return true; } +/* Copy the extra info we tack onto an elf_link_hash_entry. */ + +static void +sh_elf_copy_indirect_symbol (bed, dir, ind) + struct elf_backend_data *bed; + struct elf_link_hash_entry *dir, *ind; +{ + struct elf_sh_link_hash_entry *edir, *eind; + + edir = (struct elf_sh_link_hash_entry *) dir; + eind = (struct elf_sh_link_hash_entry *) ind; + + if (eind->dyn_relocs != NULL) + { + if (edir->dyn_relocs != NULL) + { + struct elf_sh_dyn_relocs **pp; + struct elf_sh_dyn_relocs *p; + + BFD_ASSERT (ind->root.type != bfd_link_hash_indirect); + + /* Add reloc counts against the weak sym to the strong sym + list. Merge any entries against the same section. */ + for (pp = &eind->dyn_relocs; (p = *pp) != NULL; ) + { + struct elf_sh_dyn_relocs *q; + + for (q = edir->dyn_relocs; q != NULL; q = q->next) + if (q->sec == p->sec) + { + q->pc_count += p->pc_count; + q->count += p->count; + *pp = p->next; + break; + } + if (q == NULL) + pp = &p->next; + } + *pp = edir->dyn_relocs; + } + + edir->dyn_relocs = eind->dyn_relocs; + eind->dyn_relocs = NULL; + } + edir->gotplt_refcount = eind->gotplt_refcount; + eind->gotplt_refcount = 0; + + _bfd_elf_link_hash_copy_indirect (bed, dir, ind); +} + /* Look through the relocs for a section during the first phase. Since we don't do .gots or .plts, we just need to consider the virtual table relocs for gc. */ @@ -4921,6 +5402,7 @@ sh_elf_check_relocs (abfd, info, sec, re { Elf_Internal_Shdr *symtab_hdr; struct elf_link_hash_entry **sym_hashes, **sym_hashes_end; + struct elf_sh_link_hash_table *htab; const Elf_Internal_Rela *rel; const Elf_Internal_Rela *rel_end; bfd *dynobj; @@ -4942,7 +5424,8 @@ sh_elf_check_relocs (abfd, info, sec, re if (!elf_bad_symtab (abfd)) sym_hashes_end -= symtab_hdr->sh_info; - dynobj = elf_hash_table (info)->dynobj; + htab = sh_elf_hash_table (info); + dynobj = htab->root.dynobj; local_got_offsets = elf_local_got_offsets (abfd); rel_end = relocs + sec->reloc_count; @@ -4958,7 +5441,7 @@ sh_elf_check_relocs (abfd, info, sec, re h = sym_hashes[r_symndx - symtab_hdr->sh_info]; /* Some relocs require a global offset table. */ - if (dynobj == NULL) + if (htab->sgot == NULL) { switch (ELF32_R_TYPE (rel->r_info)) { @@ -4988,8 +5471,9 @@ sh_elf_check_relocs (abfd, info, sec, re case R_SH_GOTPC_MEDHI16: case R_SH_GOTPC_HI16: #endif - elf_hash_table (info)->dynobj = dynobj = abfd; - if (! _bfd_elf_create_got_section (dynobj, info)) + if (dynobj == NULL) + htab->root.dynobj = dynobj = abfd; + if (! create_got_section (dynobj, info)) return false; break; @@ -4999,16 +5483,16 @@ sh_elf_check_relocs (abfd, info, sec, re } switch (ELF32_R_TYPE (rel->r_info)) - { - /* This relocation describes the C++ object vtable hierarchy. - Reconstruct it for later use during GC. */ + { + /* This relocation describes the C++ object vtable hierarchy. + Reconstruct it for later use during GC. */ case R_SH_GNU_VTINHERIT: if (!_bfd_elf32_gc_record_vtinherit (abfd, sec, h, rel->r_offset)) return false; break; - /* This relocation describes which C++ vtable entries are actually - used. Record for later use during GC. */ + /* This relocation describes which C++ vtable entries are actually + used. Record for later use during GC. */ case R_SH_GNU_VTENTRY: if (!_bfd_elf32_gc_record_vtentry (abfd, sec, h, rel->r_addend)) return false; @@ -5024,133 +5508,34 @@ sh_elf_check_relocs (abfd, info, sec, re case R_SH_GOT10BY4: case R_SH_GOT10BY8: #endif - /* This symbol requires a global offset table entry. */ - - if (sgot == NULL) - { - sgot = bfd_get_section_by_name (dynobj, ".got"); - BFD_ASSERT (sgot != NULL); - } - - if (srelgot == NULL - && (h != NULL || info->shared)) - { - srelgot = bfd_get_section_by_name (dynobj, ".rela.got"); - if (srelgot == NULL) - { - srelgot = bfd_make_section (dynobj, ".rela.got"); - if (srelgot == NULL - || ! bfd_set_section_flags (dynobj, srelgot, - (SEC_ALLOC - | SEC_LOAD - | SEC_HAS_CONTENTS - | SEC_IN_MEMORY - | SEC_LINKER_CREATED - | SEC_READONLY)) - || ! bfd_set_section_alignment (dynobj, srelgot, 2)) - return false; - } - } - if (h != NULL) - { -#ifdef INCLUDE_SHMEDIA - if (h->type == STT_DATALABEL) - { - struct elf_sh_link_hash_entry *hsh; - - h = (struct elf_link_hash_entry *) h->root.u.i.link; - hsh = (struct elf_sh_link_hash_entry *)h; - if (hsh->datalabel_got_offset != (bfd_vma) -1) - break; - - hsh->datalabel_got_offset = sgot->_raw_size; - } - else - { -#endif - if (h->got.offset != (bfd_vma) -1) - { - /* We have already allocated space in the .got. */ - break; - } - h->got.offset = sgot->_raw_size; -#ifdef INCLUDE_SHMEDIA - } -#endif - - /* Make sure this symbol is output as a dynamic symbol. */ - if (h->dynindx == -1) - { - if (! bfd_elf32_link_record_dynamic_symbol (info, h)) - return false; - } - - srelgot->_raw_size += sizeof (Elf32_External_Rela); - } + h->got.refcount += 1; else { + bfd_signed_vma *local_got_refcounts; + /* This is a global offset table entry for a local - symbol. */ - if (local_got_offsets == NULL) + symbol. */ + local_got_refcounts = elf_local_got_refcounts (abfd); + if (local_got_refcounts == NULL) { bfd_size_type size; - register unsigned int i; size = symtab_hdr->sh_info; - size *= sizeof (bfd_vma); + size *= sizeof (bfd_signed_vma); #ifdef INCLUDE_SHMEDIA /* Reserve space for both the datalabel and codelabel local GOT offsets. */ size *= 2; #endif - local_got_offsets = (bfd_vma *) bfd_alloc (abfd, size); - if (local_got_offsets == NULL) + local_got_refcounts = ((bfd_signed_vma *) + bfd_zalloc (abfd, size)); + if (local_got_refcounts == NULL) return false; - elf_local_got_offsets (abfd) = local_got_offsets; - for (i = 0; i < symtab_hdr->sh_info; i++) - local_got_offsets[i] = (bfd_vma) -1; -#ifdef INCLUDE_SHMEDIA - for (; i < 2 * symtab_hdr->sh_info; i++) - local_got_offsets[i] = (bfd_vma) -1; -#endif - } -#ifdef INCLUDE_SHMEDIA - if ((rel->r_addend & 1) != 0) - { - if (local_got_offsets[symtab_hdr->sh_info - + r_symndx] != (bfd_vma) -1) - { - /* We have already allocated space in the .got. */ - break; - } - local_got_offsets[symtab_hdr->sh_info - + r_symndx] = sgot->_raw_size; - } - else - { -#endif - if (local_got_offsets[r_symndx] != (bfd_vma) -1) - { - /* We have already allocated space in the .got. */ - break; - } - local_got_offsets[r_symndx] = sgot->_raw_size; -#ifdef INCLUDE_SHMEDIA - } -#endif - - if (info->shared) - { - /* If we are generating a shared object, we need to - output a R_SH_RELATIVE reloc so that the dynamic - linker can adjust this GOT entry. */ - srelgot->_raw_size += sizeof (Elf32_External_Rela); + elf_local_got_refcounts (abfd) = local_got_refcounts; } + local_got_refcounts[r_symndx] += 1; } - - sgot->_raw_size += 4; - break; case R_SH_GOTPLT32: @@ -5166,22 +5551,15 @@ sh_elf_check_relocs (abfd, info, sec, re creating a procedure linkage table entry. */ if (h == NULL - || ELF_ST_VISIBILITY (h->other) == STV_INTERNAL - || ELF_ST_VISIBILITY (h->other) == STV_HIDDEN + || (h->elf_link_hash_flags & ELF_LINK_FORCED_LOCAL) || ! info->shared || info->symbolic - || h->dynindx == -1 - || h->got.offset != (bfd_vma) -1) + || h->dynindx == -1) goto force_got; - /* Make sure this symbol is output as a dynamic symbol. */ - if (h->dynindx == -1) - { - if (! bfd_elf32_link_record_dynamic_symbol (info, h)) - return false; - } - h->elf_link_hash_flags |= ELF_LINK_HASH_NEEDS_PLT; + h->plt.refcount += 1; + ((struct elf_sh_link_hash_entry *) h)->gotplt_refcount += 1; break; @@ -5204,18 +5582,20 @@ sh_elf_check_relocs (abfd, info, sec, re if (h == NULL) continue; - if (ELF_ST_VISIBILITY (h->other) == STV_INTERNAL - || ELF_ST_VISIBILITY (h->other) == STV_HIDDEN) + if (h->elf_link_hash_flags & ELF_LINK_FORCED_LOCAL) break; h->elf_link_hash_flags |= ELF_LINK_HASH_NEEDS_PLT; - + h->plt.refcount += 1; break; case R_SH_DIR32: case R_SH_REL32: - if (h != NULL) - h->elf_link_hash_flags |= ELF_LINK_NON_GOT_REF; + if (h != NULL && ! info->shared) + { + h->elf_link_hash_flags |= ELF_LINK_NON_GOT_REF; + h->plt.refcount += 1; + } /* If we are creating a shared library, and this is a reloc against a global symbol, or a non PC relative reloc @@ -5228,15 +5608,35 @@ sh_elf_check_relocs (abfd, info, sec, re possible that DEF_REGULAR is not set now but will be set later (it is never cleared). We account for that possibility below by storing information in the - pcrel_relocs_copied field of the hash table entry. */ - if (info->shared - && (sec->flags & SEC_ALLOC) != 0 - && (ELF32_R_TYPE (rel->r_info) != R_SH_REL32 - || (h != NULL - && (! info->symbolic - || (h->elf_link_hash_flags - & ELF_LINK_HASH_DEF_REGULAR) == 0)))) + dyn_relocs field of the hash table entry. A similar + situation occurs when creating shared libraries and symbol + visibility changes render the symbol local. + + If on the other hand, we are creating an executable, we + may need to keep relocations for symbols satisfied by a + dynamic library if we manage to avoid copy relocs for the + symbol. */ + if ((info->shared + && (sec->flags & SEC_ALLOC) != 0 + && (ELF32_R_TYPE (rel->r_info) != R_SH_REL32 + || (h != NULL + && (! info->symbolic + || h->root.type == bfd_link_hash_defweak + || (h->elf_link_hash_flags + & ELF_LINK_HASH_DEF_REGULAR) == 0)))) + || (! info->shared + && (sec->flags & SEC_ALLOC) != 0 + && h != NULL + && (h->root.type == bfd_link_hash_defweak + || (h->elf_link_hash_flags + & ELF_LINK_HASH_DEF_REGULAR) == 0))) { + struct elf_sh_dyn_relocs *p; + struct elf_sh_dyn_relocs **head; + + if (dynobj == NULL) + htab->root.dynobj = dynobj = abfd; + /* When creating a shared object, we must copy these reloc types into the output file. We create a reloc section in dynobj and make room for this reloc. */ @@ -5272,44 +5672,44 @@ sh_elf_check_relocs (abfd, info, sec, re } if (sec->flags & SEC_READONLY) info->flags |= DF_TEXTREL; + elf_section_data (sec)->sreloc = sreloc; } - sreloc->_raw_size += sizeof (Elf32_External_Rela); - - /* If we are linking with -Bsymbolic, and this is a - global symbol, we count the number of PC relative - relocations we have entered for this symbol, so that - we can discard them again if the symbol is later - defined by a regular object. Note that this function - is only called if we are using an elf_sh linker - hash table, which means that h is really a pointer to - an elf_sh_link_hash_entry. */ - if (h != NULL && info->symbolic - && ELF32_R_TYPE (rel->r_info) == R_SH_REL32) + /* If this is a global symbol, we count the number of + relocations we need for this symbol. */ + if (h != NULL) + head = &((struct elf_sh_link_hash_entry *) h)->dyn_relocs; + else { - struct elf_sh_link_hash_entry *eh; - struct elf_sh_pcrel_relocs_copied *p; + asection *s; - eh = (struct elf_sh_link_hash_entry *) h; + /* Track dynamic relocs needed for local syms too. */ + s = bfd_section_from_r_symndx (abfd, &htab->sym_sec, + sec, r_symndx); + if (s == NULL) + return false; - for (p = eh->pcrel_relocs_copied; p != NULL; p = p->next) - if (p->section == sreloc) - break; + head = ((struct elf_sh_dyn_relocs **) + &elf_section_data (s)->local_dynrel); + } + p = *head; + if (p == NULL || p->sec != sec) + { + bfd_size_type amt = sizeof (*p); + p = ((struct elf_sh_dyn_relocs *) bfd_alloc (dynobj, amt)); if (p == NULL) - { - p = ((struct elf_sh_pcrel_relocs_copied *) - bfd_alloc (dynobj, (bfd_size_type) sizeof *p)); - if (p == NULL) - return false; - p->next = eh->pcrel_relocs_copied; - eh->pcrel_relocs_copied = p; - p->section = sreloc; - p->count = 0; - } - - ++p->count; + return false; + p->next = *head; + *head = p; + p->sec = sec; + p->count = 0; + p->pc_count = 0; } + + p->count += 1; + if (ELF32_R_TYPE (rel->r_info) == R_SH_REL32) + p->pc_count += 1; } break; @@ -5443,9 +5843,11 @@ sh_elf_finish_dynamic_symbol (output_bfd struct elf_link_hash_entry *h; Elf_Internal_Sym *sym; { + struct elf_sh_link_hash_table *htab; bfd *dynobj; - dynobj = elf_hash_table (info)->dynobj; + htab = sh_elf_hash_table (info); + dynobj = htab->root.dynobj; if (h->plt.offset != (bfd_vma) -1) { @@ -5462,9 +5864,9 @@ sh_elf_finish_dynamic_symbol (output_bfd BFD_ASSERT (h->dynindx != -1); - splt = bfd_get_section_by_name (dynobj, ".plt"); - sgot = bfd_get_section_by_name (dynobj, ".got.plt"); - srel = bfd_get_section_by_name (dynobj, ".rela.plt"); + splt = htab->splt; + sgot = htab->sgotplt; + srel = htab->srelplt; BFD_ASSERT (splt != NULL && sgot != NULL && srel != NULL); /* Get the index in the procedure linkage table which @@ -5592,21 +5994,23 @@ sh_elf_finish_dynamic_symbol (output_bfd /* This symbol has an entry in the global offset table. Set it up. */ - sgot = bfd_get_section_by_name (dynobj, ".got"); - srel = bfd_get_section_by_name (dynobj, ".rela.got"); + sgot = htab->sgot; + srel = htab->srelgot; BFD_ASSERT (sgot != NULL && srel != NULL); rel.r_offset = (sgot->output_section->vma + sgot->output_offset + (h->got.offset &~ (bfd_vma) 1)); - /* If this is a -Bsymbolic link, and the symbol is defined - locally, we just want to emit a RELATIVE reloc. Likewise if - the symbol was forced to be local because of a version file. + /* If this is a static link, or it is a -Bsymbolic link and the + symbol is defined locally or was forced to be local because + of a version file, we just want to emit a RELATIVE reloc. The entry in the global offset table will already have been initialized in the relocate_section function. */ if (info->shared - && (info->symbolic || h->dynindx == -1) + && (info->symbolic + || h->dynindx == -1 + || (h->elf_link_hash_flags & ELF_LINK_FORCED_LOCAL)) && (h->elf_link_hash_flags & ELF_LINK_HASH_DEF_REGULAR)) { rel.r_info = ELF32_R_INFO (0, R_SH_RELATIVE); @@ -5668,29 +6072,29 @@ sh_elf_finish_dynamic_sections (output_b bfd *output_bfd; struct bfd_link_info *info; { + struct elf_sh_link_hash_table *htab; bfd *dynobj; asection *sgot; asection *sdyn; - dynobj = elf_hash_table (info)->dynobj; + htab = sh_elf_hash_table (info); + dynobj = htab->root.dynobj; - sgot = bfd_get_section_by_name (dynobj, ".got.plt"); - BFD_ASSERT (sgot != NULL); + sgot = htab->sgotplt; sdyn = bfd_get_section_by_name (dynobj, ".dynamic"); - if (elf_hash_table (info)->dynamic_sections_created) + if (htab->root.dynamic_sections_created) { asection *splt; Elf32_External_Dyn *dyncon, *dynconend; - BFD_ASSERT (sdyn != NULL); + BFD_ASSERT (sgot != NULL && sdyn != NULL); dyncon = (Elf32_External_Dyn *) sdyn->contents; dynconend = (Elf32_External_Dyn *) (sdyn->contents + sdyn->_raw_size); for (; dyncon < dynconend; dyncon++) { Elf_Internal_Dyn dyn; - const char *name; asection *s; bfd_elf32_swap_dyn_in (dynobj, dyncon, &dyn); @@ -5701,20 +6105,19 @@ sh_elf_finish_dynamic_sections (output_b break; case DT_PLTGOT: - name = ".got"; + s = htab->sgot->output_section; goto get_vma; case DT_JMPREL: - name = ".rela.plt"; + s = htab->srelplt->output_section; get_vma: - s = bfd_get_section_by_name (output_bfd, name); BFD_ASSERT (s != NULL); dyn.d_un.d_ptr = s->vma; bfd_elf32_swap_dyn_out (output_bfd, &dyn, dyncon); break; case DT_PLTRELSZ: - s = bfd_get_section_by_name (output_bfd, ".rela.plt"); + s = htab->srelplt->output_section; BFD_ASSERT (s != NULL); if (s->_cooked_size != 0) dyn.d_un.d_val = s->_cooked_size; @@ -5733,9 +6136,9 @@ sh_elf_finish_dynamic_sections (output_b the linker script arranges for .rela.plt to follow all other relocation sections, we don't have to worry about changing the DT_RELA entry. */ - s = bfd_get_section_by_name (output_bfd, ".rela.plt"); - if (s != NULL) + if (htab->srelplt != NULL) { + s = htab->srelplt->output_section; if (s->_cooked_size != 0) dyn.d_un.d_val -= s->_cooked_size; else @@ -5747,7 +6150,7 @@ sh_elf_finish_dynamic_sections (output_b } /* Fill in the first entry in the procedure linkage table. */ - splt = bfd_get_section_by_name (dynobj, ".plt"); + splt = htab->splt; if (splt && splt->_raw_size > 0) { if (info->shared) @@ -5793,7 +6196,7 @@ sh_elf_finish_dynamic_sections (output_b } /* Fill in the first three entries in the global offset table. */ - if (sgot->_raw_size > 0) + if (sgot && sgot->_raw_size > 0) { if (sdyn == NULL) bfd_put_32 (output_bfd, (bfd_vma) 0, sgot->contents); @@ -5803,9 +6206,9 @@ sh_elf_finish_dynamic_sections (output_b sgot->contents); bfd_put_32 (output_bfd, (bfd_vma) 0, sgot->contents + 4); bfd_put_32 (output_bfd, (bfd_vma) 0, sgot->contents + 8); - } - elf_section_data (sgot->output_section)->this_hdr.sh_entsize = 4; + elf_section_data (sgot->output_section)->this_hdr.sh_entsize = 4; + } return true; } @@ -5853,11 +6256,11 @@ sh_elf_reloc_type_class (rela) #define bfd_elf32_bfd_merge_private_bfd_data \ sh_elf_merge_private_data -#define elf_backend_gc_mark_hook sh_elf_gc_mark_hook -#define elf_backend_gc_sweep_hook sh_elf_gc_sweep_hook -#define elf_backend_check_relocs sh_elf_check_relocs - -#define elf_backend_can_gc_sections 1 +#define elf_backend_gc_mark_hook sh_elf_gc_mark_hook +#define elf_backend_gc_sweep_hook sh_elf_gc_sweep_hook +#define elf_backend_check_relocs sh_elf_check_relocs +#define elf_backend_copy_indirect_symbol \ + sh_elf_copy_indirect_symbol #define elf_backend_create_dynamic_sections \ sh_elf_create_dynamic_sections #define bfd_elf32_bfd_link_hash_table_create \ @@ -5872,6 +6275,8 @@ sh_elf_reloc_type_class (rela) sh_elf_finish_dynamic_sections #define elf_backend_reloc_type_class sh_elf_reloc_type_class +#define elf_backend_can_gc_sections 1 +#define elf_backend_can_refcount 1 #define elf_backend_want_got_plt 1 #define elf_backend_plt_readonly 1 #define elf_backend_want_plt_sym 0 diff -Nurpa binutils-2.13/bfd/elf32-sh64.c binutils-2.13.1/bfd/elf32-sh64.c --- binutils-2.13/bfd/elf32-sh64.c 2002-06-25 02:21:52.000000000 -0400 +++ binutils-2.13.1/bfd/elf32-sh64.c 2002-10-11 04:56:13.000000000 -0400 @@ -411,16 +411,19 @@ sh64_elf_add_symbol_hook (abfd, info, sy if (h == NULL) { /* No previous datalabel symbol. Make one. */ + struct bfd_link_hash_entry *bh = NULL; + struct elf_backend_data *bed = get_elf_backend_data (abfd); + if (! _bfd_generic_link_add_one_symbol (info, abfd, dl_name, flags, *secp, *valp, *namep, false, - get_elf_backend_data (abfd)->collect, - (struct bfd_link_hash_entry **) &h)) + bed->collect, &bh)) { free (dl_name); return false; } + h = (struct elf_link_hash_entry *) bh; h->elf_link_hash_flags &=~ ELF_LINK_NON_ELF; h->type = STT_DATALABEL; } diff -Nurpa binutils-2.13/bfd/elf32-sparc.c binutils-2.13.1/bfd/elf32-sparc.c --- binutils-2.13/bfd/elf32-sparc.c 2002-07-11 01:33:28.000000000 -0400 +++ binutils-2.13.1/bfd/elf32-sparc.c 2002-10-28 13:45:44.000000000 -0500 @@ -1298,7 +1298,6 @@ elf32_sparc_relocate_section (output_bfd off &= ~1; else { - bfd_put_32 (output_bfd, relocation, sgot->contents + off); if (info->shared) { @@ -1314,7 +1313,8 @@ elf32_sparc_relocate_section (output_bfd + sgot->output_offset + off); outrel.r_info = ELF32_R_INFO (0, R_SPARC_RELATIVE); - outrel.r_addend = 0; + outrel.r_addend = relocation; + relocation = 0; bfd_elf32_swap_reloca_out (output_bfd, &outrel, (((Elf32_External_Rela *) srelgot->contents) @@ -1322,6 +1322,7 @@ elf32_sparc_relocate_section (output_bfd ++srelgot->reloc_count; } + bfd_put_32 (output_bfd, relocation, sgot->contents + off); local_got_offsets[r_symndx] |= 1; } } @@ -1827,14 +1828,21 @@ elf32_sparc_finish_dynamic_symbol (outpu if (info->shared && (info->symbolic || h->dynindx == -1) && (h->elf_link_hash_flags & ELF_LINK_HASH_DEF_REGULAR)) - rela.r_info = ELF32_R_INFO (0, R_SPARC_RELATIVE); + { + asection *sec = h->root.u.def.section; + rela.r_info = ELF32_R_INFO (0, R_SPARC_RELATIVE); + rela.r_addend = (h->root.u.def.value + + sec->output_section->vma + + sec->output_offset); + } else { - bfd_put_32 (output_bfd, (bfd_vma) 0, sgot->contents + h->got.offset); rela.r_info = ELF32_R_INFO (h->dynindx, R_SPARC_GLOB_DAT); + rela.r_addend = 0; } - rela.r_addend = 0; + bfd_put_32 (output_bfd, (bfd_vma) 0, + sgot->contents + (h->got.offset &~ (bfd_vma) 1)); bfd_elf32_swap_reloca_out (output_bfd, &rela, ((Elf32_External_Rela *) srela->contents + srela->reloc_count)); diff -Nurpa binutils-2.13/bfd/elf32-vax.c binutils-2.13.1/bfd/elf32-vax.c --- binutils-2.13/bfd/elf32-vax.c 2002-07-01 12:43:36.000000000 -0400 +++ binutils-2.13.1/bfd/elf32-vax.c 2002-10-28 13:45:44.000000000 -0500 @@ -419,6 +419,11 @@ struct elf_vax_link_hash_table static boolean elf_vax_discard_copies PARAMS ((struct elf_vax_link_hash_entry *, PTR)); +/* Declare this now that the above structures are defined. */ + +static boolean elf_vax_instantiate_got_entries + PARAMS ((struct elf_link_hash_entry *, PTR)); + /* Traverse an VAX ELF linker hash table. */ #define elf_vax_link_hash_traverse(table, func, info) \ @@ -569,7 +574,6 @@ elf_vax_check_relocs (abfd, info, sec, r bfd *dynobj; Elf_Internal_Shdr *symtab_hdr; struct elf_link_hash_entry **sym_hashes; - bfd_signed_vma *local_got_refcounts; const Elf_Internal_Rela *rel; const Elf_Internal_Rela *rel_end; asection *sgot; @@ -582,7 +586,6 @@ elf_vax_check_relocs (abfd, info, sec, r dynobj = elf_hash_table (info)->dynobj; symtab_hdr = &elf_tdata (abfd)->symtab_hdr; sym_hashes = elf_sym_hashes (abfd); - local_got_refcounts = elf_local_got_refcounts (abfd); sgot = NULL; srelgot = NULL; @@ -653,18 +656,6 @@ elf_vax_check_relocs (abfd, info, sec, r { h->got.refcount = 1; eh->got_addend = rel->r_addend; - - /* Make sure this symbol is output as a dynamic symbol. */ - if (h->dynindx == -1) - { - if (!bfd_elf32_link_record_dynamic_symbol (info, h)) - return false; - } - - /* Allocate space in the .got section. */ - sgot->_raw_size += 4; - /* Allocate relocation space. */ - srelgot->_raw_size += sizeof (Elf32_External_Rela); } else { @@ -902,25 +893,18 @@ elf_vax_gc_sweep_hook (abfd, info, sec, { Elf_Internal_Shdr *symtab_hdr; struct elf_link_hash_entry **sym_hashes; - bfd_signed_vma *local_got_refcounts; const Elf_Internal_Rela *rel, *relend; unsigned long r_symndx; struct elf_link_hash_entry *h; bfd *dynobj; - asection *sgot; - asection *srelgot; symtab_hdr = &elf_tdata (abfd)->symtab_hdr; sym_hashes = elf_sym_hashes (abfd); - local_got_refcounts = elf_local_got_refcounts (abfd); dynobj = elf_hash_table (info)->dynobj; if (dynobj == NULL) return true; - sgot = bfd_get_section_by_name (dynobj, ".got"); - srelgot = bfd_get_section_by_name (dynobj, ".rela.got"); - relend = relocs + sec->reloc_count; for (rel = relocs; rel < relend; rel++) { @@ -932,29 +916,7 @@ elf_vax_gc_sweep_hook (abfd, info, sec, { h = sym_hashes[r_symndx - symtab_hdr->sh_info]; if (h->got.refcount > 0) - { - --h->got.refcount; - if (h->got.refcount == 0) - { - /* We don't need the .got entry any more. */ - sgot->_raw_size -= 4; - srelgot->_raw_size -= sizeof (Elf32_External_Rela); - } - } - } - else if (local_got_refcounts != NULL) - { - if (local_got_refcounts[r_symndx] > 0) - { - --local_got_refcounts[r_symndx]; - if (local_got_refcounts[r_symndx] == 0) - { - /* We don't need the .got entry any more. */ - sgot->_raw_size -= 4; - if (info->shared) - srelgot->_raw_size -= sizeof (Elf32_External_Rela); - } - } + --h->got.refcount; } break; @@ -1221,8 +1183,15 @@ elf_vax_size_dynamic_sections (output_bf fill them in in the relocate_section routine. */ if (info->shared && info->symbolic) elf_vax_link_hash_traverse (elf_vax_hash_table (info), - elf_vax_discard_copies, - (PTR) NULL); + elf_vax_discard_copies, + (PTR) NULL); + + /* If this is a -Bsymbolic shared link or a static link, we need to + discard all the got entries we've recorded. Otherwise, we need to + instantiate (allocate space for them). */ + elf_link_hash_traverse (elf_hash_table (info), + elf_vax_instantiate_got_entries, + (PTR) info); /* The check_relocs and adjust_dynamic_symbol entry points have determined the sizes of the various dynamic sections. Allocate @@ -1392,6 +1361,60 @@ elf_vax_discard_copies (h, ignore) return true; } +/* This function is called via elf_link_hash_traverse. It looks for entries + that have GOT or PLT (.GOT) references. If creating a static object or a + shared object with -Bsymbolic, it resets the reference count back to 0 + and sets the offset to -1 so normal PC32 relocation will be done. If + creating a shared object or executable, space in the .got and .rela.got + will be reserved for the symbol. */ + +/*ARGSUSED*/ +static boolean +elf_vax_instantiate_got_entries (h, infoptr) + struct elf_link_hash_entry *h; + PTR infoptr; +{ + struct bfd_link_info *info = (struct bfd_link_info *) infoptr; + bfd *dynobj; + asection *sgot; + asection *srelgot; + + /* We don't care about non-GOT (and non-PLT) entries. */ + if (h->got.refcount <= 0 && h->plt.refcount <= 0) + return true; + + dynobj = elf_hash_table (info)->dynobj; + if (dynobj == NULL) + return true; + + sgot = bfd_get_section_by_name (dynobj, ".got"); + srelgot = bfd_get_section_by_name (dynobj, ".rela.got"); + + if (!elf_hash_table (info)->dynamic_sections_created + || (info->shared && info->symbolic)) + { + h->got.refcount = 0; + h->got.offset = (bfd_vma) -1; + h->plt.refcount = 0; + h->plt.offset = (bfd_vma) -1; + } + else if (h->got.refcount > 0) + { + /* Make sure this symbol is output as a dynamic symbol. */ + if (h->dynindx == -1) + { + if (!bfd_elf32_link_record_dynamic_symbol (info, h)) + return false; + } + + /* Allocate space in the .got and .rela.got sections. */ + sgot->_raw_size += 4; + srelgot->_raw_size += sizeof (Elf32_External_Rela); + } + + return true; +} + /* Relocate an VAX ELF section. */ static boolean @@ -1556,8 +1579,7 @@ elf_vax_relocate_section (output_bfd, in case R_VAX_GOT32: /* Relocation is to the address of the entry for this symbol in the global offset table. */ - if (h != NULL - && strcmp (h->root.root.string, "_GLOBAL_OFFSET_TABLE_") == 0) + if (h == NULL || h->got.offset == (bfd_vma) -1) break; /* Relocation is the offset of the entry for this symbol in @@ -1566,18 +1588,6 @@ elf_vax_relocate_section (output_bfd, in { bfd_vma off; - if (!elf_hash_table (info)->dynamic_sections_created - || (h == NULL) - || (info->shared - && info->symbolic - && (h->elf_link_hash_flags & ELF_LINK_HASH_DEF_REGULAR))) - { - /* This is actually a static link, or it is a -Bsymbolic link - and the symbol is defined locally or there is no symbol. - Change the GOT32 entry to a PC32 entry. */ - break; - } - if (sgot == NULL) { sgot = bfd_get_section_by_name (dynobj, ".got"); @@ -1587,6 +1597,7 @@ elf_vax_relocate_section (output_bfd, in BFD_ASSERT (h != NULL); off = h->got.offset; BFD_ASSERT (off != (bfd_vma) -1); + BFD_ASSERT (off < sgot->_raw_size); if (info->shared && h->dynindx == -1 @@ -1615,15 +1626,12 @@ elf_vax_relocate_section (output_bfd, in } relocation = sgot->output_offset + off; - /* Neither GOT relocation uses the addend. */ + /* The GOT relocation uses the addend. */ rel->r_addend = 0; - if (r_type == R_VAX_GOT32) - { - /* Change the reference to be indirect */ - contents[rel->r_offset - 1] |= 0x10; - relocation += sgot->output_section->vma; - } + /* Change the reference to be indirect. */ + contents[rel->r_offset - 1] |= 0x10; + relocation += sgot->output_section->vma; } break; @@ -1847,11 +1855,11 @@ elf_vax_relocate_section (output_bfd, in break; } - /* VAX PCREL relocations are from the end of relocation, not the start */ + /* VAX PCREL relocations are from the end of relocation, not the start. + So subtract the difference from the relocation amount since we can't + add it to the offset. */ if (howto->pc_relative && howto->pcrel_offset) - { - relocation -= bfd_get_reloc_size(howto); - } + relocation -= bfd_get_reloc_size(howto); r = _bfd_final_link_relocate (howto, input_bfd, input_section, contents, rel->r_offset, diff -Nurpa binutils-2.13/bfd/elf64-alpha-fbsd.c binutils-2.13.1/bfd/elf64-alpha-fbsd.c --- binutils-2.13/bfd/elf64-alpha-fbsd.c 1969-12-31 19:00:00.000000000 -0500 +++ binutils-2.13.1/bfd/elf64-alpha-fbsd.c 2002-09-23 18:12:40.000000000 -0400 @@ -0,0 +1,56 @@ +/* Alpha specific support for 64-bit ELF on FreeBSD. + Copyright 2002 Free Software Foundation, Inc. + +This file is part of BFD, the Binary File Descriptor library. + +This program is free software; you can redistribute it and/or modify +it under the terms of the GNU General Public License as published by +the Free Software Foundation; either version 2 of the License, or +(at your option) any later version. + +This program is distributed in the hope that it will be useful, +but WITHOUT ANY WARRANTY; without even the implied warranty of +MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +GNU General Public License for more details. + +You should have received a copy of the GNU General Public License +along with this program; if not, write to the Free Software +Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. */ + +#define TARGET_LITTLE_SYM bfd_elf64_alpha_freebsd_vec +#define TARGET_LITTLE_NAME "elf64-alpha-freebsd" +#define ELF_ARCH bfd_arch_alpha +#define ELF_MACHINE_CODE EM_ALPHA +#define ELF_MAXPAGESIZE 0x10000 + +#include "bfd.h" +#include "sysdep.h" +#include "elf-bfd.h" + +/* The kernel recognizes executables as valid only if they carry a + "FreeBSD" label in the ELF header. So we put this label on all + executables and (for simplicity) also all other object files. */ + +static void elf_alpha_post_process_headers + PARAMS ((bfd *, struct bfd_link_info *)); + +static void +elf_alpha_post_process_headers (abfd, link_info) + bfd * abfd; + struct bfd_link_info * link_info ATTRIBUTE_UNUSED; +{ + Elf_Internal_Ehdr * i_ehdrp; /* ELF file header, internal form. */ + + i_ehdrp = elf_elfheader (abfd); + + /* Put an ABI label supported by FreeBSD >= 4.1. */ + i_ehdrp->e_ident[EI_OSABI] = ELFOSABI_FREEBSD; +#ifdef OLD_FREEBSD_ABI_LABEL + /* The ABI label supported by FreeBSD <= 4.0 is quite nonstandard. */ + memcpy (&i_ehdrp->e_ident[EI_ABIVERSION], "FreeBSD", 8); +#endif +} + +#define elf_backend_post_process_headers elf_alpha_post_process_headers + +#include "elf64-alpha.c" diff -Nurpa binutils-2.13/bfd/elf64-alpha.c binutils-2.13.1/bfd/elf64-alpha.c --- binutils-2.13/bfd/elf64-alpha.c 2002-07-20 00:18:02.000000000 -0400 +++ binutils-2.13.1/bfd/elf64-alpha.c 2002-10-28 13:45:44.000000000 -0500 @@ -2480,6 +2480,7 @@ elf64_alpha_create_dynamic_sections (abf { asection *s; struct elf_link_hash_entry *h; + struct bfd_link_hash_entry *bh; /* We need to create .plt, .rela.plt, .got, and .rela.got sections. */ @@ -2495,13 +2496,13 @@ elf64_alpha_create_dynamic_sections (abf /* Define the symbol _PROCEDURE_LINKAGE_TABLE_ at the start of the .plt section. */ - h = NULL; + bh = NULL; if (! (_bfd_generic_link_add_one_symbol (info, abfd, "_PROCEDURE_LINKAGE_TABLE_", BSF_GLOBAL, s, (bfd_vma) 0, (const char *) NULL, false, - get_elf_backend_data (abfd)->collect, - (struct bfd_link_hash_entry **) &h))) + get_elf_backend_data (abfd)->collect, &bh))) return false; + h = (struct elf_link_hash_entry *) bh; h->elf_link_hash_flags |= ELF_LINK_HASH_DEF_REGULAR; h->type = STT_OBJECT; @@ -2539,13 +2540,13 @@ elf64_alpha_create_dynamic_sections (abf dynobj's .got section. We don't do this in the linker script because we don't want to define the symbol if we are not creating a global offset table. */ - h = NULL; + bh = NULL; if (!(_bfd_generic_link_add_one_symbol (info, abfd, "_GLOBAL_OFFSET_TABLE_", BSF_GLOBAL, alpha_elf_tdata(abfd)->got, (bfd_vma) 0, (const char *) NULL, - false, get_elf_backend_data (abfd)->collect, - (struct bfd_link_hash_entry **) &h))) + false, get_elf_backend_data (abfd)->collect, &bh))) return false; + h = (struct elf_link_hash_entry *) bh; h->elf_link_hash_flags |= ELF_LINK_HASH_DEF_REGULAR; h->type = STT_OBJECT; @@ -3099,7 +3100,7 @@ elf64_alpha_check_relocs (abfd, info, se case R_ALPHA_REFLONG: case R_ALPHA_REFQUAD: - if (info->shared || maybe_dynamic) + if ((info->shared && (sec->flags & SEC_ALLOC)) || maybe_dynamic) need = NEED_DYNREL; break; @@ -3403,7 +3404,7 @@ elf64_alpha_merge_ind_symbols (hi, dummy { rin = ri->next; for (rs = rsh; rs ; rs = rs->next) - if (ri->rtype == rs->rtype) + if (ri->rtype == rs->rtype && ri->srel == rs->srel) { rs->count += ri->count; goto found_reloc; @@ -4576,7 +4577,7 @@ elf64_alpha_relocate_section (output_bfd case STO_ALPHA_NOPV: break; case STO_ALPHA_STD_GPLOAD: - addend += 8; + value += 8; break; default: if (h != NULL) @@ -5480,7 +5481,7 @@ elf64_alpha_ecoff_debug_swap = /* Use a non-standard hash bucket size of 8. */ -const struct elf_size_info alpha_elf_size_info = +static const struct elf_size_info alpha_elf_size_info = { sizeof (Elf64_External_Ehdr), sizeof (Elf64_External_Phdr), @@ -5509,11 +5510,13 @@ const struct elf_size_info alpha_elf_siz NULL }; +#ifndef ELF_ARCH #define TARGET_LITTLE_SYM bfd_elf64_alpha_vec #define TARGET_LITTLE_NAME "elf64-alpha" #define ELF_ARCH bfd_arch_alpha #define ELF_MACHINE_CODE EM_ALPHA #define ELF_MAXPAGESIZE 0x10000 +#endif /* ELF_ARCH */ #define bfd_elf64_bfd_link_hash_table_create \ elf64_alpha_bfd_link_hash_table_create diff -Nurpa binutils-2.13/bfd/elf64-ppc.c binutils-2.13.1/bfd/elf64-ppc.c --- binutils-2.13/bfd/elf64-ppc.c 2002-07-11 01:33:28.000000000 -0400 +++ binutils-2.13.1/bfd/elf64-ppc.c 2002-10-11 09:00:39.000000000 -0400 @@ -143,7 +143,7 @@ static reloc_howto_type ppc64_elf_howto_ bfd_elf_generic_reloc, /* special_function */ "R_PPC64_NONE", /* name */ false, /* partial_inplace */ - 0xff, /* src_mask */ + 0, /* src_mask */ 0, /* dst_mask */ false), /* pcrel_offset */ @@ -174,7 +174,7 @@ static reloc_howto_type ppc64_elf_howto_ bfd_elf_generic_reloc, /* special_function */ "R_PPC64_ADDR24", /* name */ false, /* partial_inplace */ - 0xfc000003, /* src_mask */ + 0, /* src_mask */ 0x03fffffc, /* dst_mask */ false), /* pcrel_offset */ @@ -251,7 +251,7 @@ static reloc_howto_type ppc64_elf_howto_ bfd_elf_generic_reloc, /* special_function */ "R_PPC64_ADDR14", /* name */ false, /* partial_inplace */ - 0xffff0003, /* src_mask */ + 0, /* src_mask */ 0x0000fffc, /* dst_mask */ false), /* pcrel_offset */ @@ -268,7 +268,7 @@ static reloc_howto_type ppc64_elf_howto_ ppc64_elf_brtaken_reloc, /* special_function */ "R_PPC64_ADDR14_BRTAKEN",/* name */ false, /* partial_inplace */ - 0xffff0003, /* src_mask */ + 0, /* src_mask */ 0x0000fffc, /* dst_mask */ false), /* pcrel_offset */ @@ -285,7 +285,7 @@ static reloc_howto_type ppc64_elf_howto_ ppc64_elf_brtaken_reloc, /* special_function */ "R_PPC64_ADDR14_BRNTAKEN",/* name */ false, /* partial_inplace */ - 0xffff0003, /* src_mask */ + 0, /* src_mask */ 0x0000fffc, /* dst_mask */ false), /* pcrel_offset */ @@ -300,7 +300,7 @@ static reloc_howto_type ppc64_elf_howto_ bfd_elf_generic_reloc, /* special_function */ "R_PPC64_REL24", /* name */ false, /* partial_inplace */ - 0xfc000003, /* src_mask */ + 0, /* src_mask */ 0x03fffffc, /* dst_mask */ true), /* pcrel_offset */ @@ -315,7 +315,7 @@ static reloc_howto_type ppc64_elf_howto_ bfd_elf_generic_reloc, /* special_function */ "R_PPC64_REL14", /* name */ false, /* partial_inplace */ - 0xffff0003, /* src_mask */ + 0, /* src_mask */ 0x0000fffc, /* dst_mask */ true), /* pcrel_offset */ @@ -332,7 +332,7 @@ static reloc_howto_type ppc64_elf_howto_ ppc64_elf_brtaken_reloc, /* special_function */ "R_PPC64_REL14_BRTAKEN", /* name */ false, /* partial_inplace */ - 0xffff0003, /* src_mask */ + 0, /* src_mask */ 0x0000fffc, /* dst_mask */ true), /* pcrel_offset */ @@ -349,7 +349,7 @@ static reloc_howto_type ppc64_elf_howto_ ppc64_elf_brtaken_reloc, /* special_function */ "R_PPC64_REL14_BRNTAKEN",/* name */ false, /* partial_inplace */ - 0xffff0003, /* src_mask */ + 0, /* src_mask */ 0x0000fffc, /* dst_mask */ true), /* pcrel_offset */ @@ -682,7 +682,7 @@ static reloc_howto_type ppc64_elf_howto_ bfd_elf_generic_reloc, /* special_function */ "R_PPC64_ADDR30", /* name */ false, /* partial_inplace */ - 0x00000003, /* src_mask */ + 0, /* src_mask */ 0xfffffffc, /* dst_mask */ true), /* pcrel_offset */ @@ -998,7 +998,7 @@ static reloc_howto_type ppc64_elf_howto_ bfd_elf_generic_reloc, /* special_function */ "R_PPC64_ADDR16_DS", /* name */ false, /* partial_inplace */ - 0x0003, /* src_mask */ + 0, /* src_mask */ 0xfffc, /* dst_mask */ false), /* pcrel_offset */ @@ -1013,7 +1013,7 @@ static reloc_howto_type ppc64_elf_howto_ bfd_elf_generic_reloc, /* special_function */ "R_PPC64_ADDR16_LO_DS",/* name */ false, /* partial_inplace */ - 0x0003, /* src_mask */ + 0, /* src_mask */ 0xfffc, /* dst_mask */ false), /* pcrel_offset */ @@ -1028,7 +1028,7 @@ static reloc_howto_type ppc64_elf_howto_ ppc64_elf_unhandled_reloc, /* special_function */ "R_PPC64_GOT16_DS", /* name */ false, /* partial_inplace */ - 0x0003, /* src_mask */ + 0, /* src_mask */ 0xfffc, /* dst_mask */ false), /* pcrel_offset */ @@ -1043,7 +1043,7 @@ static reloc_howto_type ppc64_elf_howto_ ppc64_elf_unhandled_reloc, /* special_function */ "R_PPC64_GOT16_LO_DS", /* name */ false, /* partial_inplace */ - 0x0003, /* src_mask */ + 0, /* src_mask */ 0xfffc, /* dst_mask */ false), /* pcrel_offset */ @@ -1058,7 +1058,7 @@ static reloc_howto_type ppc64_elf_howto_ ppc64_elf_unhandled_reloc, /* special_function */ "R_PPC64_PLT16_LO_DS", /* name */ false, /* partial_inplace */ - 0x0003, /* src_mask */ + 0, /* src_mask */ 0xfffc, /* dst_mask */ false), /* pcrel_offset */ @@ -1073,7 +1073,7 @@ static reloc_howto_type ppc64_elf_howto_ ppc64_elf_sectoff_reloc, /* special_function */ "R_PPC64_SECTOFF_DS", /* name */ false, /* partial_inplace */ - 0x0003, /* src_mask */ + 0, /* src_mask */ 0xfffc, /* dst_mask */ false), /* pcrel_offset */ @@ -1088,7 +1088,7 @@ static reloc_howto_type ppc64_elf_howto_ ppc64_elf_sectoff_reloc, /* special_function */ "R_PPC64_SECTOFF_LO_DS",/* name */ false, /* partial_inplace */ - 0x0003, /* src_mask */ + 0, /* src_mask */ 0xfffc, /* dst_mask */ false), /* pcrel_offset */ @@ -1103,7 +1103,7 @@ static reloc_howto_type ppc64_elf_howto_ ppc64_elf_toc_reloc, /* special_function */ "R_PPC64_TOC16_DS", /* name */ false, /* partial_inplace */ - 0x0003, /* src_mask */ + 0, /* src_mask */ 0xfffc, /* dst_mask */ false), /* pcrel_offset */ @@ -1118,7 +1118,7 @@ static reloc_howto_type ppc64_elf_howto_ ppc64_elf_toc_reloc, /* special_function */ "R_PPC64_TOC16_LO_DS", /* name */ false, /* partial_inplace */ - 0x0003, /* src_mask */ + 0, /* src_mask */ 0xfffc, /* dst_mask */ false), /* pcrel_offset */ @@ -1134,7 +1134,7 @@ static reloc_howto_type ppc64_elf_howto_ ppc64_elf_unhandled_reloc, /* special_function */ "R_PPC64_PLTGOT16_DS", /* name */ false, /* partial_inplace */ - 0x0003, /* src_mask */ + 0, /* src_mask */ 0xfffc, /* dst_mask */ false), /* pcrel_offset */ @@ -1150,7 +1150,7 @@ static reloc_howto_type ppc64_elf_howto_ ppc64_elf_unhandled_reloc, /* special_function */ "R_PPC64_PLTGOT16_LO_DS",/* name */ false, /* partial_inplace */ - 0x0003, /* src_mask */ + 0, /* src_mask */ 0xfffc, /* dst_mask */ false), /* pcrel_offset */ @@ -1955,7 +1955,8 @@ static boolean create_got_section static boolean ppc64_elf_create_dynamic_sections PARAMS ((bfd *, struct bfd_link_info *)); static void ppc64_elf_copy_indirect_symbol - PARAMS ((struct elf_link_hash_entry *, struct elf_link_hash_entry *)); + PARAMS ((struct elf_backend_data *, struct elf_link_hash_entry *, + struct elf_link_hash_entry *)); static boolean ppc64_elf_check_relocs PARAMS ((bfd *, struct bfd_link_info *, asection *, const Elf_Internal_Rela *)); @@ -2443,7 +2444,8 @@ ppc64_elf_create_dynamic_sections (dynob /* Copy the extra info we tack onto an elf_link_hash_entry. */ static void -ppc64_elf_copy_indirect_symbol (dir, ind) +ppc64_elf_copy_indirect_symbol (bed, dir, ind) + struct elf_backend_data *bed; struct elf_link_hash_entry *dir, *ind; { struct ppc_link_hash_entry *edir, *eind; @@ -2489,7 +2491,7 @@ ppc64_elf_copy_indirect_symbol (dir, ind edir->is_func_descriptor |= eind->is_func_descriptor; edir->is_entry |= eind->is_entry; - _bfd_elf_link_hash_copy_indirect (dir, ind); + _bfd_elf_link_hash_copy_indirect (bed, dir, ind); } /* Set a flag, used by ppc64_elf_gc_mark_hook, on the entry symbol and @@ -3167,6 +3169,7 @@ func_desc_adjust (h, inf) { bfd *abfd; asymbol *newsym; + struct bfd_link_hash_entry *bh; abfd = h->root.u.undef.abfd; newsym = bfd_make_empty_symbol (abfd); @@ -3177,13 +3180,14 @@ func_desc_adjust (h, inf) if (h->root.type == bfd_link_hash_undefweak) newsym->flags |= BSF_WEAK; + bh = &fdh->root; if ( !(_bfd_generic_link_add_one_symbol (info, abfd, newsym->name, newsym->flags, - newsym->section, newsym->value, NULL, false, false, - (struct bfd_link_hash_entry **) &fdh))) + newsym->section, newsym->value, NULL, false, false, &bh))) { return false; } + fdh = (struct elf_link_hash_entry *) bh; fdh->elf_link_hash_flags &= ~ELF_LINK_NON_ELF; } @@ -3676,12 +3680,16 @@ edit_opd (obfd, info) break; } - if (sym_sec->output_section == bfd_abs_section_ptr) - { - /* OK, we've found a function that's excluded from the - link. */ - need_edit = true; - } + /* opd entries are always for functions defined in the + current input bfd. If the symbol isn't defined in the + input bfd, then we won't be using the function in this + bfd; It must be defined in a linkonce section in another + bfd, or is weak. It's also possible that we are + discarding the function due to a linker script /DISCARD/, + which we test for via the output_section. */ + if (sym_sec->owner != ibfd + || sym_sec->output_section == bfd_abs_section_ptr) + need_edit = true; offset += 24; } @@ -3755,8 +3763,25 @@ edit_opd (obfd, info) sym->st_shndx); } - skip = sym_sec->output_section == bfd_abs_section_ptr; - if (!skip) + skip = (sym_sec->owner != ibfd + || sym_sec->output_section == bfd_abs_section_ptr); + if (skip) + { + if (h != NULL && sym_sec->owner == ibfd) + { + /* Arrange for the function descriptor sym + to be dropped. */ + struct elf_link_hash_entry *fdh; + struct ppc_link_hash_entry *fh; + + fh = (struct ppc_link_hash_entry *) h; + BFD_ASSERT (fh->is_func); + fdh = fh->oh; + fdh->root.u.def.value = 0; + fdh->root.u.def.section = sym_sec; + } + } + else { /* We'll be keeping this opd entry. */ @@ -3782,8 +3807,7 @@ edit_opd (obfd, info) for the function descriptor sym which we don't have at the moment. So keep an array of adjustments. */ - adjust[(rel->r_offset + wptr - rptr) / 24] - = wptr - rptr; + adjust[rel->r_offset / 24] = wptr - rptr; } if (wptr != rptr) @@ -4449,27 +4473,6 @@ ppc_build_one_stub (gen_entry, in_arg) break; case ppc_stub_plt_call: - /* Build the .glink lazy link call stub. */ - p = htab->sglink->contents + htab->sglink->_cooked_size; - indx = htab->sglink->reloc_count; - if (indx < 0x8000) - { - bfd_put_32 (htab->sglink->owner, LI_R0_0 | indx, p); - p += 4; - } - else - { - bfd_put_32 (htab->sglink->owner, LIS_R0_0 | PPC_HI (indx), p); - p += 4; - bfd_put_32 (htab->sglink->owner, ORI_R0_R0_0 | PPC_LO (indx), p); - p += 4; - } - bfd_put_32 (htab->sglink->owner, - B_DOT | ((htab->sglink->contents - p) & 0x3fffffc), p); - p += 4; - htab->sglink->_cooked_size = p - htab->sglink->contents; - htab->sglink->reloc_count += 1; - /* Do the best we can for shared libraries built without exporting ".foo" for each "foo". This can happen when symbol versioning scripts strip all bar a subset of symbols. */ @@ -5134,6 +5137,8 @@ ppc64_elf_build_stubs (info) if (htab->splt != NULL) { + unsigned int indx; + /* Build the .glink plt call stub. */ plt_r2 = (htab->splt->output_offset + htab->splt->output_section->vma @@ -5141,15 +5146,34 @@ ppc64_elf_build_stubs (info) - TOC_BASE_OFF); p = htab->sglink->contents; p = build_plt_stub (htab->sglink->owner, p, (int) plt_r2, 1); - while (p - htab->sglink->contents < GLINK_CALL_STUB_SIZE) + while (p < htab->sglink->contents + GLINK_CALL_STUB_SIZE) { bfd_put_32 (htab->sglink->owner, NOP, p); p += 4; } - htab->sglink->_cooked_size = p - htab->sglink->contents; - /* Use reloc_count to count entries. */ - htab->sglink->reloc_count = 0; + /* Build the .glink lazy link call stubs. */ + indx = 0; + while (p < htab->sglink->contents + htab->sglink->_raw_size) + { + if (indx < 0x8000) + { + bfd_put_32 (htab->sglink->owner, LI_R0_0 | indx, p); + p += 4; + } + else + { + bfd_put_32 (htab->sglink->owner, LIS_R0_0 | PPC_HI (indx), p); + p += 4; + bfd_put_32 (htab->sglink->owner, ORI_R0_R0_0 | PPC_LO (indx), p); + p += 4; + } + bfd_put_32 (htab->sglink->owner, + B_DOT | ((htab->sglink->contents - p) & 0x3fffffc), p); + indx++; + p += 4; + } + htab->sglink->_cooked_size = p - htab->sglink->contents; } if (htab->sbrlt->_raw_size != 0) @@ -5162,7 +5186,6 @@ ppc64_elf_build_stubs (info) /* Build the stubs as directed by the stub hash table. */ bfd_hash_traverse (&htab->stub_hash_table, ppc_build_one_stub, info); - htab->sglink->reloc_count = 0; for (stub_sec = htab->stub_bfd->sections; stub_sec != NULL; diff -Nurpa binutils-2.13/bfd/elf64-s390.c binutils-2.13.1/bfd/elf64-s390.c --- binutils-2.13/bfd/elf64-s390.c 2002-07-11 01:33:28.000000000 -0400 +++ binutils-2.13.1/bfd/elf64-s390.c 2002-08-21 21:34:15.000000000 -0400 @@ -40,7 +40,8 @@ static boolean create_got_section static boolean elf_s390_create_dynamic_sections PARAMS((bfd *, struct bfd_link_info *)); static void elf_s390_copy_indirect_symbol - PARAMS ((struct elf_link_hash_entry *, struct elf_link_hash_entry *)); + PARAMS ((struct elf_backend_data *, struct elf_link_hash_entry *, + struct elf_link_hash_entry *)); static boolean elf_s390_check_relocs PARAMS ((bfd *, struct bfd_link_info *, asection *, const Elf_Internal_Rela *)); @@ -510,7 +511,8 @@ elf_s390_create_dynamic_sections (dynobj /* Copy the extra info we tack onto an elf_link_hash_entry. */ static void -elf_s390_copy_indirect_symbol (dir, ind) +elf_s390_copy_indirect_symbol (bed, dir, ind) + struct elf_backend_data *bed; struct elf_link_hash_entry *dir, *ind; { struct elf_s390_link_hash_entry *edir, *eind; @@ -552,7 +554,7 @@ elf_s390_copy_indirect_symbol (dir, ind) eind->dyn_relocs = NULL; } - _bfd_elf_link_hash_copy_indirect (dir, ind); + _bfd_elf_link_hash_copy_indirect (bed, dir, ind); } /* Look through the relocs for a section during the first phase, and diff -Nurpa binutils-2.13/bfd/elf64-sh64.c binutils-2.13.1/bfd/elf64-sh64.c --- binutils-2.13/bfd/elf64-sh64.c 2002-07-07 05:10:40.000000000 -0400 +++ binutils-2.13.1/bfd/elf64-sh64.c 2002-10-11 04:56:13.000000000 -0400 @@ -2912,16 +2912,19 @@ sh64_elf64_add_symbol_hook (abfd, info, if (h == NULL) { /* No previous datalabel symbol. Make one. */ + struct bfd_link_hash_entry *bh = NULL; + struct elf_backend_data *bed = get_elf_backend_data (abfd); + if (! _bfd_generic_link_add_one_symbol (info, abfd, dl_name, flags, *secp, *valp, *namep, false, - get_elf_backend_data (abfd)->collect, - (struct bfd_link_hash_entry **) &h)) + bed->collect, &bh)) { free (dl_name); return false; } + h = (struct elf_link_hash_entry *) bh; h->elf_link_hash_flags &=~ ELF_LINK_NON_ELF; h->type = STT_DATALABEL; } @@ -3284,13 +3287,15 @@ sh64_elf64_create_dynamic_sections (abfd { /* Define the symbol _PROCEDURE_LINKAGE_TABLE_ at the start of the .plt section. */ - struct elf_link_hash_entry *h = NULL; + struct elf_link_hash_entry *h; + struct bfd_link_hash_entry *bh = NULL; + if (! (_bfd_generic_link_add_one_symbol (info, abfd, "_PROCEDURE_LINKAGE_TABLE_", BSF_GLOBAL, s, - (bfd_vma) 0, (const char *) NULL, false, - get_elf_backend_data (abfd)->collect, - (struct bfd_link_hash_entry **) &h))) + (bfd_vma) 0, (const char *) NULL, false, bed->collect, &bh))) return false; + + h = (struct elf_link_hash_entry *) bh; h->elf_link_hash_flags |= ELF_LINK_HASH_DEF_REGULAR; h->type = STT_OBJECT; @@ -3714,7 +3719,7 @@ sh64_elf64_size_dynamic_sections (output } /* Allocate memory for the section contents. */ - s->contents = (bfd_byte *) bfd_alloc (dynobj, s->_raw_size); + s->contents = (bfd_byte *) bfd_zalloc (dynobj, s->_raw_size); if (s->contents == NULL && s->_raw_size != 0) return false; } diff -Nurpa binutils-2.13/bfd/elf64-sparc.c binutils-2.13.1/bfd/elf64-sparc.c --- binutils-2.13/bfd/elf64-sparc.c 2002-07-11 01:33:28.000000000 -0400 +++ binutils-2.13.1/bfd/elf64-sparc.c 2002-11-05 23:32:04.000000000 -0500 @@ -2181,11 +2181,9 @@ sparc64_elf_relocate_section (output_bfd } else { + outrel.r_addend = relocation + rel->r_addend; if (r_type == R_SPARC_64) - { - outrel.r_info = ELF64_R_INFO (0, R_SPARC_RELATIVE); - outrel.r_addend = relocation + rel->r_addend; - } + outrel.r_info = ELF64_R_INFO (0, R_SPARC_RELATIVE); else { long indx; @@ -2215,6 +2213,13 @@ sparc64_elf_relocate_section (output_bfd osec = sec->output_section; indx = elf_section_data (osec)->dynindx; + /* We are turning this relocation into one + against a section symbol, so subtract out + the output section's address but not the + offset of the input section in the output + section. */ + outrel.r_addend -= osec->vma; + /* FIXME: we really should be able to link non-pic shared libraries. */ if (indx == 0) @@ -2233,7 +2238,6 @@ sparc64_elf_relocate_section (output_bfd ELF64_R_TYPE_INFO ( ELF64_R_TYPE_DATA (rel->r_info), r_type)); - outrel.r_addend = relocation + rel->r_addend; } } @@ -2744,11 +2748,12 @@ sparc64_elf_finish_dynamic_symbol (outpu } else { - bfd_put_64 (output_bfd, (bfd_vma) 0, sgot->contents + h->got.offset); rela.r_info = ELF64_R_INFO (h->dynindx, R_SPARC_GLOB_DAT); rela.r_addend = 0; } + bfd_put_64 (output_bfd, (bfd_vma) 0, + sgot->contents + (h->got.offset &~ (bfd_vma) 1)); bfd_elf64_swap_reloca_out (output_bfd, &rela, ((Elf64_External_Rela *) srela->contents + srela->reloc_count)); diff -Nurpa binutils-2.13/bfd/elf64-x86-64.c binutils-2.13.1/bfd/elf64-x86-64.c --- binutils-2.13/bfd/elf64-x86-64.c 2002-07-11 01:33:28.000000000 -0400 +++ binutils-2.13.1/bfd/elf64-x86-64.c 2002-08-21 21:34:15.000000000 -0400 @@ -137,7 +137,8 @@ static boolean create_got_section static boolean elf64_x86_64_create_dynamic_sections PARAMS((bfd *, struct bfd_link_info *)); static void elf64_x86_64_copy_indirect_symbol - PARAMS ((struct elf_link_hash_entry *, struct elf_link_hash_entry *)); + PARAMS ((struct elf_backend_data *, struct elf_link_hash_entry *, + struct elf_link_hash_entry *)); static boolean elf64_x86_64_check_relocs PARAMS ((bfd *, struct bfd_link_info *, asection *sec, const Elf_Internal_Rela *)); @@ -497,7 +498,8 @@ elf64_x86_64_create_dynamic_sections (dy /* Copy the extra info we tack onto an elf_link_hash_entry. */ static void -elf64_x86_64_copy_indirect_symbol (dir, ind) +elf64_x86_64_copy_indirect_symbol (bed, dir, ind) + struct elf_backend_data *bed; struct elf_link_hash_entry *dir, *ind; { struct elf64_x86_64_link_hash_entry *edir, *eind; @@ -539,7 +541,7 @@ elf64_x86_64_copy_indirect_symbol (dir, eind->dyn_relocs = NULL; } - _bfd_elf_link_hash_copy_indirect (dir, ind); + _bfd_elf_link_hash_copy_indirect (bed, dir, ind); } static boolean diff -Nurpa binutils-2.13/bfd/elfcode.h binutils-2.13.1/bfd/elfcode.h --- binutils-2.13/bfd/elfcode.h 2002-07-07 05:10:39.000000000 -0400 +++ binutils-2.13.1/bfd/elfcode.h 2002-09-23 18:12:40.000000000 -0400 @@ -1377,6 +1377,7 @@ elf_slurp_reloc_table_from_section (abfd arelent *relent; unsigned int i; int entsize; + unsigned int symcount; allocated = (PTR) bfd_malloc (rel_hdr->sh_size); if (allocated == NULL) @@ -1393,6 +1394,11 @@ elf_slurp_reloc_table_from_section (abfd BFD_ASSERT (entsize == sizeof (Elf_External_Rel) || entsize == sizeof (Elf_External_Rela)); + if (dynamic) + symcount = bfd_get_dynamic_symcount (abfd); + else + symcount = bfd_get_symcount (abfd); + for (i = 0, relent = relents; i < reloc_count; i++, relent++, native_relocs += entsize) @@ -1421,6 +1427,13 @@ elf_slurp_reloc_table_from_section (abfd if (ELF_R_SYM (rela.r_info) == 0) relent->sym_ptr_ptr = bfd_abs_section_ptr->symbol_ptr_ptr; + else if (ELF_R_SYM (rela.r_info) > symcount) + { + (*_bfd_error_handler) + (_("%s(%s): relocation %d has invalid symbol index %ld"), + abfd->filename, asect->name, i, ELF_R_SYM (rela.r_info)); + relent->sym_ptr_ptr = bfd_abs_section.symbol_ptr_ptr; + } else { asymbol **ps, *s; diff -Nurpa binutils-2.13/bfd/elflink.c binutils-2.13.1/bfd/elflink.c --- binutils-2.13/bfd/elflink.c 2002-07-30 14:19:42.000000000 -0400 +++ binutils-2.13.1/bfd/elflink.c 2002-10-11 04:56:13.000000000 -0400 @@ -33,6 +33,7 @@ _bfd_elf_create_got_section (abfd, info) flagword flags; register asection *s; struct elf_link_hash_entry *h; + struct bfd_link_hash_entry *bh; struct elf_backend_data *bed = get_elf_backend_data (abfd); int ptralign; @@ -79,12 +80,13 @@ _bfd_elf_create_got_section (abfd, info) (or .got.plt) section. We don't do this in the linker script because we don't want to define the symbol if we are not creating a global offset table. */ - h = NULL; + bh = NULL; if (!(_bfd_generic_link_add_one_symbol (info, abfd, "_GLOBAL_OFFSET_TABLE_", BSF_GLOBAL, s, bed->got_symbol_offset, (const char *) NULL, false, - bed->collect, (struct bfd_link_hash_entry **) &h))) + bed->collect, &bh))) return false; + h = (struct elf_link_hash_entry *) bh; h->elf_link_hash_flags |= ELF_LINK_HASH_DEF_REGULAR; h->type = STT_OBJECT; @@ -151,13 +153,15 @@ _bfd_elf_create_dynamic_sections (abfd, { /* Define the symbol _PROCEDURE_LINKAGE_TABLE_ at the start of the .plt section. */ - struct elf_link_hash_entry *h = NULL; + struct elf_link_hash_entry *h; + struct bfd_link_hash_entry *bh = NULL; + if (! (_bfd_generic_link_add_one_symbol (info, abfd, "_PROCEDURE_LINKAGE_TABLE_", BSF_GLOBAL, s, (bfd_vma) 0, (const char *) NULL, false, - get_elf_backend_data (abfd)->collect, - (struct bfd_link_hash_entry **) &h))) + get_elf_backend_data (abfd)->collect, &bh))) return false; + h = (struct elf_link_hash_entry *) bh; h->elf_link_hash_flags |= ELF_LINK_HASH_DEF_REGULAR; h->type = STT_OBJECT; @@ -546,29 +550,27 @@ _bfd_elf_create_linker_section (abfd, in if (lsect->sym_name) { - struct elf_link_hash_entry *h = NULL; + struct elf_link_hash_entry *h; + struct bfd_link_hash_entry *bh; + #ifdef DEBUG fprintf (stderr, "Adding %s to section %s\n", lsect->sym_name, lsect->name); #endif - h = (struct elf_link_hash_entry *) - bfd_link_hash_lookup (info->hash, lsect->sym_name, false, false, false); + bh = bfd_link_hash_lookup (info->hash, lsect->sym_name, + false, false, false); - if ((h == NULL || h->root.type == bfd_link_hash_undefined) - && !(_bfd_generic_link_add_one_symbol (info, - abfd, - lsect->sym_name, - BSF_GLOBAL, - s, - ((lsect->hole_size) - ? s->_raw_size - lsect->hole_size + lsect->sym_offset - : lsect->sym_offset), - (const char *) NULL, - false, - get_elf_backend_data (abfd)->collect, - (struct bfd_link_hash_entry **) &h))) - return (elf_linker_section_t *)0; + if ((bh == NULL || bh->type == bfd_link_hash_undefined) + && !(_bfd_generic_link_add_one_symbol + (info, abfd, lsect->sym_name, BSF_GLOBAL, s, + (lsect->hole_size + ? s->_raw_size - lsect->hole_size + lsect->sym_offset + : lsect->sym_offset), + (const char *) NULL, false, + get_elf_backend_data (abfd)->collect, &bh))) + return (elf_linker_section_t *) 0; + h = (struct elf_link_hash_entry *) bh; if ((defaults->which != LINKER_SECTION_SDATA) && (defaults->which != LINKER_SECTION_SDATA2)) @@ -579,7 +581,7 @@ _bfd_elf_create_linker_section (abfd, in if (info->shared && ! _bfd_elf_link_record_dynamic_symbol (info, h)) - return (elf_linker_section_t *)0; + return (elf_linker_section_t *) 0; } } diff -Nurpa binutils-2.13/bfd/elflink.h binutils-2.13.1/bfd/elflink.h --- binutils-2.13/bfd/elflink.h 2002-07-30 14:19:42.000000000 -0400 +++ binutils-2.13.1/bfd/elflink.h 2002-10-28 13:45:44.000000000 -0500 @@ -343,7 +343,7 @@ elf_link_add_archive_symbols (abfd, info false, false, false); if (h == NULL) - { + { /* We also need to check references to the symbol without the version. */ @@ -899,19 +899,19 @@ elf_merge_symbol (abfd, info, name, sym, /* This function is called to create an indirect symbol from the default for the symbol with the default version if needed. The - symbol is described by H, NAME, SYM, SEC, VALUE, and OVERRIDE. We + symbol is described by H, NAME, SYM, PSEC, VALUE, and OVERRIDE. We set DYNSYM if the new indirect symbol is dynamic. DT_NEEDED indicates if it comes from a DT_NEEDED entry of a shared object. */ static boolean -elf_add_default_symbol (abfd, info, h, name, sym, sec, value, +elf_add_default_symbol (abfd, info, h, name, sym, psec, value, dynsym, override, dt_needed) bfd *abfd; struct bfd_link_info *info; struct elf_link_hash_entry *h; const char *name; Elf_Internal_Sym *sym; - asection **sec; + asection **psec; bfd_vma *value; boolean *dynsym; boolean override; @@ -921,11 +921,13 @@ elf_add_default_symbol (abfd, info, h, n boolean size_change_ok; char *shortname; struct elf_link_hash_entry *hi; + struct bfd_link_hash_entry *bh; struct elf_backend_data *bed; boolean collect; boolean dynamic; char *p; size_t len, shortlen; + asection *sec; /* If this symbol has a version, and it is the default version, we create an indirect symbol from the default name to the fully @@ -970,18 +972,20 @@ elf_add_default_symbol (abfd, info, h, n actually going to define an indirect symbol. */ type_change_ok = false; size_change_ok = false; - if (! elf_merge_symbol (abfd, info, shortname, sym, sec, value, + sec = *psec; + if (! elf_merge_symbol (abfd, info, shortname, sym, &sec, value, &hi, &override, &type_change_ok, &size_change_ok, dt_needed)) return false; if (! override) { + bh = &hi->root; if (! (_bfd_generic_link_add_one_symbol (info, abfd, shortname, BSF_INDIRECT, bfd_ind_section_ptr, - (bfd_vma) 0, name, false, collect, - (struct bfd_link_hash_entry **) &hi))) + (bfd_vma) 0, name, false, collect, &bh))) return false; + hi = (struct elf_link_hash_entry *) bh; } else { @@ -1042,7 +1046,7 @@ elf_add_default_symbol (abfd, info, h, n | ELF_LINK_HASH_DEF_REGULAR)) == 0); ht = (struct elf_link_hash_entry *) hi->root.u.i.link; - (*bed->elf_backend_copy_indirect_symbol) (ht, hi); + (*bed->elf_backend_copy_indirect_symbol) (bed, ht, hi); /* See if the new flags lead us to realize that the symbol must be dynamic. */ @@ -1077,7 +1081,8 @@ elf_add_default_symbol (abfd, info, h, n /* Once again, merge with any existing symbol. */ type_change_ok = false; size_change_ok = false; - if (! elf_merge_symbol (abfd, info, shortname, sym, sec, value, + sec = *psec; + if (! elf_merge_symbol (abfd, info, shortname, sym, &sec, value, &hi, &override, &type_change_ok, &size_change_ok, dt_needed)) return false; @@ -1085,18 +1090,22 @@ elf_add_default_symbol (abfd, info, h, n if (override) { /* Here SHORTNAME is a versioned name, so we don't expect to see - the type of override we do in the case above. */ - (*_bfd_error_handler) - (_("%s: warning: unexpected redefinition of `%s'"), - bfd_archive_filename (abfd), shortname); + the type of override we do in the case above unless it is + overridden by a versioned definiton. */ + if (hi->root.type != bfd_link_hash_defined + && hi->root.type != bfd_link_hash_defweak) + (*_bfd_error_handler) + (_("%s: warning: unexpected redefinition of indirect versioned symbol `%s'"), + bfd_archive_filename (abfd), shortname); } else { + bh = &hi->root; if (! (_bfd_generic_link_add_one_symbol (info, abfd, shortname, BSF_INDIRECT, - bfd_ind_section_ptr, (bfd_vma) 0, name, false, - collect, (struct bfd_link_hash_entry **) &hi))) + bfd_ind_section_ptr, (bfd_vma) 0, name, false, collect, &bh))) return false; + hi = (struct elf_link_hash_entry *) bh; /* If there is a duplicate definition somewhere, then HI may not point to an indirect symbol. We will have reported an error @@ -1110,7 +1119,7 @@ elf_add_default_symbol (abfd, info, h, n & (ELF_LINK_HASH_DEF_DYNAMIC | ELF_LINK_HASH_DEF_REGULAR)) == 0); - (*bed->elf_backend_copy_indirect_symbol) (h, hi); + (*bed->elf_backend_copy_indirect_symbol) (bed, h, hi); /* See if the new flags lead us to realize that the symbol must be dynamic. */ @@ -1289,6 +1298,14 @@ elf_link_add_object_symbols (abfd, info) const char *name; bfd_size_type oldsize; bfd_size_type strindex; + struct bfd_link_needed_list *rpath = NULL, *runpath = NULL; + + /* ld --just-symbols and dynamic objects don't mix very well. + Test for --just-symbols by looking at info set up by + _bfd_elf_link_just_syms. */ + if ((s = abfd->sections) != NULL + && elf_section_data (s)->sec_info_type == ELF_INFO_TYPE_JUST_SYMS) + goto error_return; /* Find the name to use in a DT_NEEDED entry that refers to this object. If the object has a DT_SONAME entry, we use it. @@ -1318,8 +1335,6 @@ elf_link_add_object_symbols (abfd, info) Elf_External_Dyn *extdynend; int elfsec; unsigned long shlink; - int rpath; - int runpath; dynbuf = (Elf_External_Dyn *) bfd_malloc (s->_raw_size); if (dynbuf == NULL) @@ -1336,8 +1351,6 @@ elf_link_add_object_symbols (abfd, info) extdyn = dynbuf; extdynend = extdyn + s->_raw_size / sizeof (Elf_External_Dyn); - rpath = 0; - runpath = 0; for (; extdyn < extdynend; extdyn++) { Elf_Internal_Dyn dyn; @@ -1381,13 +1394,6 @@ elf_link_add_object_symbols (abfd, info) char *fnm, *anm; unsigned int tagv = dyn.d_un.d_val; - /* When we see DT_RPATH before DT_RUNPATH, we have - to clear runpath. Do _NOT_ bfd_release, as that - frees all more recently bfd_alloc'd blocks as - well. */ - if (rpath && hash_table->runpath) - hash_table->runpath = NULL; - amt = sizeof (struct bfd_link_needed_list); n = (struct bfd_link_needed_list *) bfd_alloc (abfd, amt); fnm = bfd_elf_string_from_elf_section (abfd, shlink, tagv); @@ -1401,13 +1407,11 @@ elf_link_add_object_symbols (abfd, info) n->name = anm; n->by = abfd; n->next = NULL; - for (pn = & hash_table->runpath; + for (pn = & runpath; *pn != NULL; pn = &(*pn)->next) ; *pn = n; - runpath = 1; - rpath = 0; } /* Ignore DT_RPATH if we have seen DT_RUNPATH. */ if (!runpath && dyn.d_tag == DT_RPATH) @@ -1433,18 +1437,32 @@ elf_link_add_object_symbols (abfd, info) n->name = anm; n->by = abfd; n->next = NULL; - for (pn = & hash_table->runpath; + for (pn = & rpath; *pn != NULL; pn = &(*pn)->next) ; *pn = n; - rpath = 1; } } free (dynbuf); } + /* DT_RUNPATH overrides DT_RPATH. Do _NOT_ bfd_release, as that + frees all more recently bfd_alloc'd blocks as well. */ + if (runpath) + rpath = runpath; + + if (rpath) + { + struct bfd_link_needed_list **pn; + for (pn = & hash_table->runpath; + *pn != NULL; + pn = &(*pn)->next) + ; + *pn = rpath; + } + /* We do not want to include any of the sections in a dynamic object in the output file. We hack by simply clobbering the list of sections in the BFD. This could be handled more @@ -2286,6 +2304,7 @@ elf_link_create_dynamic_sections (abfd, flagword flags; register asection *s; struct elf_link_hash_entry *h; + struct bfd_link_hash_entry *bh; struct elf_backend_data *bed; if (! is_elf_hash_table (info)) @@ -2378,12 +2397,12 @@ elf_link_create_dynamic_sections (abfd, creating a .dynamic section. We don't want to define it if there is no .dynamic section, since on some ELF platforms the start up code examines it to decide how to initialize the process. */ - h = NULL; + bh = NULL; if (! (_bfd_generic_link_add_one_symbol (info, abfd, "_DYNAMIC", BSF_GLOBAL, s, (bfd_vma) 0, - (const char *) NULL, false, get_elf_backend_data (abfd)->collect, - (struct bfd_link_hash_entry **) &h))) + (const char *) 0, false, get_elf_backend_data (abfd)->collect, &bh))) return false; + h = (struct elf_link_hash_entry *) bh; h->elf_link_hash_flags |= ELF_LINK_HASH_DEF_REGULAR; h->type = STT_OBJECT; @@ -2765,9 +2784,9 @@ compute_bucket_count (info) elf_link_hash_traverse (elf_hash_table (info), elf_collect_hash_codes, &hashcodesp); -/* We have a problem here. The following code to optimize the table - size requires an integer type with more the 32 bits. If - BFD_HOST_U_64_BIT is set we know about such a type. */ + /* We have a problem here. The following code to optimize the table + size requires an integer type with more the 32 bits. If + BFD_HOST_U_64_BIT is set we know about such a type. */ #ifdef BFD_HOST_U_64_BIT if (info->optimize) { @@ -2938,6 +2957,9 @@ NAME(bfd_elf,size_dynamic_sections) (out struct elf_info_failed eif; struct elf_link_hash_entry *h; asection *dynstr; + struct bfd_elf_version_tree *t; + struct bfd_elf_version_expr *d; + boolean all_defined; *sinterpptr = bfd_get_section_by_name (dynobj, ".interp"); BFD_ASSERT (*sinterpptr != NULL || info->shared); @@ -3018,6 +3040,57 @@ NAME(bfd_elf,size_dynamic_sections) (out return false; } + /* Make all global versions with definiton. */ + for (t = verdefs; t != NULL; t = t->next) + for (d = t->globals; d != NULL; d = d->next) + if (!d->symver && strchr (d->pattern, '*') == NULL) + { + const char *verstr, *name; + size_t namelen, verlen, newlen; + char *newname, *p; + struct elf_link_hash_entry *newh; + + name = d->pattern; + namelen = strlen (name); + verstr = t->name; + verlen = strlen (verstr); + newlen = namelen + verlen + 3; + + newname = (char *) bfd_malloc ((bfd_size_type) newlen); + if (newname == NULL) + return false; + memcpy (newname, name, namelen); + + /* Check the hidden versioned definition. */ + p = newname + namelen; + *p++ = ELF_VER_CHR; + memcpy (p, verstr, verlen + 1); + newh = elf_link_hash_lookup (elf_hash_table (info), + newname, false, false, + false); + if (newh == NULL + || (newh->root.type != bfd_link_hash_defined + && newh->root.type != bfd_link_hash_defweak)) + { + /* Check the default versioned definition. */ + *p++ = ELF_VER_CHR; + memcpy (p, verstr, verlen + 1); + newh = elf_link_hash_lookup (elf_hash_table (info), + newname, false, false, + false); + } + free (newname); + + /* Mark this version if there is a definition and it is + not defined in a shared object. */ + if (newh != NULL + && ((newh->elf_link_hash_flags + & ELF_LINK_HASH_DEF_DYNAMIC) == 0) + && (newh->root.type == bfd_link_hash_defined + || newh->root.type == bfd_link_hash_defweak)) + d->symver = 1; + } + /* Attach all the symbols to their version information. */ asvinfo.output_bfd = output_bfd; asvinfo.info = info; @@ -3030,6 +3103,28 @@ NAME(bfd_elf,size_dynamic_sections) (out if (asvinfo.failed) return false; + if (!info->allow_undefined_version) + { + /* Check if all global versions have a definiton. */ + all_defined = true; + for (t = verdefs; t != NULL; t = t->next) + for (d = t->globals; d != NULL; d = d->next) + if (!d->symver && !d->script + && strchr (d->pattern, '*') == NULL) + { + (*_bfd_error_handler) + (_("%s: undefined version: %s"), + d->pattern, t->name); + all_defined = false; + } + + if (!all_defined) + { + bfd_set_error (bfd_error_bad_value); + return false; + } + } + /* Find all symbols which were defined in a dynamic object and make the backend pick a reasonable value for them. */ elf_link_hash_traverse (elf_hash_table (info), @@ -3085,7 +3180,7 @@ NAME(bfd_elf,size_dynamic_sections) (out { (*_bfd_error_handler) (_("%s: .preinit_array section is not allowed in DSO"), - bfd_archive_filename (sub)); + bfd_archive_filename (sub)); break; } @@ -3244,19 +3339,20 @@ NAME(bfd_elf,size_dynamic_sections) (out unsigned int cdeps; struct bfd_elf_version_deps *n; struct elf_link_hash_entry *h; + struct bfd_link_hash_entry *bh; cdeps = 0; for (n = t->deps; n != NULL; n = n->next) ++cdeps; /* Add a symbol representing this version. */ - h = NULL; + bh = NULL; if (! (_bfd_generic_link_add_one_symbol (info, dynobj, t->name, BSF_GLOBAL, bfd_abs_section_ptr, (bfd_vma) 0, (const char *) NULL, false, - get_elf_backend_data (dynobj)->collect, - (struct bfd_link_hash_entry **) &h))) + get_elf_backend_data (dynobj)->collect, &bh))) return false; + h = (struct elf_link_hash_entry *) bh; h->elf_link_hash_flags &= ~ ELF_LINK_NON_ELF; h->elf_link_hash_flags |= ELF_LINK_HASH_DEF_REGULAR; h->type = STT_OBJECT; @@ -3821,7 +3917,7 @@ elf_fix_symbol_flags (h, eif) struct elf_backend_data *bed; bed = get_elf_backend_data (elf_hash_table (eif->info)->dynobj); - (*bed->elf_backend_copy_indirect_symbol) (weakdef, h); + (*bed->elf_backend_copy_indirect_symbol) (bed, weakdef, h); } } @@ -3941,7 +4037,7 @@ elf_adjust_dynamic_symbol (h, data) && (h->elf_link_hash_flags & ELF_LINK_HASH_NEEDS_PLT) == 0) (*_bfd_error_handler) (_("warning: type and size of dynamic symbol `%s' are not defined"), - h->root.root.string); + h->root.root.string); dynobj = elf_hash_table (eif->info)->dynobj; bed = get_elf_backend_data (dynobj); @@ -4001,7 +4097,7 @@ elf_export_symbol (h, data) if (!eif->verdefs) { -doit: + doit: if (! _bfd_elf_link_record_dynamic_symbol (eif->info, h)) { eif->failed = true; @@ -4258,7 +4354,6 @@ elf_link_assign_sym_version (h, data) (_("%s: undefined versioned symbol name %s"), bfd_get_filename (sinfo->output_bfd), h->root.root.string); bfd_set_error (bfd_error_bad_value); -error_return: sinfo->failed = true; return false; } @@ -4272,45 +4367,58 @@ error_return: if (h->verinfo.vertree == NULL && sinfo->verdefs != NULL) { struct bfd_elf_version_tree *t; - struct bfd_elf_version_tree *deflt; + struct bfd_elf_version_tree *local_ver; struct bfd_elf_version_expr *d; /* See if can find what version this symbol is in. If the symbol is supposed to be local, then don't actually register it. */ - deflt = NULL; + local_ver = NULL; for (t = sinfo->verdefs; t != NULL; t = t->next) { if (t->globals != NULL) { + boolean matched; + + matched = false; for (d = t->globals; d != NULL; d = d->next) { if ((*d->match) (d, h->root.root.string)) { - h->verinfo.vertree = t; - break; + if (d->symver) + matched = true; + else + { + /* There is a version without definition. Make + the symbol the default definition for this + version. */ + h->verinfo.vertree = t; + local_ver = NULL; + d->script = 1; + break; + } } } if (d != NULL) break; + else if (matched) + /* There is no undefined version for this symbol. Hide the + default one. */ + (*bed->elf_backend_hide_symbol) (info, h, true); } if (t->locals != NULL) { for (d = t->locals; d != NULL; d = d->next) { + /* If the match is "*", keep looking for a more + explicit, perhaps even global, match. */ if (d->pattern[0] == '*' && d->pattern[1] == '\0') - deflt = t; + local_ver = t; else if ((*d->match) (d, h->root.root.string)) { - h->verinfo.vertree = t; - if (h->dynindx != -1 - && info->shared - && ! info->export_dynamic) - { - (*bed->elf_backend_hide_symbol) (info, h, true); - } + local_ver = t; break; } } @@ -4320,9 +4428,9 @@ error_return: } } - if (deflt != NULL && h->verinfo.vertree == NULL) + if (local_ver != NULL) { - h->verinfo.vertree = deflt; + h->verinfo.vertree = local_ver; if (h->dynindx != -1 && info->shared && ! info->export_dynamic) @@ -4330,43 +4438,6 @@ error_return: (*bed->elf_backend_hide_symbol) (info, h, true); } } - - /* We need to check if a hidden versioned definition should - hide the default one. */ - if (h->dynindx != -1 && h->verinfo.vertree != NULL) - { - const char *verstr, *name; - size_t namelen, verlen, newlen; - char *newname; - struct elf_link_hash_entry *newh; - - name = h->root.root.string; - namelen = strlen (name); - verstr = h->verinfo.vertree->name; - verlen = strlen (verstr); - newlen = namelen + verlen + 2; - - newname = (char *) bfd_malloc ((bfd_size_type) newlen); - if (newname == NULL) - goto error_return; - memcpy (newname, name, namelen); - - /* Check the hidden versioned definition. */ - p = newname + namelen; - *p++ = ELF_VER_CHR; - memcpy (p, verstr, verlen + 1); - newh = elf_link_hash_lookup (elf_hash_table (info), newname, - false, false, false); - - if (newh - && (newh->root.type == bfd_link_hash_defined - || newh->root.type == bfd_link_hash_defweak)) - /* We find a hidden versioned definition. Hide the default - one. */ - (*bed->elf_backend_hide_symbol) (info, h, true); - - free (newname); - } } return true; @@ -4576,7 +4647,7 @@ elf_link_adjust_relocs (abfd, rel_hdr, c for (j = 0; j < bed->s->int_rels_per_ext_rel; j++) irela[j].r_info = ELF_R_INFO ((*rel_hash)->indx, - ELF_R_TYPE (irela[j].r_info)); + ELF_R_TYPE (irela[j].r_info)); if (bed->s->swap_reloca_out) (*bed->s->swap_reloca_out) (abfd, irela, (bfd_byte *) erela); @@ -4589,10 +4660,12 @@ elf_link_adjust_relocs (abfd, rel_hdr, c free (irela); } -struct elf_link_sort_rela { +struct elf_link_sort_rela +{ bfd_vma offset; enum elf_reloc_type_class type; - union { + union + { Elf_Internal_Rel rel; Elf_Internal_Rela rela; } u; @@ -5266,7 +5339,7 @@ elf_bfd_final_link (abfd, info) size = 0; for (o = sec->link_order_head; o != NULL; o = o->next) if (size < o->offset + o->size) - size = o->offset + o->size; + size = o->offset + o->size; } end = sec->vma + size; } @@ -5405,8 +5478,8 @@ elf_bfd_final_link (abfd, info) sym = e->isym; if (e->isym.st_shndx != SHN_UNDEF - && (e->isym.st_shndx < SHN_LORESERVE - || e->isym.st_shndx > SHN_HIRESERVE)) + && (e->isym.st_shndx < SHN_LORESERVE + || e->isym.st_shndx > SHN_HIRESERVE)) { s = bfd_section_from_elf_index (e->input_bfd, e->isym.st_shndx); @@ -6343,7 +6416,7 @@ elf_link_output_extsym (h, data) /* If we're stripping it, then it was just a dynamic symbol, and there's nothing else to do. */ - if (strip) + if (strip || (input_sec->flags & SEC_EXCLUDE) != 0) return true; h->indx = bfd_get_symcount (finfo->output_bfd); @@ -6395,19 +6468,19 @@ elf_link_output_relocs (output_bfd, inpu } else { - (*_bfd_error_handler) ( - _("%s: relocation size mismatch in %s section %s"), - bfd_get_filename (output_bfd), - bfd_archive_filename (input_section->owner), - input_section->name); + (*_bfd_error_handler) + (_("%s: relocation size mismatch in %s section %s"), + bfd_get_filename (output_bfd), + bfd_archive_filename (input_section->owner), + input_section->name); bfd_set_error (bfd_error_wrong_object_format); return false; } bed = get_elf_backend_data (output_bfd); irela = internal_relocs; - irelaend = irela + NUM_SHDR_ENTRIES (input_rel_hdr) - * bed->s->int_rels_per_ext_rel; + irelaend = irela + (NUM_SHDR_ENTRIES (input_rel_hdr) + * bed->s->int_rels_per_ext_rel); if (input_rel_hdr->sh_entsize == sizeof (Elf_External_Rel)) { @@ -6753,20 +6826,12 @@ elf_link_input_bfd (finfo, input_bfd) || h->root.type == bfd_link_hash_defweak) && elf_discarded_section (h->root.u.def.section)) { -#if BFD_VERSION_DATE < 20031005 if ((o->flags & SEC_DEBUGGING) != 0) { -#if BFD_VERSION_DATE > 20021005 - (*finfo->info->callbacks->warning) - (finfo->info, - _("warning: relocation against removed section; zeroing"), - NULL, input_bfd, o, rel->r_offset); -#endif BFD_ASSERT (r_symndx != 0); memset (rel, 0, sizeof (*rel)); } else -#endif { if (! ((*finfo->info->callbacks->undefined_symbol) (finfo->info, h->root.root.string, @@ -6782,23 +6847,15 @@ elf_link_input_bfd (finfo, input_bfd) if (sec != NULL && elf_discarded_section (sec)) { -#if BFD_VERSION_DATE < 20031005 if ((o->flags & SEC_DEBUGGING) != 0 || (sec->flags & SEC_LINK_ONCE) != 0) { -#if BFD_VERSION_DATE > 20021005 - (*finfo->info->callbacks->warning) - (finfo->info, - _("warning: relocation against removed section"), - NULL, input_bfd, o, rel->r_offset); -#endif BFD_ASSERT (r_symndx != 0); rel->r_info = ELF_R_INFO (0, ELF_R_TYPE (rel->r_info)); rel->r_addend = 0; } else -#endif { boolean ok; const char *msg @@ -7043,7 +7100,6 @@ elf_link_input_bfd (finfo, input_bfd) internal_relocs)) return false; } - } } @@ -7560,28 +7616,27 @@ elf_finish_pointer_linker_section (outpu /* Garbage collect unused sections. */ static boolean elf_gc_mark - PARAMS ((struct bfd_link_info *info, asection *sec, - asection * (*gc_mark_hook) - PARAMS ((asection *, struct bfd_link_info *, Elf_Internal_Rela *, - struct elf_link_hash_entry *, Elf_Internal_Sym *)))); + PARAMS ((struct bfd_link_info *, asection *, + asection * (*) (asection *, struct bfd_link_info *, + Elf_Internal_Rela *, struct elf_link_hash_entry *, + Elf_Internal_Sym *))); static boolean elf_gc_sweep - PARAMS ((struct bfd_link_info *info, - boolean (*gc_sweep_hook) - PARAMS ((bfd *abfd, struct bfd_link_info *info, asection *o, - const Elf_Internal_Rela *relocs)))); + PARAMS ((struct bfd_link_info *, + boolean (*) (bfd *, struct bfd_link_info *, asection *, + const Elf_Internal_Rela *))); static boolean elf_gc_sweep_symbol - PARAMS ((struct elf_link_hash_entry *h, PTR idxptr)); + PARAMS ((struct elf_link_hash_entry *, PTR)); static boolean elf_gc_allocate_got_offsets - PARAMS ((struct elf_link_hash_entry *h, PTR offarg)); + PARAMS ((struct elf_link_hash_entry *, PTR)); static boolean elf_gc_propagate_vtable_entries_used - PARAMS ((struct elf_link_hash_entry *h, PTR dummy)); + PARAMS ((struct elf_link_hash_entry *, PTR)); static boolean elf_gc_smash_unused_vtentry_relocs - PARAMS ((struct elf_link_hash_entry *h, PTR dummy)); + PARAMS ((struct elf_link_hash_entry *, PTR)); /* The mark phase of garbage collection. For a given section, mark it and any sections in this section's group, and all the sections @@ -7591,9 +7646,10 @@ static boolean elf_gc_mark (info, sec, gc_mark_hook) struct bfd_link_info *info; asection *sec; - asection * (*gc_mark_hook) - PARAMS ((asection *, struct bfd_link_info *, Elf_Internal_Rela *, - struct elf_link_hash_entry *, Elf_Internal_Sym *)); + asection * (*gc_mark_hook) PARAMS ((asection *, struct bfd_link_info *, + Elf_Internal_Rela *, + struct elf_link_hash_entry *, + Elf_Internal_Sym *)); { boolean ret; asection *group_sec; @@ -7705,9 +7761,8 @@ elf_gc_mark (info, sec, gc_mark_hook) static boolean elf_gc_sweep (info, gc_sweep_hook) struct bfd_link_info *info; - boolean (*gc_sweep_hook) - PARAMS ((bfd *abfd, struct bfd_link_info *info, asection *o, - const Elf_Internal_Rela *relocs)); + boolean (*gc_sweep_hook) PARAMS ((bfd *, struct bfd_link_info *, + asection *, const Elf_Internal_Rela *)); { bfd *sub; @@ -8422,7 +8477,12 @@ elf_bfd_discard_info (output_bfd, info) if (_bfd_elf_discard_section_eh_frame (abfd, info, eh, ehdr, elf_reloc_symbol_deleted_p, &cookie)) - ret = true; + { + /* Relocs have been edited. Ensure edited version is + used later in relocate_section. */ + elf_section_data (eh)->relocs = cookie.rels; + ret = true; + } if (cookie.rels && elf_section_data (eh)->relocs != cookie.rels) free (cookie.rels); } diff -Nurpa binutils-2.13/bfd/elfxx-ia64.c binutils-2.13.1/bfd/elfxx-ia64.c --- binutils-2.13/bfd/elfxx-ia64.c 2002-07-23 14:01:58.000000000 -0400 +++ binutils-2.13.1/bfd/elfxx-ia64.c 2002-10-11 04:56:14.000000000 -0400 @@ -211,7 +211,8 @@ static struct bfd_hash_entry *elfNN_ia64 PARAMS ((struct bfd_hash_entry *entry, struct bfd_hash_table *table, const char *string)); static void elfNN_ia64_hash_copy_indirect - PARAMS ((struct elf_link_hash_entry *, struct elf_link_hash_entry *)); + PARAMS ((struct elf_backend_data *, struct elf_link_hash_entry *, + struct elf_link_hash_entry *)); static void elfNN_ia64_hash_hide_symbol PARAMS ((struct bfd_link_info *, struct elf_link_hash_entry *, boolean)); static struct bfd_link_hash_table *elfNN_ia64_hash_table_create @@ -650,13 +651,14 @@ static const bfd_byte plt_full_entry[PLT not support brl, and so it gets emulated by the kernel. */ #undef USE_BRL +#ifdef USE_BRL static const bfd_byte oor_brl[16] = { 0x05, 0x00, 0x00, 0x00, 0x01, 0x00, /* [MLX] nop.m 0 */ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, /* brl.sptk.few tgt;; */ 0x00, 0x00, 0x00, 0xc0 }; - +#else static const bfd_byte oor_ip[48] = { 0x04, 0x00, 0x00, 0x00, 0x01, 0x00, /* [MLX] nop.m 0 */ @@ -669,6 +671,7 @@ static const bfd_byte oor_ip[48] = 0x60, 0x80, 0x04, 0x80, 0x03, 0x00, /* mov b6=r16 */ 0x60, 0x00, 0x80, 0x00 /* br b6;; */ }; +#endif /* These functions do relaxation for IA-64 ELF. @@ -1270,6 +1273,7 @@ elfNN_ia64_aix_add_symbol_hook (abfd, in { struct elf_backend_data *bed; struct elfNN_ia64_link_hash_table *ia64_info; + struct bfd_link_hash_entry *bh = NULL; bed = get_elf_backend_data (abfd); ia64_info = elfNN_ia64_hash_table (info); @@ -1278,9 +1282,10 @@ elfNN_ia64_aix_add_symbol_hook (abfd, in (info, abfd, *namep, BSF_GLOBAL, bfd_get_section_by_name (abfd, ".bss"), bed->got_symbol_offset, (const char *) NULL, false, - bed->collect, (struct bfd_link_hash_entry **) &h))) + bed->collect, &bh))) return false; + h = (struct elf_link_hash_entry *) bh; h->elf_link_hash_flags |= ELF_LINK_HASH_DEF_REGULAR; h->type = STT_OBJECT; @@ -1593,7 +1598,8 @@ elfNN_ia64_new_elf_hash_entry (entry, ta } static void -elfNN_ia64_hash_copy_indirect (xdir, xind) +elfNN_ia64_hash_copy_indirect (bed, xdir, xind) + struct elf_backend_data *bed ATTRIBUTE_UNUSED; struct elf_link_hash_entry *xdir, *xind; { struct elfNN_ia64_link_hash_entry *dir, *ind; diff -Nurpa binutils-2.13/bfd/elfxx-mips.c binutils-2.13.1/bfd/elfxx-mips.c --- binutils-2.13/bfd/elfxx-mips.c 2002-07-30 14:19:42.000000000 -0400 +++ binutils-2.13.1/bfd/elfxx-mips.c 2002-10-28 13:45:45.000000000 -0500 @@ -1446,15 +1446,18 @@ mips_elf_global_got_index (abfd, h) bfd_vma index; asection *sgot; struct mips_got_info *g; + long global_got_dynindx = 0; g = mips_elf_got_info (abfd, &sgot); + if (g->global_gotsym != NULL) + global_got_dynindx = g->global_gotsym->dynindx; /* Once we determine the global GOT entry with the lowest dynamic symbol table index, we must put all dynamic symbols with greater indices into the GOT. That makes it easy to calculate the GOT offset. */ - BFD_ASSERT (h->dynindx >= g->global_gotsym->dynindx); - index = ((h->dynindx - g->global_gotsym->dynindx + g->local_gotno) + BFD_ASSERT (h->dynindx >= global_got_dynindx); + index = ((h->dynindx - global_got_dynindx + g->local_gotno) * MIPS_ELF_GOT_SIZE (abfd)); BFD_ASSERT (index < sgot->_raw_size); @@ -1897,6 +1900,7 @@ mips_elf_create_got_section (abfd, info) flagword flags; register asection *s; struct elf_link_hash_entry *h; + struct bfd_link_hash_entry *bh; struct mips_got_info *g; bfd_size_type amt; @@ -1916,13 +1920,14 @@ mips_elf_create_got_section (abfd, info) /* Define the symbol _GLOBAL_OFFSET_TABLE_. We don't do this in the linker script because we don't want to define the symbol if we are not creating a global offset table. */ - h = NULL; + bh = NULL; if (! (_bfd_generic_link_add_one_symbol (info, abfd, "_GLOBAL_OFFSET_TABLE_", BSF_GLOBAL, s, (bfd_vma) 0, (const char *) NULL, false, - get_elf_backend_data (abfd)->collect, - (struct bfd_link_hash_entry **) &h))) + get_elf_backend_data (abfd)->collect, &bh))) return false; + + h = (struct elf_link_hash_entry *) bh; h->elf_link_hash_flags &= ~ELF_LINK_NON_ELF; h->elf_link_hash_flags |= ELF_LINK_HASH_DEF_REGULAR; h->type = STT_OBJECT; @@ -2932,7 +2937,12 @@ mips_elf_create_dynamic_relocation (outp /* The relocation is always an REL32 relocation because we don't know where the shared library will wind up at load-time. */ - outrel[0].r_info = ELF_R_INFO (output_bfd, indx, R_MIPS_REL32); + outrel[0].r_info = ELF_R_INFO (output_bfd, (unsigned long) indx, + R_MIPS_REL32); + outrel[1].r_info = ELF_R_INFO (output_bfd, (unsigned long) 0, + R_MIPS_NONE); + outrel[2].r_info = ELF_R_INFO (output_bfd, (unsigned long) 0, + R_MIPS_NONE); /* Adjust the output offset of the relocation to reference the correct location in the output file. */ @@ -3811,15 +3821,17 @@ _bfd_mips_elf_add_symbol_hook (abfd, inf && strcmp (*namep, "__rld_obj_head") == 0) { struct elf_link_hash_entry *h; + struct bfd_link_hash_entry *bh; /* Mark __rld_obj_head as dynamic. */ - h = NULL; + bh = NULL; if (! (_bfd_generic_link_add_one_symbol (info, abfd, *namep, BSF_GLOBAL, *secp, (bfd_vma) *valp, (const char *) NULL, false, - get_elf_backend_data (abfd)->collect, - (struct bfd_link_hash_entry **) &h))) + get_elf_backend_data (abfd)->collect, &bh))) return false; + + h = (struct elf_link_hash_entry *) bh; h->elf_link_hash_flags &= ~ELF_LINK_NON_ELF; h->elf_link_hash_flags |= ELF_LINK_HASH_DEF_REGULAR; h->type = STT_OBJECT; @@ -3875,6 +3887,7 @@ _bfd_mips_elf_create_dynamic_sections (a struct bfd_link_info *info; { struct elf_link_hash_entry *h; + struct bfd_link_hash_entry *bh; flagword flags; register asection *s; const char * const *namep; @@ -3933,13 +3946,14 @@ _bfd_mips_elf_create_dynamic_sections (a { for (namep = mips_elf_dynsym_rtproc_names; *namep != NULL; namep++) { - h = NULL; + bh = NULL; if (! (_bfd_generic_link_add_one_symbol (info, abfd, *namep, BSF_GLOBAL, bfd_und_section_ptr, (bfd_vma) 0, (const char *) NULL, false, - get_elf_backend_data (abfd)->collect, - (struct bfd_link_hash_entry **) &h))) + get_elf_backend_data (abfd)->collect, &bh))) return false; + + h = (struct elf_link_hash_entry *) bh; h->elf_link_hash_flags &= ~ELF_LINK_NON_ELF; h->elf_link_hash_flags |= ELF_LINK_HASH_DEF_REGULAR; h->type = STT_SECTION; @@ -3975,26 +3989,17 @@ _bfd_mips_elf_create_dynamic_sections (a if (!info->shared) { - h = NULL; - if (SGI_COMPAT (abfd)) - { - if (!(_bfd_generic_link_add_one_symbol - (info, abfd, "_DYNAMIC_LINK", BSF_GLOBAL, bfd_abs_section_ptr, - (bfd_vma) 0, (const char *) NULL, false, - get_elf_backend_data (abfd)->collect, - (struct bfd_link_hash_entry **) &h))) - return false; - } - else - { - /* For normal mips it is _DYNAMIC_LINKING. */ - if (!(_bfd_generic_link_add_one_symbol - (info, abfd, "_DYNAMIC_LINKING", BSF_GLOBAL, - bfd_abs_section_ptr, (bfd_vma) 0, (const char *) NULL, false, - get_elf_backend_data (abfd)->collect, - (struct bfd_link_hash_entry **) &h))) - return false; - } + const char *name; + + name = SGI_COMPAT (abfd) ? "_DYNAMIC_LINK" : "_DYNAMIC_LINKING"; + bh = NULL; + if (!(_bfd_generic_link_add_one_symbol + (info, abfd, name, BSF_GLOBAL, bfd_abs_section_ptr, + (bfd_vma) 0, (const char *) NULL, false, + get_elf_backend_data (abfd)->collect, &bh))) + return false; + + h = (struct elf_link_hash_entry *) bh; h->elf_link_hash_flags &= ~ELF_LINK_NON_ELF; h->elf_link_hash_flags |= ELF_LINK_HASH_DEF_REGULAR; h->type = STT_SECTION; @@ -4011,26 +4016,15 @@ _bfd_mips_elf_create_dynamic_sections (a s = bfd_get_section_by_name (abfd, ".rld_map"); BFD_ASSERT (s != NULL); - h = NULL; - if (SGI_COMPAT (abfd)) - { - if (!(_bfd_generic_link_add_one_symbol - (info, abfd, "__rld_map", BSF_GLOBAL, s, - (bfd_vma) 0, (const char *) NULL, false, - get_elf_backend_data (abfd)->collect, - (struct bfd_link_hash_entry **) &h))) - return false; - } - else - { - /* For normal mips the symbol is __RLD_MAP. */ - if (!(_bfd_generic_link_add_one_symbol - (info, abfd, "__RLD_MAP", BSF_GLOBAL, s, - (bfd_vma) 0, (const char *) NULL, false, - get_elf_backend_data (abfd)->collect, - (struct bfd_link_hash_entry **) &h))) - return false; - } + name = SGI_COMPAT (abfd) ? "__rld_map" : "__RLD_MAP"; + bh = NULL; + if (!(_bfd_generic_link_add_one_symbol + (info, abfd, name, BSF_GLOBAL, s, + (bfd_vma) 0, (const char *) NULL, false, + get_elf_backend_data (abfd)->collect, &bh))) + return false; + + h = (struct elf_link_hash_entry *) bh; h->elf_link_hash_flags &= ~ELF_LINK_NON_ELF; h->elf_link_hash_flags |= ELF_LINK_HASH_DEF_REGULAR; h->type = STT_OBJECT; @@ -6365,12 +6359,13 @@ _bfd_mips_elf_gc_sweep_hook (abfd, info, _bfd_elf_link_hash_copy_indirect copy the flags for us. */ void -_bfd_mips_elf_copy_indirect_symbol (dir, ind) +_bfd_mips_elf_copy_indirect_symbol (bed, dir, ind) + struct elf_backend_data *bed; struct elf_link_hash_entry *dir, *ind; { struct mips_elf_link_hash_entry *dirmips, *indmips; - _bfd_elf_link_hash_copy_indirect (dir, ind); + _bfd_elf_link_hash_copy_indirect (bed, dir, ind); if (ind->root.type != bfd_link_hash_indirect) return; diff -Nurpa binutils-2.13/bfd/elfxx-mips.h binutils-2.13.1/bfd/elfxx-mips.h --- binutils-2.13/bfd/elfxx-mips.h 2002-07-01 04:06:47.000000000 -0400 +++ binutils-2.13.1/bfd/elfxx-mips.h 2002-08-21 21:34:16.000000000 -0400 @@ -68,7 +68,8 @@ extern boolean _bfd_mips_elf_gc_sweep_ho PARAMS ((bfd *, struct bfd_link_info *, asection *, const Elf_Internal_Rela *)); extern void _bfd_mips_elf_copy_indirect_symbol - PARAMS ((struct elf_link_hash_entry *, struct elf_link_hash_entry *)); + PARAMS ((struct elf_backend_data *, struct elf_link_hash_entry *, + struct elf_link_hash_entry *)); extern void _bfd_mips_elf_hide_symbol PARAMS ((struct bfd_link_info *, struct elf_link_hash_entry *, boolean)); extern boolean _bfd_mips_elf_ignore_discarded_relocs diff -Nurpa binutils-2.13/bfd/elfxx-target.h binutils-2.13.1/bfd/elfxx-target.h --- binutils-2.13/bfd/elfxx-target.h 2002-07-23 14:01:58.000000000 -0400 +++ binutils-2.13.1/bfd/elfxx-target.h 2002-11-07 15:42:11.000000000 -0500 @@ -385,15 +385,6 @@ Foundation, Inc., 59 Temple Place - Suit #ifndef elf_backend_write_section #define elf_backend_write_section NULL #endif -#ifndef elf_backend_set_nonloadable_filepos -#define elf_backend_set_nonloadable_filepos NULL -#endif -#ifndef elf_backend_is_contained_by_filepos -#define elf_backend_is_contained_by_filepos NULL -#endif -#ifndef elf_backend_copy_private_bfd_data_p -#define elf_backend_copy_private_bfd_data_p NULL -#endif #ifndef elf_backend_mips_irix_compat #define elf_backend_mips_irix_compat NULL #endif @@ -495,9 +486,6 @@ static const struct elf_backend_data elf elf_backend_discard_info, elf_backend_ignore_discarded_relocs, elf_backend_write_section, - elf_backend_set_nonloadable_filepos, - elf_backend_is_contained_by_filepos, - elf_backend_copy_private_bfd_data_p, elf_backend_mips_irix_compat, elf_backend_mips_rtype_to_howto, elf_backend_ecoff_debug_swap, diff -Nurpa binutils-2.13/bfd/format.c binutils-2.13.1/bfd/format.c --- binutils-2.13/bfd/format.c 2002-06-25 02:21:54.000000000 -0400 +++ binutils-2.13.1/bfd/format.c 2002-10-28 13:45:45.000000000 -0500 @@ -132,7 +132,7 @@ bfd_check_format_matches (abfd, format, } if (abfd->format != bfd_unknown) - return abfd->format == format; + return (boolean) (abfd->format == format); /* Since the target type was defaulted, check them all in the hope that one will be uniquely recognized. */ @@ -355,7 +355,7 @@ bfd_set_format (abfd, format) } if (abfd->format != bfd_unknown) - return abfd->format == format; + return (boolean) (abfd->format == format); /* Presume the answer is yes. */ abfd->format = format; diff -Nurpa binutils-2.13/bfd/gen-aout.c binutils-2.13.1/bfd/gen-aout.c --- binutils-2.13/bfd/gen-aout.c 2001-10-02 01:58:41.000000000 -0400 +++ binutils-2.13.1/bfd/gen-aout.c 2002-10-28 13:45:45.000000000 -0500 @@ -21,6 +21,10 @@ Foundation, Inc., 59 Temple Place - Suit #include "/usr/include/a.out.h" #include +#ifndef _ +#define _(X) X +#endif + int main (argc, argv) int argc; char** argv; diff -Nurpa binutils-2.13/bfd/ieee.c binutils-2.13.1/bfd/ieee.c --- binutils-2.13/bfd/ieee.c 2002-06-25 02:21:54.000000000 -0400 +++ binutils-2.13.1/bfd/ieee.c 2002-09-23 18:12:41.000000000 -0400 @@ -1414,7 +1414,7 @@ ieee_archive_p (abfd) abfd->tdata.ieee_ar_data = (ieee_ar_data_type *) bfd_alloc (abfd, amt); if (!abfd->tdata.ieee_ar_data) - goto error_return; + goto error_ret_restore; ieee = IEEE_AR_DATA (abfd); /* Ignore the return value here. It doesn't matter if we don't read @@ -1530,13 +1530,13 @@ ieee_archive_p (abfd) return abfd->xvec; got_wrong_format_error: - bfd_release (abfd, ieee); - abfd->tdata.ieee_ar_data = save; bfd_set_error (bfd_error_wrong_format); - error_return: if (elts != NULL) free (elts); + bfd_release (abfd, ieee); + error_ret_restore: + abfd->tdata.ieee_ar_data = save; return NULL; } @@ -1732,7 +1732,7 @@ ieee_object_p (abfd) got_wrong_format: bfd_set_error (bfd_error_wrong_format); fail: - (void) bfd_release (abfd, ieee); + bfd_release (abfd, ieee); abfd->tdata.ieee_data = save; return (const bfd_target *) NULL; } diff -Nurpa binutils-2.13/bfd/ihex.c binutils-2.13.1/bfd/ihex.c --- binutils-2.13/bfd/ihex.c 2002-06-04 23:43:10.000000000 -0400 +++ binutils-2.13.1/bfd/ihex.c 2002-09-23 18:12:41.000000000 -0400 @@ -193,19 +193,16 @@ static boolean ihex_mkobject (abfd) bfd *abfd; { - if (abfd->tdata.ihex_data == NULL) - { - struct ihex_data_struct *tdata; - bfd_size_type amt = sizeof (struct ihex_data_struct); + struct ihex_data_struct *tdata; + bfd_size_type amt = sizeof (struct ihex_data_struct); - tdata = (struct ihex_data_struct *) bfd_alloc (abfd, amt); - if (tdata == NULL) - return false; - abfd->tdata.ihex_data = tdata; - tdata->head = NULL; - tdata->tail = NULL; - } + tdata = (struct ihex_data_struct *) bfd_alloc (abfd, amt); + if (tdata == NULL) + return false; + abfd->tdata.ihex_data = tdata; + tdata->head = NULL; + tdata->tail = NULL; return true; } @@ -513,6 +510,7 @@ static const bfd_target * ihex_object_p (abfd) bfd *abfd; { + PTR tdata_save; bfd_byte b[9]; unsigned int i; unsigned int type; @@ -551,9 +549,14 @@ ihex_object_p (abfd) } /* OK, it looks like it really is an Intel Hex file. */ - if (! ihex_mkobject (abfd) - || ! ihex_scan (abfd)) - return NULL; + tdata_save = abfd->tdata.any; + if (! ihex_mkobject (abfd) || ! ihex_scan (abfd)) + { + if (abfd->tdata.any != tdata_save && abfd->tdata.any != NULL) + bfd_release (abfd, abfd->tdata.any); + abfd->tdata.any = tdata_save; + return NULL; + } return abfd->xvec; } diff -Nurpa binutils-2.13/bfd/libbfd.c binutils-2.13.1/bfd/libbfd.c --- binutils-2.13/bfd/libbfd.c 2002-06-25 02:21:54.000000000 -0400 +++ binutils-2.13.1/bfd/libbfd.c 2002-10-28 13:45:45.000000000 -0500 @@ -186,9 +186,9 @@ bfd_realloc (ptr, size) } if (ptr == NULL) - ret = malloc ((size_t) size); + ret = (PTR) malloc ((size_t) size); else - ret = realloc (ptr, (size_t) size); + ret = (PTR) realloc (ptr, (size_t) size); if (ret == NULL && (size_t) size != 0) bfd_set_error (bfd_error_no_memory); @@ -562,7 +562,7 @@ bfd_bwrite (ptr, size, abfd) newsize = (bim->size + 127) & ~(bfd_size_type) 127; if (newsize > oldsize) { - bim->buffer = bfd_realloc (bim->buffer, newsize); + bim->buffer = (bfd_byte *) bfd_realloc (bim->buffer, newsize); if (bim->buffer == 0) { bim->size = 0; @@ -608,7 +608,7 @@ bfd_write_bigendian_4byte_int (abfd, i) { bfd_byte buffer[4]; bfd_putb32 ((bfd_vma) i, buffer); - return bfd_bwrite ((PTR) buffer, (bfd_size_type) 4, abfd) == 4; + return (boolean) (bfd_bwrite ((PTR) buffer, (bfd_size_type) 4, abfd) == 4); } bfd_vma @@ -706,7 +706,7 @@ bfd_seek (abfd, position, direction) newsize = (bim->size + 127) & ~(bfd_size_type) 127; if (newsize > oldsize) { - bim->buffer = bfd_realloc (bim->buffer, newsize); + bim->buffer = (bfd_byte *) bfd_realloc (bim->buffer, newsize); if (bim->buffer == 0) { bim->size = 0; @@ -1414,7 +1414,7 @@ bfd_generic_is_local_label_name (abfd, n { char locals_prefix = (bfd_get_symbol_leading_char (abfd) == '_') ? 'L' : '.'; - return (name[0] == locals_prefix); + return (boolean) (name[0] == locals_prefix); } /* Can be used from / for bfd_merge_private_bfd_data to check that diff -Nurpa binutils-2.13/bfd/libbfd.h binutils-2.13.1/bfd/libbfd.h --- binutils-2.13/bfd/libbfd.h 2002-06-22 22:09:04.000000000 -0400 +++ binutils-2.13.1/bfd/libbfd.h 2002-09-23 18:12:41.000000000 -0400 @@ -799,6 +799,9 @@ static const char *const bfd_reloc_code_ "BFD_RELOC_386_RELATIVE", "BFD_RELOC_386_GOTOFF", "BFD_RELOC_386_GOTPC", + "BFD_RELOC_386_TLS_TPOFF", + "BFD_RELOC_386_TLS_IE", + "BFD_RELOC_386_TLS_GOTIE", "BFD_RELOC_386_TLS_LE", "BFD_RELOC_386_TLS_GD", "BFD_RELOC_386_TLS_LDM", diff -Nurpa binutils-2.13/bfd/libcoff.h binutils-2.13.1/bfd/libcoff.h --- binutils-2.13/bfd/libcoff.h 2002-06-04 23:43:11.000000000 -0400 +++ binutils-2.13.1/bfd/libcoff.h 2002-10-28 13:45:45.000000000 -0500 @@ -784,7 +784,7 @@ typedef struct struct coff_link_hash_entry *, struct internal_syment *, bfd_vma *)); - boolean (*_bfd_coff_adjust_symndx)\ + boolean (*_bfd_coff_adjust_symndx) PARAMS ((bfd *, struct bfd_link_info *, bfd *, asection *, struct internal_reloc *, boolean *)); diff -Nurpa binutils-2.13/bfd/linker.c binutils-2.13.1/bfd/linker.c --- binutils-2.13/bfd/linker.c 2002-06-25 05:40:44.000000000 -0400 +++ binutils-2.13.1/bfd/linker.c 2002-10-28 13:45:45.000000000 -0500 @@ -449,7 +449,8 @@ _bfd_link_hash_newfunc (entry, table, st subclass. */ if (entry == NULL) { - entry = bfd_hash_allocate (table, sizeof (struct bfd_link_hash_entry)); + entry = (struct bfd_hash_entry *) + bfd_hash_allocate (table, sizeof (struct bfd_link_hash_entry)); if (entry == NULL) return entry; } @@ -645,8 +646,8 @@ _bfd_generic_link_hash_newfunc (entry, t subclass. */ if (entry == NULL) { - entry = bfd_hash_allocate (table, - sizeof (struct generic_link_hash_entry)); + entry = (struct bfd_hash_entry *) + bfd_hash_allocate (table, sizeof (struct generic_link_hash_entry)); if (entry == NULL) return entry; } @@ -1305,6 +1306,7 @@ generic_link_add_symbol_list (abfd, info const char *name; const char *string; struct generic_link_hash_entry *h; + struct bfd_link_hash_entry *bh; name = bfd_asymbol_name (p); if (((p->flags & BSF_INDIRECT) != 0 @@ -1326,12 +1328,12 @@ generic_link_add_symbol_list (abfd, info else string = NULL; - h = NULL; + bh = NULL; if (! (_bfd_generic_link_add_one_symbol (info, abfd, name, p->flags, bfd_get_section (p), - p->value, string, false, collect, - (struct bfd_link_hash_entry **) &h))) + p->value, string, false, collect, &bh))) return false; + h = (struct generic_link_hash_entry *) bh; /* If this is a constructor symbol, and the linker didn't do anything with it, then we want to just pass the symbol @@ -2018,7 +2020,7 @@ _bfd_generic_final_link (abfd, info) for (o = abfd->sections; o != NULL; o = o->next) for (p = o->link_order_head; p != NULL; p = p->next) if (p->type == bfd_indirect_link_order) - p->u.indirect.section->linker_mark = true; + p->u.indirect.section->linker_mark = (unsigned int) true; /* Build the output symbol table. */ for (sub = info->input_bfds; sub != (bfd *) NULL; sub = sub->link_next) diff -Nurpa binutils-2.13/bfd/merge.c binutils-2.13.1/bfd/merge.c --- binutils-2.13/bfd/merge.c 2002-07-09 19:47:22.000000000 -0400 +++ binutils-2.13.1/bfd/merge.c 2002-10-28 13:45:45.000000000 -0500 @@ -353,7 +353,7 @@ sec_merge_emit (abfd, entry) if (alignment_power) free (pad); - return entry == NULL || entry->secinfo != secinfo; + return (boolean) (entry == NULL || entry->secinfo != secinfo); } /* This function is called for each input file from the add_symbols @@ -667,7 +667,7 @@ merge_strings (sinfo) break; if (e->len > 4 * e->u.entsize) { - s = e->root.string + e->len - e->u.entsize; + s = (const unsigned char *) (e->root.string + e->len - e->u.entsize); hash = 0; for (i = 0; i < 4 * e->u.entsize; i++) { @@ -690,7 +690,7 @@ merge_strings (sinfo) else *p = (PTR) e; } - s = e->root.string + e->len - e->u.entsize; + s = (const unsigned char *) (e->root.string + e->len - e->u.entsize); hash = 0; for (i = 0; i < e->u.entsize; i++) { diff -Nurpa binutils-2.13/bfd/peicode.h binutils-2.13.1/bfd/peicode.h --- binutils-2.13/bfd/peicode.h 2002-06-25 02:21:54.000000000 -0400 +++ binutils-2.13.1/bfd/peicode.h 2002-09-23 18:12:41.000000000 -0400 @@ -1207,7 +1207,10 @@ _("%s: Recognised but unhandled machine return NULL; if (bfd_bread (ptr, size, abfd) != size) - return NULL; + { + bfd_release (abfd, ptr); + return NULL; + } symbol_name = ptr; source_dll = ptr + strlen (ptr) + 1; @@ -1219,14 +1222,17 @@ _("%s: Recognised but unhandled machine (_("%s: string not null terminated in ILF object file."), bfd_archive_filename (abfd)); bfd_set_error (bfd_error_malformed_archive); - + bfd_release (abfd, ptr); return NULL; } /* Now construct the bfd. */ if (! pe_ILF_build_a_bfd (abfd, magic, symbol_name, source_dll, ordinal, types)) - return NULL; + { + bfd_release (abfd, ptr); + return NULL; + } return abfd->xvec; } diff -Nurpa binutils-2.13/bfd/po/SRC-POTFILES.in binutils-2.13.1/bfd/po/SRC-POTFILES.in --- binutils-2.13/bfd/po/SRC-POTFILES.in 2002-07-01 04:31:53.000000000 -0400 +++ binutils-2.13.1/bfd/po/SRC-POTFILES.in 2002-10-30 11:29:41.000000000 -0500 @@ -134,6 +134,7 @@ elf32-h8300.c elf32-hppa.c elf32-hppa.h elf32-i370.c +elf32-i386-fbsd.c elf32-i386.c elf32-i386qnx.c elf32-i860.c @@ -161,6 +162,7 @@ elf32-v850.c elf32-vax.c elf32-xstormy16.c elf32.c +elf64-alpha-fbsd.c elf64-alpha.c elf64-gen.c elf64-hppa.c diff -Nurpa binutils-2.13/bfd/po/bfd.pot binutils-2.13.1/bfd/po/bfd.pot --- binutils-2.13/bfd/po/bfd.pot 2002-07-23 16:17:48.000000000 -0400 +++ binutils-2.13.1/bfd/po/bfd.pot 2002-10-30 11:29:41.000000000 -0500 @@ -1,12 +1,13 @@ # SOME DESCRIPTIVE TITLE. -# Copyright (C) YEAR Free Software Foundation, Inc. +# Copyright (C) YEAR THE PACKAGE'S COPYRIGHT HOLDER +# This file is distributed under the same license as the PACKAGE package. # FIRST AUTHOR , YEAR. # #, fuzzy msgid "" msgstr "" "Project-Id-Version: PACKAGE VERSION\n" -"POT-Creation-Date: 2002-07-23 15:55-0400\n" +"POT-Creation-Date: 2002-10-30 10:06-0500\n" "PO-Revision-Date: YEAR-MO-DA HO:MI+ZONE\n" "Last-Translator: FULL NAME \n" "Language-Team: LANGUAGE \n" @@ -54,115 +55,115 @@ msgstr "" msgid "%s: relocateable link from %s to %s not supported" msgstr "" -#: archive.c:1826 +#: archive.c:1818 msgid "Warning: writing archive was slow: rewriting timestamp\n" msgstr "" -#: archive.c:2093 +#: archive.c:2085 msgid "Reading archive file mod timestamp" msgstr "" #. FIXME: bfd can't call perror. -#: archive.c:2120 +#: archive.c:2112 msgid "Writing updated armap timestamp" msgstr "" -#: bfd.c:274 +#: bfd.c:277 msgid "No error" msgstr "" -#: bfd.c:275 +#: bfd.c:278 msgid "System call error" msgstr "" -#: bfd.c:276 +#: bfd.c:279 msgid "Invalid bfd target" msgstr "" -#: bfd.c:277 +#: bfd.c:280 msgid "File in wrong format" msgstr "" -#: bfd.c:278 +#: bfd.c:281 msgid "Archive object file in wrong format" msgstr "" -#: bfd.c:279 +#: bfd.c:282 msgid "Invalid operation" msgstr "" -#: bfd.c:280 +#: bfd.c:283 msgid "Memory exhausted" msgstr "" -#: bfd.c:281 +#: bfd.c:284 msgid "No symbols" msgstr "" -#: bfd.c:282 +#: bfd.c:285 msgid "Archive has no index; run ranlib to add one" msgstr "" -#: bfd.c:283 +#: bfd.c:286 msgid "No more archived files" msgstr "" -#: bfd.c:284 +#: bfd.c:287 msgid "Malformed archive" msgstr "" -#: bfd.c:285 +#: bfd.c:288 msgid "File format not recognized" msgstr "" -#: bfd.c:286 +#: bfd.c:289 msgid "File format is ambiguous" msgstr "" -#: bfd.c:287 +#: bfd.c:290 msgid "Section has no contents" msgstr "" -#: bfd.c:288 +#: bfd.c:291 msgid "Nonrepresentable section on output" msgstr "" -#: bfd.c:289 +#: bfd.c:292 msgid "Symbol needs debug section which does not exist" msgstr "" -#: bfd.c:290 +#: bfd.c:293 msgid "Bad value" msgstr "" -#: bfd.c:291 +#: bfd.c:294 msgid "File truncated" msgstr "" -#: bfd.c:292 +#: bfd.c:295 msgid "File too big" msgstr "" -#: bfd.c:293 +#: bfd.c:296 msgid "#" msgstr "" -#: bfd.c:700 +#: bfd.c:703 #, c-format msgid "BFD %s assertion fail %s:%d" msgstr "" -#: bfd.c:719 +#: bfd.c:722 #, c-format msgid "BFD %s internal error, aborting at %s line %d in %s\n" msgstr "" -#: bfd.c:723 +#: bfd.c:726 #, c-format msgid "BFD %s internal error, aborting at %s line %d\n" msgstr "" -#: bfd.c:725 +#: bfd.c:728 msgid "Please report this bug.\n" msgstr "" @@ -209,17 +210,17 @@ msgstr "" msgid "%s: unable to find ARM glue '%s' for `%s'" msgstr "" -#: coff-arm.c:1391 coff-arm.c:1486 elf32-arm.h:887 elf32-arm.h:991 +#: coff-arm.c:1391 coff-arm.c:1486 elf32-arm.h:888 elf32-arm.h:992 #, c-format msgid "%s(%s): warning: interworking not enabled." msgstr "" -#: coff-arm.c:1395 elf32-arm.h:994 +#: coff-arm.c:1395 elf32-arm.h:995 #, c-format msgid " first occurrence: %s: arm call to thumb" msgstr "" -#: coff-arm.c:1490 elf32-arm.h:890 +#: coff-arm.c:1490 elf32-arm.h:891 #, c-format msgid " first occurrence: %s: thumb call to arm" msgstr "" @@ -228,100 +229,100 @@ msgstr "" msgid " consider relinking with --support-old-code enabled" msgstr "" -#: coff-arm.c:1785 coff-tic80.c:686 cofflink.c:3031 +#: coff-arm.c:1785 coff-tic80.c:686 cofflink.c:3034 #, c-format msgid "%s: bad reloc address 0x%lx in section `%s'" msgstr "" -#: coff-arm.c:2127 +#: coff-arm.c:2129 #, c-format msgid "%s: illegal symbol index in reloc: %d" msgstr "" -#: coff-arm.c:2255 +#: coff-arm.c:2257 #, c-format msgid "ERROR: %s is compiled for APCS-%d, whereas %s is compiled for APCS-%d" msgstr "" -#: coff-arm.c:2270 elf32-arm.h:2297 +#: coff-arm.c:2272 elf32-arm.h:2298 #, c-format msgid "" "ERROR: %s passes floats in float registers, whereas %s passes them in " "integer registers" msgstr "" -#: coff-arm.c:2273 elf32-arm.h:2302 +#: coff-arm.c:2275 elf32-arm.h:2303 #, c-format msgid "" "ERROR: %s passes floats in integer registers, whereas %s passes them in " "float registers" msgstr "" -#: coff-arm.c:2288 +#: coff-arm.c:2290 #, c-format msgid "" "ERROR: %s is compiled as position independent code, whereas target %s is " "absolute position" msgstr "" -#: coff-arm.c:2291 +#: coff-arm.c:2293 #, c-format msgid "" "ERROR: %s is compiled as absolute position code, whereas target %s is " "position independent" msgstr "" -#: coff-arm.c:2320 elf32-arm.h:2358 +#: coff-arm.c:2322 elf32-arm.h:2359 #, c-format msgid "Warning: %s supports interworking, whereas %s does not" msgstr "" -#: coff-arm.c:2323 elf32-arm.h:2365 +#: coff-arm.c:2325 elf32-arm.h:2366 #, c-format msgid "Warning: %s does not support interworking, whereas %s does" msgstr "" -#: coff-arm.c:2350 +#: coff-arm.c:2352 #, c-format msgid "private flags = %x:" msgstr "" -#: coff-arm.c:2358 elf32-arm.h:2418 +#: coff-arm.c:2360 elf32-arm.h:2419 msgid " [floats passed in float registers]" msgstr "" -#: coff-arm.c:2360 +#: coff-arm.c:2362 msgid " [floats passed in integer registers]" msgstr "" -#: coff-arm.c:2363 elf32-arm.h:2421 +#: coff-arm.c:2365 elf32-arm.h:2422 msgid " [position independent]" msgstr "" -#: coff-arm.c:2365 +#: coff-arm.c:2367 msgid " [absolute position]" msgstr "" -#: coff-arm.c:2369 +#: coff-arm.c:2371 msgid " [interworking flag not initialised]" msgstr "" -#: coff-arm.c:2371 +#: coff-arm.c:2373 msgid " [interworking supported]" msgstr "" -#: coff-arm.c:2373 +#: coff-arm.c:2375 msgid " [interworking not supported]" msgstr "" -#: coff-arm.c:2421 elf32-arm.h:2124 +#: coff-arm.c:2423 elf32-arm.h:2125 #, c-format msgid "" "Warning: Not setting interworking flag of %s since it has already been " "specified as non-interworking" msgstr "" -#: coff-arm.c:2425 elf32-arm.h:2128 +#: coff-arm.c:2427 elf32-arm.h:2129 #, c-format msgid "Warning: Clearing the interworking flag of %s due to outside request" msgstr "" @@ -348,17 +349,17 @@ msgstr "" msgid "reloc not properly aligned" msgstr "" -#: coff-rs6000.c:2766 +#: coff-rs6000.c:2760 #, c-format msgid "%s: unsupported relocation type 0x%02x" msgstr "" -#: coff-rs6000.c:2859 +#: coff-rs6000.c:2853 #, c-format msgid "%s: TOC reloc at 0x%x to symbol `%s' with no TOC entry" msgstr "" -#: coff-rs6000.c:3590 coff64-rs6000.c:2091 +#: coff-rs6000.c:3586 coff64-rs6000.c:2080 #, c-format msgid "%s: symbol `%s' has unrecognized smclas %d" msgstr "" @@ -368,7 +369,7 @@ msgstr "" msgid "Unrecognized reloc type 0x%x" msgstr "" -#: coff-tic54x.c:390 coffcode.h:4974 +#: coff-tic54x.c:390 coffcode.h:4981 #, c-format msgid "%s: warning: illegal symbol index %ld in relocs" msgstr "" @@ -388,52 +389,52 @@ msgstr "" msgid "Unrecognized TI COFF target id '0x%x'" msgstr "" -#: coffcode.h:4365 +#: coffcode.h:4372 #, c-format msgid "%s: warning: illegal symbol index %ld in line numbers" msgstr "" -#: coffcode.h:4379 +#: coffcode.h:4386 #, c-format msgid "%s: warning: duplicate line number information for `%s'" msgstr "" -#: coffcode.h:4736 +#: coffcode.h:4743 #, c-format msgid "%s: Unrecognized storage class %d for %s symbol `%s'" msgstr "" -#: coffcode.h:4867 +#: coffcode.h:4874 #, c-format msgid "warning: %s: local symbol `%s' has no section" msgstr "" -#: coffcode.h:5012 +#: coffcode.h:5019 #, c-format msgid "%s: illegal relocation type %d at address 0x%lx" msgstr "" -#: coffgen.c:1661 +#: coffgen.c:1668 #, c-format msgid "%s: bad string table size %lu" msgstr "" -#: cofflink.c:534 elflink.h:1912 +#: cofflink.c:534 elflink.h:1930 #, c-format msgid "Warning: type of symbol `%s' changed from %d to %d in %s" msgstr "" -#: cofflink.c:2321 +#: cofflink.c:2324 #, c-format msgid "%s: relocs in section `%s', but it has no contents" msgstr "" -#: cofflink.c:2664 coffswap.h:877 +#: cofflink.c:2667 coffswap.h:877 #, c-format msgid "%s: %s: reloc overflow: 0x%lx > 0xffff" msgstr "" -#: cofflink.c:2673 coffswap.h:864 +#: cofflink.c:2676 coffswap.h:864 #, c-format msgid "%s: warning: %s: line number overflow: 0x%lx > 0xffff" msgstr "" @@ -460,144 +461,144 @@ msgid "" "(%lu)." msgstr "" -#: dwarf2.c:757 +#: dwarf2.c:760 #, c-format msgid "Dwarf Error: Invalid or unhandled FORM value: %u." msgstr "" -#: dwarf2.c:852 +#: dwarf2.c:924 msgid "Dwarf Error: mangled line number section (bad file number)." msgstr "" -#: dwarf2.c:938 +#: dwarf2.c:1016 msgid "Dwarf Error: Can't find .debug_line section." msgstr "" -#: dwarf2.c:961 +#: dwarf2.c:1039 #, c-format msgid "" "Dwarf Error: Line offset (%lu) greater than or equal to .debug_line size (%" "lu)." msgstr "" -#: dwarf2.c:1159 +#: dwarf2.c:1245 msgid "Dwarf Error: mangled line number section." msgstr "" -#: dwarf2.c:1355 dwarf2.c:1566 +#: dwarf2.c:1454 dwarf2.c:1665 #, c-format msgid "Dwarf Error: Could not find abbrev number %u." msgstr "" -#: dwarf2.c:1527 +#: dwarf2.c:1626 #, c-format msgid "" "Dwarf Error: found dwarf version '%u', this reader only handles version 2 " "information." msgstr "" -#: dwarf2.c:1534 +#: dwarf2.c:1633 #, c-format msgid "" "Dwarf Error: found address size '%u', this reader can not handle sizes " "greater than '%u'." msgstr "" -#: dwarf2.c:1557 +#: dwarf2.c:1656 #, c-format msgid "Dwarf Error: Bad abbrev number: %u." msgstr "" -#: ecoff.c:1318 +#: ecoff.c:1320 #, c-format msgid "Unknown basic type %d" msgstr "" -#: ecoff.c:1578 +#: ecoff.c:1580 #, c-format msgid "" "\n" " End+1 symbol: %ld" msgstr "" -#: ecoff.c:1585 ecoff.c:1588 +#: ecoff.c:1587 ecoff.c:1590 #, c-format msgid "" "\n" " First symbol: %ld" msgstr "" -#: ecoff.c:1600 +#: ecoff.c:1602 #, c-format msgid "" "\n" " End+1 symbol: %-7ld Type: %s" msgstr "" -#: ecoff.c:1607 +#: ecoff.c:1609 #, c-format msgid "" "\n" " Local symbol: %ld" msgstr "" -#: ecoff.c:1615 +#: ecoff.c:1617 #, c-format msgid "" "\n" " struct; End+1 symbol: %ld" msgstr "" -#: ecoff.c:1620 +#: ecoff.c:1622 #, c-format msgid "" "\n" " union; End+1 symbol: %ld" msgstr "" -#: ecoff.c:1625 +#: ecoff.c:1627 #, c-format msgid "" "\n" " enum; End+1 symbol: %ld" msgstr "" -#: ecoff.c:1631 +#: ecoff.c:1633 #, c-format msgid "" "\n" " Type: %s" msgstr "" -#: elf-hppa.h:1476 elf-hppa.h:1509 elf32-ppc.c:3091 elf32-sh.c:4213 +#: elf-hppa.h:1476 elf-hppa.h:1509 elf32-ppc.c:3091 elf32-sh.c:4537 #: elf64-sh64.c:1659 #, c-format msgid "" "%s: warning: unresolvable relocation against symbol `%s' from %s section" msgstr "" -#: elf-m10200.c:446 elf-m10300.c:656 elf32-arm.h:2084 elf32-avr.c:833 +#: elf-m10200.c:446 elf-m10300.c:656 elf32-arm.h:2085 elf32-avr.c:833 #: elf32-cris.c:1403 elf32-d10v.c:481 elf32-fr30.c:635 elf32-frv.c:809 -#: elf32-h8300.c:548 elf32-i860.c:1031 elf32-m32r.c:1278 elf32-openrisc.c:439 +#: elf32-h8300.c:548 elf32-i860.c:1031 elf32-m32r.c:1280 elf32-openrisc.c:439 #: elf32-v850.c:1691 elf32-xstormy16.c:933 elf64-mmix.c:1302 msgid "internal error: out of range error" msgstr "" -#: elf-m10200.c:450 elf-m10300.c:660 elf32-arm.h:2088 elf32-avr.c:837 +#: elf-m10200.c:450 elf-m10300.c:660 elf32-arm.h:2089 elf32-avr.c:837 #: elf32-cris.c:1407 elf32-d10v.c:485 elf32-fr30.c:639 elf32-frv.c:813 -#: elf32-h8300.c:552 elf32-i860.c:1035 elf32-m32r.c:1282 elf32-openrisc.c:443 -#: elf32-v850.c:1695 elf32-xstormy16.c:937 elf64-mmix.c:1306 elfxx-mips.c:5264 +#: elf32-h8300.c:552 elf32-i860.c:1035 elf32-m32r.c:1284 elf32-openrisc.c:443 +#: elf32-v850.c:1695 elf32-xstormy16.c:937 elf64-mmix.c:1306 elfxx-mips.c:5258 msgid "internal error: unsupported relocation error" msgstr "" -#: elf-m10200.c:454 elf-m10300.c:664 elf32-arm.h:2092 elf32-d10v.c:489 -#: elf32-h8300.c:556 elf32-m32r.c:1286 +#: elf-m10200.c:454 elf-m10300.c:664 elf32-arm.h:2093 elf32-d10v.c:489 +#: elf32-h8300.c:556 elf32-m32r.c:1288 msgid "internal error: dangerous error" msgstr "" -#: elf-m10200.c:458 elf-m10300.c:668 elf32-arm.h:2096 elf32-avr.c:845 +#: elf-m10200.c:458 elf-m10300.c:668 elf32-arm.h:2097 elf32-avr.c:845 #: elf32-cris.c:1415 elf32-d10v.c:493 elf32-fr30.c:647 elf32-frv.c:821 -#: elf32-h8300.c:560 elf32-i860.c:1043 elf32-m32r.c:1290 elf32-openrisc.c:451 +#: elf32-h8300.c:560 elf32-i860.c:1043 elf32-m32r.c:1292 elf32-openrisc.c:451 #: elf32-v850.c:1715 elf32-xstormy16.c:945 elf64-mmix.c:1314 msgid "internal error: unknown error" msgstr "" @@ -646,177 +647,177 @@ msgstr "" msgid " required from %s:\n" msgstr "" -#: elf.c:1902 +#: elf.c:1904 #, c-format msgid "%s: invalid link %lu for reloc section %s (index %u)" msgstr "" -#: elf.c:3603 +#: elf.c:3619 #, c-format msgid "%s: Not enough room for program headers (allocated %u, need %u)" msgstr "" -#: elf.c:3708 +#: elf.c:3724 #, c-format msgid "%s: Not enough room for program headers, try linking with -N" msgstr "" -#: elf.c:3833 +#: elf.c:3849 #, c-format msgid "" "Error: First section in segment (%s) starts at 0x%x whereas the segment " "starts at 0x%x" msgstr "" -#: elf.c:4148 +#: elf.c:4164 #, c-format msgid "%s: warning: allocated section `%s' not in segment" msgstr "" -#: elf.c:4472 +#: elf.c:4488 #, c-format msgid "%s: symbol `%s' required but not present" msgstr "" -#: elf.c:4749 +#: elf.c:4765 #, c-format msgid "%s: warning: Empty loadable segment detected, is this intentional ?\n" msgstr "" -#: elf.c:6193 +#: elf.c:6213 #, c-format msgid "%s: unsupported relocation type %s" msgstr "" -#: elf32-arm.h:1221 +#: elf32-arm.h:1222 #, c-format msgid "%s: Warning: Arm BLX instruction targets Arm function '%s'." msgstr "" -#: elf32-arm.h:1417 +#: elf32-arm.h:1418 #, c-format msgid "%s: Warning: Thumb BLX instruction targets thumb function '%s'." msgstr "" -#: elf32-arm.h:1914 elf32-sh.c:4125 +#: elf32-arm.h:1915 elf32-sh.c:4444 #, c-format msgid "%s(%s+0x%lx): %s relocation against SEC_MERGE section" msgstr "" -#: elf32-arm.h:2008 +#: elf32-arm.h:2009 #, c-format msgid "" "%s: warning: unresolvable relocation %d against symbol `%s' from %s section" msgstr "" -#: elf32-arm.h:2176 +#: elf32-arm.h:2177 #, c-format msgid "" "Warning: Clearing the interworking flag of %s because non-interworking code " "in %s has been linked with it" msgstr "" -#: elf32-arm.h:2271 +#: elf32-arm.h:2272 #, c-format msgid "" "ERROR: %s is compiled for EABI version %d, whereas %s is compiled for " "version %d" msgstr "" -#: elf32-arm.h:2285 +#: elf32-arm.h:2286 #, c-format msgid "ERROR: %s is compiled for APCS-%d, whereas target %s uses APCS-%d" msgstr "" -#: elf32-arm.h:2313 +#: elf32-arm.h:2314 #, c-format msgid "ERROR: %s uses VFP instructions, whereas %s uses FPA instructions" msgstr "" -#: elf32-arm.h:2318 +#: elf32-arm.h:2319 #, c-format msgid "ERROR: %s uses FPA instructions, whereas %s uses VFP instructions" msgstr "" -#: elf32-arm.h:2338 +#: elf32-arm.h:2339 #, c-format msgid "ERROR: %s uses software FP, whereas %s uses hardware FP" msgstr "" -#: elf32-arm.h:2343 +#: elf32-arm.h:2344 #, c-format msgid "ERROR: %s uses hardware FP, whereas %s uses software FP" msgstr "" #. Ignore init flag - it may not be set, despite the flags field #. containing valid data. -#: elf32-arm.h:2396 elf32-cris.c:2988 elf32-m68k.c:410 elf32-vax.c:543 -#: elfxx-mips.c:7756 +#: elf32-arm.h:2397 elf32-cris.c:2989 elf32-m68k.c:410 elf32-vax.c:548 +#: elfxx-mips.c:7760 #, c-format msgid "private flags = %lx:" msgstr "" -#: elf32-arm.h:2405 +#: elf32-arm.h:2406 msgid " [interworking enabled]" msgstr "" -#: elf32-arm.h:2413 +#: elf32-arm.h:2414 msgid " [VFP float format]" msgstr "" -#: elf32-arm.h:2415 +#: elf32-arm.h:2416 msgid " [FPA float format]" msgstr "" -#: elf32-arm.h:2424 +#: elf32-arm.h:2425 msgid " [new ABI]" msgstr "" -#: elf32-arm.h:2427 +#: elf32-arm.h:2428 msgid " [old ABI]" msgstr "" -#: elf32-arm.h:2430 +#: elf32-arm.h:2431 msgid " [software FP]" msgstr "" -#: elf32-arm.h:2438 +#: elf32-arm.h:2439 msgid " [Version1 EABI]" msgstr "" -#: elf32-arm.h:2441 elf32-arm.h:2452 +#: elf32-arm.h:2442 elf32-arm.h:2453 msgid " [sorted symbol table]" msgstr "" -#: elf32-arm.h:2443 elf32-arm.h:2454 +#: elf32-arm.h:2444 elf32-arm.h:2455 msgid " [unsorted symbol table]" msgstr "" -#: elf32-arm.h:2449 +#: elf32-arm.h:2450 msgid " [Version2 EABI]" msgstr "" -#: elf32-arm.h:2457 +#: elf32-arm.h:2458 msgid " [dynamic symbols use segment index]" msgstr "" -#: elf32-arm.h:2460 +#: elf32-arm.h:2461 msgid " [mapping symbols precede others]" msgstr "" -#: elf32-arm.h:2467 +#: elf32-arm.h:2468 msgid " " msgstr "" -#: elf32-arm.h:2474 +#: elf32-arm.h:2475 msgid " [relocatable executable]" msgstr "" -#: elf32-arm.h:2477 +#: elf32-arm.h:2478 msgid " [has entry point]" msgstr "" -#: elf32-arm.h:2482 +#: elf32-arm.h:2483 msgid "" msgstr "" @@ -877,16 +878,16 @@ msgid "" " relocation %s should not be used in a shared object; recompile with -fPIC" msgstr "" -#: elf32-cris.c:2991 +#: elf32-cris.c:2992 msgid " [symbols have a _ prefix]" msgstr "" -#: elf32-cris.c:3030 +#: elf32-cris.c:3031 #, c-format msgid "%s: uses _-prefixed symbols, but writing file with non-prefixed symbols" msgstr "" -#: elf32-cris.c:3031 +#: elf32-cris.c:3032 #, c-format msgid "%s: uses non-prefixed symbols, but writing file with _-prefixed symbols" msgstr "" @@ -919,122 +920,117 @@ msgstr "" msgid "%s: Relocations in generic ELF (EM: %d)" msgstr "" -#: elf32-hppa.c:671 elf64-ppc.c:2323 +#: elf32-hppa.c:672 elf64-ppc.c:2324 #, c-format msgid "%s: cannot create stub entry %s" msgstr "" -#: elf32-hppa.c:956 elf32-hppa.c:3555 +#: elf32-hppa.c:957 elf32-hppa.c:3557 #, c-format msgid "%s(%s+0x%lx): cannot reach %s, recompile with -ffunction-sections" msgstr "" -#: elf32-hppa.c:1338 elf64-x86-64.c:673 +#: elf32-hppa.c:1340 elf64-x86-64.c:675 #, c-format msgid "" "%s: relocation %s can not be used when making a shared object; recompile " "with -fPIC" msgstr "" -#: elf32-hppa.c:1358 +#: elf32-hppa.c:1360 #, c-format msgid "" "%s: relocation %s should not be used when making a shared object; recompile " "with -fPIC" msgstr "" -#: elf32-hppa.c:1551 +#: elf32-hppa.c:1553 #, c-format msgid "Could not find relocation section for %s" msgstr "" -#: elf32-hppa.c:2855 +#: elf32-hppa.c:2857 #, c-format msgid "%s: duplicate export stub %s" msgstr "" -#: elf32-hppa.c:3433 +#: elf32-hppa.c:3435 #, c-format msgid "%s(%s+0x%lx): fixing %s" msgstr "" -#: elf32-hppa.c:4080 +#: elf32-hppa.c:4082 #, c-format msgid "%s(%s+0x%lx): cannot handle %s for %s" msgstr "" -#: elf32-hppa.c:4393 +#: elf32-hppa.c:4395 msgid ".got section not immediately after .plt section" msgstr "" -#: elf32-i386.c:379 +#: elf32-i386.c:401 #, c-format msgid "%s: invalid relocation type %d" msgstr "" -#: elf32-i386.c:876 elf32-s390.c:649 elf64-s390.c:595 elf64-x86-64.c:591 +#: elf32-i386.c:916 elf32-s390.c:651 elf64-s390.c:597 elf64-x86-64.c:593 #, c-format msgid "%s: bad symbol index: %d" msgstr "" -#: elf32-i386.c:948 +#: elf32-i386.c:1025 #, c-format msgid "%s: `%s' accessed both as normal and thread local symbol" msgstr "" -#: elf32-i386.c:1072 elf32-s390.c:808 elf64-ppc.c:2827 elf64-s390.c:759 -#: elf64-x86-64.c:761 +#: elf32-i386.c:1137 elf32-s390.c:810 elf64-ppc.c:2829 elf64-s390.c:761 +#: elf64-x86-64.c:763 #, c-format msgid "%s: bad relocation section name `%s'" msgstr "" -#: elf32-i386.c:1159 elf64-alpha.c:4768 -#, c-format -msgid "%s: TLS local exec code cannot be linked into shared objects" -msgstr "" - -#: elf32-i386.c:2747 elf32-s390.c:1981 elf32-sparc.c:1571 elf64-ppc.c:5918 -#: elf64-s390.c:1945 elf64-sparc.c:2578 elf64-x86-64.c:1948 +#: elf32-i386.c:2990 elf32-s390.c:1983 elf32-sparc.c:1572 elf64-ppc.c:5941 +#: elf64-s390.c:1947 elf64-sparc.c:2578 elf64-x86-64.c:1950 #, c-format msgid "%s(%s+0x%lx): unresolvable relocation against symbol `%s'" msgstr "" -#: elf32-i386.c:2784 elf32-s390.c:2019 elf64-ppc.c:5977 elf64-s390.c:1983 -#: elf64-x86-64.c:1986 +#: elf32-i386.c:3029 elf32-s390.c:2021 elf64-ppc.c:6000 elf64-s390.c:1985 +#: elf64-x86-64.c:1988 #, c-format msgid "%s(%s+0x%lx): reloc against `%s': error %d" msgstr "" -#: elf32-m32r.c:924 +#: elf32-m32r.c:926 msgid "SDA relocation when _SDA_BASE_ not defined" msgstr "" -#: elf32-ia64.c:3687 elf32-m32r.c:1013 elf32-ppc.c:2987 elf64-alpha.c:4185 -#: elf64-alpha.c:4313 elf64-ia64.c:3687 +#: elf32-m32r.c:1015 elf32-ppc.c:2987 elf64-alpha.c:4186 elf64-alpha.c:4314 +#: elf32-ia64.c:3693 elf64-ia64.c:3693 #, c-format msgid "%s: unknown relocation type %d" msgstr "" -#: elf32-m32r.c:1221 +#: elf32-m32r.c:1223 #, c-format msgid "%s: The target (%s) of an %s relocation is in the wrong section (%s)" msgstr "" -#: elf32-m32r.c:1947 +#: elf32-m32r.c:1949 #, c-format msgid "%s: Instruction set mismatch with previous modules" msgstr "" -#: elf32-m32r.c:1970 +#: elf32-m32r.c:1972 #, c-format msgid "private flags = %lx" msgstr "" -#: elf32-m32r.c:1975 +#: elf32-m32r.c:1977 msgid ": m32r instructions" msgstr "" -#: elf32-m32r.c:1976 +#: elf32-m32r.c:1978 msgid ": m32rx instructions" msgstr "" @@ -1077,7 +1073,7 @@ msgid "" "%s: compiled normally and linked with modules compiled with -mrelocatable" msgstr "" -#: elf32-ppc.c:1494 elf64-sparc.c:2989 elfxx-mips.c:7713 +#: elf32-ppc.c:1494 elf64-sparc.c:2990 elfxx-mips.c:7717 #, c-format msgid "%s: uses different e_flags (0x%lx) fields than previous modules (0x%lx)" msgstr "" @@ -1092,67 +1088,67 @@ msgstr "" msgid "%s: relocation %s cannot be used when making a shared object" msgstr "" -#: elf32-ppc.c:3126 elf64-ppc.c:5473 +#: elf32-ppc.c:3126 elf64-ppc.c:5496 #, c-format msgid "%s: unknown relocation type %d for symbol %s" msgstr "" -#: elf32-ppc.c:3482 elf32-ppc.c:3503 elf32-ppc.c:3553 +#: elf32-ppc.c:3489 elf32-ppc.c:3510 elf32-ppc.c:3560 #, c-format msgid "" "%s: The target (%s) of a %s relocation is in the wrong output section (%s)" msgstr "" -#: elf32-ppc.c:3619 +#: elf32-ppc.c:3626 #, c-format msgid "%s: Relocation %s is not yet supported for symbol %s." msgstr "" -#: elf32-sh.c:1964 +#: elf32-sh.c:1973 #, c-format msgid "%s: 0x%lx: warning: bad R_SH_USES offset" msgstr "" -#: elf32-sh.c:1976 +#: elf32-sh.c:1985 #, c-format msgid "%s: 0x%lx: warning: R_SH_USES points to unrecognized insn 0x%x" msgstr "" -#: elf32-sh.c:1993 +#: elf32-sh.c:2002 #, c-format msgid "%s: 0x%lx: warning: bad R_SH_USES load offset" msgstr "" -#: elf32-sh.c:2008 +#: elf32-sh.c:2017 #, c-format msgid "%s: 0x%lx: warning: could not find expected reloc" msgstr "" -#: elf32-sh.c:2036 +#: elf32-sh.c:2045 #, c-format msgid "%s: 0x%lx: warning: symbol in unexpected section" msgstr "" -#: elf32-sh.c:2153 +#: elf32-sh.c:2162 #, c-format msgid "%s: 0x%lx: warning: could not find expected COUNT reloc" msgstr "" -#: elf32-sh.c:2162 +#: elf32-sh.c:2171 #, c-format msgid "%s: 0x%lx: warning: bad count" msgstr "" -#: elf32-sh.c:2550 elf32-sh.c:2926 +#: elf32-sh.c:2559 elf32-sh.c:2935 #, c-format msgid "%s: 0x%lx: fatal: reloc overflow while relaxing" msgstr "" -#: elf32-sh.c:4073 elf64-sh64.c:1576 +#: elf32-sh.c:4392 elf64-sh64.c:1576 msgid "Unexpected STO_SH5_ISA32 on local symbol is not handled" msgstr "" -#: elf32-sh.c:4284 +#: elf32-sh.c:4611 #, c-format msgid "%s: 0x%lx: fatal: unaligned branch target for relax-support relocation" msgstr "" @@ -1172,50 +1168,50 @@ msgstr "" msgid "%s: object size does not match that of target %s" msgstr "" -#: elf32-sh64.c:440 elf64-sh64.c:2941 +#: elf32-sh64.c:443 elf64-sh64.c:2944 #, c-format msgid "%s: encountered datalabel symbol in input" msgstr "" -#: elf32-sh64.c:523 +#: elf32-sh64.c:526 msgid "PTB mismatch: a SHmedia address (bit 0 == 1)" msgstr "" -#: elf32-sh64.c:526 +#: elf32-sh64.c:529 msgid "PTA mismatch: a SHcompact address (bit 0 == 0)" msgstr "" -#: elf32-sh64.c:544 +#: elf32-sh64.c:547 #, c-format msgid "%s: GAS error: unexpected PTB insn with R_SH_PT_16" msgstr "" -#: elf32-sh64.c:593 elf64-sh64.c:1703 +#: elf32-sh64.c:596 elf64-sh64.c:1703 #, c-format msgid "%s: error: unaligned relocation type %d at %08x reloc %08x\n" msgstr "" -#: elf32-sh64.c:677 +#: elf32-sh64.c:680 #, c-format msgid "%s: could not write out added .cranges entries" msgstr "" -#: elf32-sh64.c:739 +#: elf32-sh64.c:742 #, c-format msgid "%s: could not write out sorted .cranges entries" msgstr "" -#: elf32-sparc.c:1535 elf64-sparc.c:2224 +#: elf32-sparc.c:1536 elf64-sparc.c:2224 #, c-format msgid "%s: probably compiled without -fPIC?" msgstr "" -#: elf32-sparc.c:2002 +#: elf32-sparc.c:2010 #, c-format msgid "%s: compiled for a 64 bit system and target is 32 bit" msgstr "" -#: elf32-sparc.c:2016 +#: elf32-sparc.c:2024 #, c-format msgid "%s: linking little endian files with big endian files" msgstr "" @@ -1287,41 +1283,41 @@ msgstr "" msgid "v850ea architecture" msgstr "" -#: elf32-vax.c:546 +#: elf32-vax.c:551 msgid " [nonpic]" msgstr "" -#: elf32-vax.c:549 +#: elf32-vax.c:554 msgid " [d-float]" msgstr "" -#: elf32-vax.c:552 +#: elf32-vax.c:557 msgid " [g-float]" msgstr "" -#: elf32-vax.c:674 +#: elf32-vax.c:665 #, c-format msgid "" "%s: warning: GOT addend of %ld to `%s' does not match previous GOT addend of " "%ld" msgstr "" -#: elf32-vax.c:1679 +#: elf32-vax.c:1687 #, c-format msgid "%s: warning: PLT addend of %d to `%s' from %s section ignored" msgstr "" -#: elf32-vax.c:1814 +#: elf32-vax.c:1822 #, c-format msgid "%s: warning: %s relocation against symbol `%s' from %s section" msgstr "" -#: elf32-vax.c:1820 +#: elf32-vax.c:1828 #, c-format msgid "%s: warning: %s relocation to 0x%x from %s section" msgstr "" -#: elf32-ia64.c:2280 elf32-xstormy16.c:414 elf64-ia64.c:2280 +#: elf32-xstormy16.c:414 elf32-ia64.c:2286 elf64-ia64.c:2286 msgid "non-zero addend in @fptr reloc" msgstr "" @@ -1329,46 +1325,51 @@ msgstr "" msgid "GPDISP relocation did not find ldah and lda instructions" msgstr "" -#: elf64-alpha.c:3675 +#: elf64-alpha.c:3676 #, c-format msgid "%s: .got subsegment exceeds 64K (size %d)" msgstr "" -#: elf64-alpha.c:4498 elf64-alpha.c:4510 +#: elf64-alpha.c:4499 elf64-alpha.c:4511 #, c-format msgid "%s: gp-relative relocation against dynamic symbol %s" msgstr "" -#: elf64-alpha.c:4536 elf64-alpha.c:4676 +#: elf64-alpha.c:4537 elf64-alpha.c:4677 #, c-format msgid "%s: pc-relative relocation against dynamic symbol %s" msgstr "" -#: elf64-alpha.c:4564 +#: elf64-alpha.c:4565 #, c-format msgid "%s: change in gp: BRSGP %s" msgstr "" -#: elf64-alpha.c:4589 +#: elf64-alpha.c:4590 msgid "" msgstr "" -#: elf64-alpha.c:4594 +#: elf64-alpha.c:4595 #, c-format msgid "%s: !samegp reloc against symbol without .prologue: %s" msgstr "" -#: elf64-alpha.c:4639 +#: elf64-alpha.c:4640 #, c-format msgid "%s: unhandled dynamic relocation against %s" msgstr "" -#: elf64-alpha.c:4752 +#: elf64-alpha.c:4753 #, c-format msgid "%s: dtp-relative relocation against dynamic symbol %s" msgstr "" -#: elf64-alpha.c:4775 +#: elf64-alpha.c:4769 +#, c-format +msgid "%s: TLS local exec code cannot be linked into shared objects" +msgstr "" + +#: elf64-alpha.c:4776 #, c-format msgid "%s: tp-relative relocation against dynamic symbol %s" msgstr "" @@ -1447,46 +1448,46 @@ msgstr "" msgid "%s: compiled for a little endian system and target is big endian" msgstr "" -#: elf64-ppc.c:3610 +#: elf64-ppc.c:3614 #, c-format msgid "%s: unexpected reloc type %u in .opd section" msgstr "" -#: elf64-ppc.c:3630 +#: elf64-ppc.c:3634 #, c-format msgid "%s: .opd is not a regular array of opd entries" msgstr "" -#: elf64-ppc.c:3672 +#: elf64-ppc.c:3676 #, c-format msgid "%s: undefined sym `%s' in .opd section" msgstr "" -#: elf64-ppc.c:4397 +#: elf64-ppc.c:4421 #, c-format msgid "can't find branch stub `%s'" msgstr "" -#: elf64-ppc.c:4436 elf64-ppc.c:4501 +#: elf64-ppc.c:4460 elf64-ppc.c:4504 #, c-format msgid "linkage table error against `%s'" msgstr "" -#: elf64-ppc.c:4573 +#: elf64-ppc.c:4576 #, c-format msgid "can't build branch stub `%s'" msgstr "" -#: elf64-ppc.c:5179 +#: elf64-ppc.c:5202 msgid "stubs don't match calculated size" msgstr "" -#: elf64-ppc.c:5828 +#: elf64-ppc.c:5851 #, c-format msgid "%s: Relocation %s is not supported for symbol %s." msgstr "" -#: elf64-ppc.c:5872 +#: elf64-ppc.c:5895 #, c-format msgid "%s: error: relocation %s not a multiple of 4" msgstr "" @@ -1516,7 +1517,7 @@ msgstr "" msgid "Symbol `%s' has differing types: %s in %s, previously REGISTER in %s" msgstr "" -#: elf64-sparc.c:2970 +#: elf64-sparc.c:2971 #, c-format msgid "%s: linking UltraSPARC specific with HAL specific code" msgstr "" @@ -1526,83 +1527,85 @@ msgstr "" msgid "%s: version count (%ld) does not match symbol count (%ld)" msgstr "" -#: elflink.c:440 +#: elfcode.h:1433 +#, c-format +msgid "%s(%s): relocation %d has invalid symbol index %ld" +msgstr "" + +#: elflink.c:536 #, c-format msgid "%s: Section %s is too large to add hole of %ld bytes" msgstr "" -#: elflink.h:1090 +#: elflink.h:1098 #, c-format -msgid "%s: warning: unexpected redefinition of `%s'" +msgid "%s: warning: unexpected redefinition of indirect versioned symbol `%s'" msgstr "" -#: elflink.h:1727 +#: elflink.h:1745 #, c-format msgid "%s: %s: invalid version %u (max %d)" msgstr "" -#: elflink.h:1768 +#: elflink.h:1786 #, c-format msgid "%s: %s: invalid needed version %d" msgstr "" -#: elflink.h:1890 +#: elflink.h:1908 #, c-format msgid "Warning: size of symbol `%s' changed from %lu to %lu in %s" msgstr "" -#: elflink.h:3174 +#: elflink.h:3116 +#, c-format +msgid "%s: undefined version: %s" +msgstr "" + +#: elflink.h:3182 #, c-format msgid "%s: .preinit_array section is not allowed in DSO" msgstr "" -#: elflink.h:4030 +#: elflink.h:4039 #, c-format msgid "warning: type and size of dynamic symbol `%s' are not defined" msgstr "" -#: elflink.h:4345 +#: elflink.h:4354 #, c-format msgid "%s: undefined versioned symbol name %s" msgstr "" -#: elflink.h:4611 elflink.h:4619 elflink.h:6508 elflink.h:7600 +#: elflink.h:4595 elflink.h:4603 elflink.h:6494 elflink.h:7569 msgid "Error: out of memory" msgstr "" -#: elflink.h:4781 +#: elflink.h:4767 msgid "Not enough memory to sort relocations" msgstr "" -#: elflink.h:5682 elflink.h:5725 +#: elflink.h:5668 elflink.h:5711 #, c-format msgid "%s: could not find output section %s" msgstr "" -#: elflink.h:5688 +#: elflink.h:5674 #, c-format msgid "warning: %s section has zero size" msgstr "" -#: elflink.h:6275 +#: elflink.h:6261 #, c-format msgid "%s: could not find output section %s for input section %s" msgstr "" -#: elflink.h:6486 +#: elflink.h:6472 #, c-format msgid "%s: relocation size mismatch in %s section %s" msgstr "" -#: elflink.h:6849 -msgid "warning: relocation against removed section; zeroing" -msgstr "" - -#: elflink.h:6879 -msgid "warning: relocation against removed section" -msgstr "" - -#: elflink.h:6892 +#: elflink.h:6862 #, c-format msgid "local symbols in discarded section %s" msgstr "" @@ -1611,132 +1614,132 @@ msgstr "" msgid "static procedure (no name)" msgstr "" -#: elfxx-mips.c:1601 +#: elfxx-mips.c:1604 msgid "not enough GOT space for local GOT entries" msgstr "" -#: elfxx-mips.c:2750 +#: elfxx-mips.c:2755 #, c-format msgid "%s: %s+0x%lx: jump to stub routine which is not jal" msgstr "" -#: elfxx-mips.c:4270 +#: elfxx-mips.c:4264 #, c-format msgid "%s: Malformed reloc detected for section %s" msgstr "" -#: elfxx-mips.c:4348 +#: elfxx-mips.c:4342 #, c-format msgid "%s: CALL16 reloc at 0x%lx not against global symbol" msgstr "" -#: elfxx-mips.c:7301 +#: elfxx-mips.c:7296 #, c-format msgid "%s: illegal section name `%s'" msgstr "" -#: elfxx-mips.c:7615 +#: elfxx-mips.c:7610 #, c-format msgid "%s: linking PIC files with non-PIC files" msgstr "" -#: elfxx-mips.c:7625 +#: elfxx-mips.c:7620 #, c-format msgid "%s: linking abicalls files with non-abicalls files" msgstr "" -#: elfxx-mips.c:7654 +#: elfxx-mips.c:7649 #, c-format msgid "%s: ISA mismatch (-mips%d) with previous modules (-mips%d)" msgstr "" -#: elfxx-mips.c:7676 +#: elfxx-mips.c:7671 #, c-format msgid "%s: ISA mismatch (%d) with previous modules (%d)" msgstr "" -#: elfxx-mips.c:7699 +#: elfxx-mips.c:7694 #, c-format msgid "%s: ABI mismatch: linking %s module with previous %s modules" msgstr "" -#: elfxx-mips.c:7759 +#: elfxx-mips.c:7763 msgid " [abi=O32]" msgstr "" -#: elfxx-mips.c:7761 +#: elfxx-mips.c:7765 msgid " [abi=O64]" msgstr "" -#: elfxx-mips.c:7763 +#: elfxx-mips.c:7767 msgid " [abi=EABI32]" msgstr "" -#: elfxx-mips.c:7765 +#: elfxx-mips.c:7769 msgid " [abi=EABI64]" msgstr "" -#: elfxx-mips.c:7767 +#: elfxx-mips.c:7771 msgid " [abi unknown]" msgstr "" -#: elfxx-mips.c:7769 +#: elfxx-mips.c:7773 msgid " [abi=N32]" msgstr "" -#: elfxx-mips.c:7771 +#: elfxx-mips.c:7775 msgid " [abi=64]" msgstr "" -#: elfxx-mips.c:7773 +#: elfxx-mips.c:7777 msgid " [no abi set]" msgstr "" -#: elfxx-mips.c:7776 +#: elfxx-mips.c:7780 msgid " [mips1]" msgstr "" -#: elfxx-mips.c:7778 +#: elfxx-mips.c:7782 msgid " [mips2]" msgstr "" -#: elfxx-mips.c:7780 +#: elfxx-mips.c:7784 msgid " [mips3]" msgstr "" -#: elfxx-mips.c:7782 +#: elfxx-mips.c:7786 msgid " [mips4]" msgstr "" -#: elfxx-mips.c:7784 +#: elfxx-mips.c:7788 msgid " [mips5]" msgstr "" -#: elfxx-mips.c:7786 +#: elfxx-mips.c:7790 msgid " [mips32]" msgstr "" -#: elfxx-mips.c:7788 +#: elfxx-mips.c:7792 msgid " [mips64]" msgstr "" -#: elfxx-mips.c:7790 +#: elfxx-mips.c:7794 msgid " [unknown ISA]" msgstr "" -#: elfxx-mips.c:7793 +#: elfxx-mips.c:7797 msgid " [mdmx]" msgstr "" -#: elfxx-mips.c:7796 +#: elfxx-mips.c:7800 msgid " [mips16]" msgstr "" -#: elfxx-mips.c:7799 +#: elfxx-mips.c:7803 msgid " [32bitmode]" msgstr "" -#: elfxx-mips.c:7801 +#: elfxx-mips.c:7805 msgid " [not 32bitmode]" msgstr "" @@ -1785,52 +1788,52 @@ msgstr "" msgid "%s: unexpected type after ATN" msgstr "" -#: ihex.c:258 +#: ihex.c:255 #, c-format msgid "%s:%d: unexpected character `%s' in Intel Hex file\n" msgstr "" -#: ihex.c:366 +#: ihex.c:363 #, c-format msgid "%s:%u: bad checksum in Intel Hex file (expected %u, found %u)" msgstr "" -#: ihex.c:420 +#: ihex.c:417 #, c-format msgid "%s:%u: bad extended address record length in Intel Hex file" msgstr "" -#: ihex.c:437 +#: ihex.c:434 #, c-format msgid "%s:%u: bad extended start address length in Intel Hex file" msgstr "" -#: ihex.c:454 +#: ihex.c:451 #, c-format msgid "%s:%u: bad extended linear address record length in Intel Hex file" msgstr "" -#: ihex.c:471 +#: ihex.c:468 #, c-format msgid "%s:%u: bad extended linear start address length in Intel Hex file" msgstr "" -#: ihex.c:488 +#: ihex.c:485 #, c-format msgid "%s:%u: unrecognized ihex type %u in Intel Hex file\n" msgstr "" -#: ihex.c:607 +#: ihex.c:610 #, c-format msgid "%s: internal error in ihex_read_section" msgstr "" -#: ihex.c:642 +#: ihex.c:645 #, c-format msgid "%s: bad section length in ihex_read_section" msgstr "" -#: ihex.c:860 +#: ihex.c:863 #, c-format msgid "%s: address 0x%s out of range for Intel Hex file" msgstr "" @@ -1854,12 +1857,12 @@ msgstr "" msgid "Deprecated %s called\n" msgstr "" -#: linker.c:1873 +#: linker.c:1875 #, c-format msgid "%s: indirect symbol `%s' to `%s' is a loop" msgstr "" -#: linker.c:2776 +#: linker.c:2778 #, c-format msgid "Attempt to do relocateable link with %s input and %s output" msgstr "" @@ -2079,7 +2082,7 @@ msgstr "" msgid "%s: size field is zero in Import Library Format header" msgstr "" -#: peicode.h:1219 +#: peicode.h:1222 #, c-format msgid "%s: string not null terminated in ILF object file." msgstr "" @@ -2136,7 +2139,7 @@ msgstr "" msgid "som_sizeof_headers unimplemented" msgstr "" -#: srec.c:301 +#: srec.c:302 #, c-format msgid "%s:%d: Unexpected character `%s' in S-record file\n" msgstr "" @@ -2174,29 +2177,29 @@ msgstr "" msgid "Object module NOT error-free !\n" msgstr "" -#: vms-misc.c:543 +#: vms-misc.c:541 #, c-format msgid "Stack overflow (%d) in _bfd_vms_push" msgstr "" -#: vms-misc.c:561 +#: vms-misc.c:559 msgid "Stack underflow in _bfd_vms_pop" msgstr "" -#: vms-misc.c:919 +#: vms-misc.c:918 msgid "_bfd_vms_output_counted called with zero bytes" msgstr "" -#: vms-misc.c:924 +#: vms-misc.c:923 msgid "_bfd_vms_output_counted called with too many bytes" msgstr "" -#: vms-misc.c:1055 +#: vms-misc.c:1054 #, c-format msgid "Symbol %s replaced by %s\n" msgstr "" -#: vms-misc.c:1117 +#: vms-misc.c:1116 #, c-format msgid "failed to enter %s" msgstr "" @@ -2349,109 +2352,109 @@ msgstr "" msgid "%s: reloc %s:%d not in csect" msgstr "" -#: xcofflink.c:2092 +#: xcofflink.c:2094 #, c-format msgid "%s: XCOFF shared object when not producing XCOFF output" msgstr "" -#: xcofflink.c:2113 +#: xcofflink.c:2115 #, c-format msgid "%s: dynamic object with no .loader section" msgstr "" -#: xcofflink.c:2758 +#: xcofflink.c:2760 #, c-format msgid "%s: no such symbol" msgstr "" -#: xcofflink.c:2891 +#: xcofflink.c:2893 msgid "error: undefined symbol __rtinit" msgstr "" -#: xcofflink.c:3453 +#: xcofflink.c:3455 #, c-format msgid "warning: attempt to export undefined symbol `%s'" msgstr "" -#: xcofflink.c:4447 +#: xcofflink.c:4449 #, c-format msgid "TOC overflow: 0x%lx > 0x10000; try -mminimal-toc when compiling" msgstr "" -#: xcofflink.c:5287 xcofflink.c:5756 xcofflink.c:5818 xcofflink.c:6119 +#: xcofflink.c:5289 xcofflink.c:5758 xcofflink.c:5820 xcofflink.c:6124 #, c-format msgid "%s: loader reloc in unrecognized section `%s'" msgstr "" -#: xcofflink.c:5309 xcofflink.c:6130 +#: xcofflink.c:5311 xcofflink.c:6135 #, c-format msgid "%s: `%s' in loader reloc but not loader sym" msgstr "" -#: xcofflink.c:5324 +#: xcofflink.c:5326 #, c-format msgid "%s: loader reloc in read-only section %s" msgstr "" -#: elf32-ia64.c:2222 elf64-ia64.c:2222 +#: elf32-ia64.c:2228 elf64-ia64.c:2228 msgid "@pltoff reloc against local symbol" msgstr "" -#: elf32-ia64.c:3562 elf64-ia64.c:3562 +#: elf32-ia64.c:3568 elf64-ia64.c:3568 #, c-format msgid "%s: short data segment overflowed (0x%lx >= 0x400000)" msgstr "" -#: elf32-ia64.c:3573 elf64-ia64.c:3573 +#: elf32-ia64.c:3579 elf64-ia64.c:3579 #, c-format msgid "%s: __gp does not cover short data segment" msgstr "" -#: elf32-ia64.c:3858 elf64-ia64.c:3858 +#: elf32-ia64.c:3864 elf64-ia64.c:3864 #, c-format msgid "%s: linking non-pic code in a shared library" msgstr "" -#: elf32-ia64.c:3891 elf64-ia64.c:3891 +#: elf32-ia64.c:3897 elf64-ia64.c:3897 #, c-format msgid "%s: @gprel relocation against dynamic symbol %s" msgstr "" -#: elf32-ia64.c:4030 elf64-ia64.c:4030 +#: elf32-ia64.c:4036 elf64-ia64.c:4036 #, c-format msgid "%s: dynamic relocation against speculation fixup" msgstr "" -#: elf32-ia64.c:4038 elf64-ia64.c:4038 +#: elf32-ia64.c:4044 elf64-ia64.c:4044 #, c-format msgid "%s: speculation fixup against undefined weak symbol" msgstr "" -#: elf32-ia64.c:4271 elf64-ia64.c:4271 +#: elf32-ia64.c:4277 elf64-ia64.c:4277 msgid "unsupported reloc" msgstr "" -#: elf32-ia64.c:4551 elf64-ia64.c:4551 +#: elf32-ia64.c:4557 elf64-ia64.c:4557 #, c-format msgid "%s: linking trap-on-NULL-dereference with non-trapping files" msgstr "" -#: elf32-ia64.c:4560 elf64-ia64.c:4560 +#: elf32-ia64.c:4566 elf64-ia64.c:4566 #, c-format msgid "%s: linking big-endian files with little-endian files" msgstr "" -#: elf32-ia64.c:4569 elf64-ia64.c:4569 +#: elf32-ia64.c:4575 elf64-ia64.c:4575 #, c-format msgid "%s: linking 64-bit files with 32-bit files" msgstr "" -#: elf32-ia64.c:4578 elf64-ia64.c:4578 +#: elf32-ia64.c:4584 elf64-ia64.c:4584 #, c-format msgid "%s: linking constant-gp files with non-constant-gp files" msgstr "" -#: elf32-ia64.c:4588 elf64-ia64.c:4588 +#: elf32-ia64.c:4594 elf64-ia64.c:4594 #, c-format msgid "%s: linking auto-pic files with non-auto-pic files" msgstr "" diff -Nurpa binutils-2.13/bfd/po/da.gmo binutils-2.13.1/bfd/po/da.gmo --- binutils-2.13/bfd/po/da.gmo 1969-12-31 19:00:00.000000000 -0500 +++ binutils-2.13.1/bfd/po/da.gmo 2002-11-07 17:40:00.000000000 -0500 @@ -0,0 +1,305 @@ +Þ•×ì!H-I-b--˜-$«-3Ð-.%$.J.AZ.&œ.Ã.Ü.õ.// =/^/~/•/*¨/9Ó/6 0;D0€06’0:É051J:1)…1L¯1)ü1L&2s2‰2D 2å2343)K3)u3Ÿ3´3Ñ3å34 4'4;4O4`4q4 €4 Š4 ˜4 +¦4 +±4 +¼4Ç4Ü4 +å4$ð4#5%95 +_5j5}5$•5º5Ø5 ò5!ü56 &60696 B6L6U6^6 g6 +q6 |6 Š6”6 +¥6°6È6â6ñ67#7276K7{‚7xþ7w8'8*µ85à839%J9Ap9²9*Ê99õ9[/:6‹:3Â:!ö:#;&<;)c;.;0¼;/í;F<>d<-£<(Ñ<ú<7=1P=0‚=/³=<ã=/ >&P>Mw>3Å>Tù>2N?0?:²?2í?| @4@(Ò@(û@[$A+€AH¬A/õA(%B?NB<ŽB?ËBQ C3]C1‘C5ÃC'ùC4!D<VD6“DJÊDDEZExE1˜E"ÊE%íE FE4F4zF;¯F?ëF7+G-cG*‘G8¼G2õG+(H/TH3„H0¸H7éH!I+AI$mI+’I¾IÜIAõIH7J>€J+¿JIëJ;5KqK‘K)¬K+ÖK.L.1L5`L@–L@×LIM=bMI MIêM$4N9YN.“N/ÂN'òN@O5[O‘O*®O0ÙO) +P,4P;aP4P/ÒPQ% Q*FQ'qQ>™QBØQR47RllR@ÙR?SGZSF¢SJéSH4TK}TGÉTBUXTU4­U/âUVN1V4€V0µVæV(ýV*&W(QW6zW2±W2äW5X8MX5†X,¼X<éX(&Y-OY}Y —Y/¸YèYûYZ(Zkd2ªd5ÝdDePXe=©e2çe7f5Rf/ˆfo¸f,(gKUgH¡g2êg3h=Qh;hBËhAi:Pi3‹i ¿i/Éi;ùi5jIj^j {j"…j+¨j#Ôj;øj4k.Pk4k ´k"¾kák(øk!l1lHl)^lˆlSžl#òl.m,Em+rm-žmVÌm1#nOUnY¥nVÿn;Vo)’oZ¼oZpErpA¸pPúpWKqW£qAûqA=r7r7·r$ïrVsks€s5sÓs +ès#óst0tKt `tmt|t št/¨t+Øt8u=u"\uIuÉuÜu$îu6vJvgv}vv v°v ÀvÊvÓvÜv +óv"þv%!w GwSwsw)ˆw/²wâw.x,0x]x:yx%´x%Úxy"y?¿ŒþŒ19@0zP«+üP(Ž)yŽO£ŽóŽ I!"kŽ5Ÿ*Õ*+=\p¬¾Ùô‘ ‘ $‘ .‘ <‘ +J‘ +U‘ +`‘k‘‘ˆ‘)š‘/Ä‘*ô‘’1’C’$_’„’£’ ½’.Ç’ö’ þ’““ “$“-“6“ ?“ +I“T“ e“q“ˆ“—“ ®“Ï“â“ú“ ”$”H=”‰†”y•Š•-ž•.Ì•5û•01–)b–@Œ–Í–.å–5—\J—8§—0à—!˜#3˜4W˜4Œ˜4Á˜2ö˜@)™Uj™@À™;š0=š%nšD”š>Ùš-›0F›=w›9µ›0ï›S œ>tœY³œ4 3B=v;´{ð8lž/¥ž.Õž^Ÿ3cŸW—Ÿ8ïŸ0( PY Lª :÷ H2¡;{¡8·¡>ð¡*/¢=Z¢C˜¢EÜ¢G"£Aj£¬£"Ê£.í£¤<¤[¤:u¤1°¤Eâ¤K(¥6t¥.«¥%Ú¥B¦5C¦6y¦1°¦?â¦B"§>e§%¤§;ʧ.¨05¨&f¨¨@¬¨Fí¨@4©0u©K¦©9ò©#,ªPª3kª/Ÿª0Ϫ0«61«Ah«Aª«Oì«C<¬N€¬OϬ'­?G­1‡­0¹­,ê­I®5a®—®.²®6á®&¯6?¯Gv¯4¾¯4ó¯(°-G°.u°#¤°>È°D±L±>g±k¦±A²@T²K•²Já²M,³Jz³JųG´>X´\—´9ô´4.µ"cµM†µ6Ôµ+ ¶7¶-O¶&}¶'¤¶4̶1·13·3e·7™·3Ñ·)¸;/¸7k¸0£¸#Ô¸,ø¸0%¹V¹n¹„¹ ¹·¹>͹4 ºAº;`ºAœº*Þº2 »<<»Yy»CÓ»6¼QN¼Y ¼Rú¼PM½Dž½@ã½1$¾9V¾/¾.À¾-ï¾(¿&F¿+m¿6™¿4п/À15À)gÀ(‘À%ºÀ1àÀÁ--Á[Á0rÁ!£Á/ÅÁ õÁ?Â-VÂ1„Âb¶ÂJÃEdÃMªÃJøÃ:CÄ@~Ä9¿Ä;ùÄG5Å[}ÅCÙÅ3Æ6QÆ3ˆÆ;¼ÆoøÆ*hÇI“ÇFÝÇ%$È1JÈM|ÈKÊÈRÉWiÉGÁÉ3 Ê=Ê9FÊ?€ÊÀÊÕÊëÊË( Ë56Ë"lËFË#ÖË.úË2)Ì\Ì#mÌ‘Ì.®ÌÝÌ!ñÌÍ'&ÍNÍ`bÍ.ÃÍ3òÍ1&Î0XÎ3‰Îa½Î4ÏWTÏc¬ÏZÐ@kÐ)¬ÐZÖÐV1ÑBˆÑ@ËÑP Ò_]Ò_½ÒCÓCaÓP¥ÓPöÓ$GÔXlÔÅÔàÔ1üÔ.Õ BÕ7NÕ†Õ ÕºÕÔÕæÕöÕÖ9%Ö4_Ö<”ÖÑÖëÖK +×V×g×$x×;× Ù×ú×Ø#Ø:ØJØ ZØdØ +vØØØ#¬Ø3ÐØÙ Ù)Ù'>Ù-fÙ#”Ù2¸Ù0ëÙÚ>8Ú(wÚ) ÚÊÚ%çÚ> ÛLÛ +iÛtÛ3‹Û,¿ÛìÛÜ0ÜKÜ*ZÜ%…Ü*«ÜÖÜCòÜC6Ý7zݲÝFÂÝ ÞÞ3Þ5KÞ4Þ¶ÞÓÞçÞßß*:ßJeßI°ßAúßA<à^~àDÝà["áO~á'ÎáAöá:8â=sâ#±âÕâ7éâ*!ãLã!jã*Œã·ãÔã2ñã0$ä0Uä †ä§äÆäãä"üä å@å/Yå‰å'¢åÊåéå)æ,2æ _æ'€æ¨æÈæÛæïæçç0-ç"^ççœç·çÒç(íç+è&Bè(iè-’è>Àèÿè7é2Vé,‰é¶é!Óé"õé&ê?êWêgêxê'Šê2²ê8åê,ë8KëG„ë¾uúÒ¬Ör(e¤ÎF•å^Wà#B¯ê{LQ†×ìˆGîDét9ï b +1 ?Ìjfm¢x ãm3‹d®CXQ¨Â%l ›:Eп­c[M—;ÖOTpk~×H­¾/ï,P“"zJÚ.g‰=;ÕrËõƒ Èÿøí +jŸ‚‹A£ðÊu ²Š*ƒ/LÚË´§~é©Õœ»ÛUý óÀ_ä">•·’ÄS<hþH%µÉª gÝÆߘ…äk¯nëv£YèŒ Ó|.A}úÅRùÝ@ùÓØûñ™èa1í9!¼)[Ê@œ³¸˜…åv)Ò]( *¥Í#µ85ìOâÃ}E¡§'-'ÌêÞÈÑ°^I™¥y:obÿ +8áÔ¹ŒŽ + ¦žØRx66GõYyIÏý\¶BS`°ÙÅTš“<É—«»ðÐléû¢Fqºâ{tÍà„ÀòCf$Ç€¦sšiˆÏ÷0±ÇŽÄÜV‘oî„pÁi¶=¤wæ¹h3w‡ò¸ ã”’_‚7¡€Kø?Æ”Jëc‘ºdXU½žü®üN4z0ßþ`ôŸÛ†÷¼´ª>+n¬öq² –M¨ó $W2&Ùe«-ô›K5ñ,³4¿ÎÑ]Á2ö7 –ÞŠ\Z‡ç&aZÜP½Ôs‰áD±ç!·Næ|V Export Address Table Export Address Table %08lx + Name Pointer Table Ordinal Table [Name Pointer/Ordinal] Table %08lx + code-base %08lx toc (loadable/actual) %08lx/%08lx + reloc %4d offset %4x [%4lx] %s vma: Hint/Ord Member-Name Bound-To + + DLL Name: %s + + +PE File Base Relocations (interpreted .reloc section contents) + + End+1 symbol: %-7ld Type: %s + End+1 symbol: %ld + First symbol: %ld + Local symbol: %ld + Type: %s + enum; End+1 symbol: %ld + struct; End+1 symbol: %ld + union; End+1 symbol: %ld +Characteristics 0x%x + +Dynamic Section: + +Export Address Table -- Ordinal Base %ld + +Function descriptor located at the start address: %04lx + +No reldata section! Function descriptor not decoded. + +Partition[%d] start = { 0x%.2x, 0x%.2x, 0x%.2x, 0x%.2x } + +Program Header: + +The Export Tables (interpreted %s section contents) + + +The Function Table (interpreted .pdata section contents) + +The Import Tables (interpreted %s section contents) + +There is a first thunk, but the section containing it could not be found + +There is an export table in %s at 0x%lx + +There is an export table, but the section containing it could not be found + +There is an import table in %s at 0x%lx + +There is an import table, but the section containing it could not be found + +Version References: + +Version definitions: + +Virtual Address: %08lx Chunk size %ld (0x%lx) Number of fixups %ld + +[Ordinal/Name Pointer] Table + +ppcboot header: + consider relinking with --support-old-code enabled first occurrence: %s: arm call to thumb first occurrence: %s: thumb call to arm required from %s: + Glue code sequence Register restore millicode Register save millicode [32bitmode] [FPA float format] [VFP float format] [Version1 EABI] [Version2 EABI] [abi unknown] [abi=64] [abi=EABI32] [abi=EABI64] [abi=N32] [abi=O32] [abi=O64] [absolute position] [cpu32] [d-float] [dynamic symbols use segment index] [floats passed in float registers] [floats passed in integer registers] [g-float] [has entry point] [interworking enabled] [interworking flag not initialised] [interworking not supported] [interworking supported] [m68000] [mapping symbols precede others] [mdmx] [mips16] [mips1] [mips2] [mips32] [mips3] [mips4] [mips5] [mips64] [new ABI] [no abi set] [nonpic] [not 32bitmode] [old ABI] [position independent] [relocatable executable] [software FP] [sorted symbol table] [symbols have a _ prefix] [unknown ISA] [unsorted symbol table] vma: Begin Address End Address Unwind Info + vma: Begin End EH EH PrologEnd Exception + Address Address Handler Data Address Mask + vma: Hint Time Forward DLL First + Table Stamp Chain Name Thunk +#%s (%s): Section flag %s (0x%x) ignored%s(%s): warning: interworking not enabled.%s(%s+0x%lx): %s relocation against SEC_MERGE section%s(%s+0x%lx): Stabs entry has invalid string index.%s(%s+0x%lx): cannot handle %s for %s%s(%s+0x%lx): cannot reach %s, recompile with -ffunction-sections%s(%s+0x%lx): fixing %s%s(%s+0x%lx): reloc against `%s': error %d%s(%s+0x%lx): unresolvable relocation against symbol `%s'%s, section %s: + relocation %s should not be used in a shared object; recompile with -fPIC%s: !samegp reloc against symbol without .prologue: %s%s: %s+0x%lx: jump to stub routine which is not jal%s: %s: invalid needed version %d%s: %s: invalid version %u (max %d)%s: %s: reloc overflow: 0x%lx > 0xffff%s: .got subsegment exceeds 64K (size %d)%s: .opd is not a regular array of opd entries%s: .preinit_array section is not allowed in DSO%s: 0x%lx: fatal: reloc overflow while relaxing%s: 0x%lx: fatal: unaligned branch target for relax-support relocation%s: 0x%lx: warning: R_SH_USES points to unrecognized insn 0x%x%s: 0x%lx: warning: bad R_SH_USES load offset%s: 0x%lx: warning: bad R_SH_USES offset%s: 0x%lx: warning: bad count%s: 0x%lx: warning: could not find expected COUNT reloc%s: 0x%lx: warning: could not find expected reloc%s: 0x%lx: warning: symbol in unexpected section%s: @gprel relocation against dynamic symbol %s%s: ABI mismatch: linking %s module with previous %s modules%s: Architecture mismatch with previous modules%s: Bad relocation record imported: %d%s: Bad symbol definition: `Main' set to %s rather than the start address %s +%s: CALL16 reloc at 0x%lx not against global symbol%s: Error: multiple definition of `%s'; start of %s is set in a earlier linked file +%s: GAS error: unexpected PTB insn with R_SH_PT_16%s: ISA mismatch (%d) with previous modules (%d)%s: ISA mismatch (-mips%d) with previous modules (-mips%d)%s: Instruction set mismatch with previous modules%s: Internal inconsistency error for value for + linker-allocated global register: linked: 0x%lx%08lx != relaxed: 0x%lx%08lx +%s: Internal inconsistency; no relocation section %s%s: Invalid relocation type exported: %d%s: Invalid relocation type imported: %d%s: LOCAL directive: Register $%ld is not a local register. First global register is $%ld.%s: Malformed reloc detected for section %s%s: No PLT nor GOT for relocation %s against symbol `%s' from %s section%s: No core to allocate a symbol %d bytes long +%s: No core to allocate section name %s +%s: Not enough room for program headers (allocated %u, need %u)%s: Not enough room for program headers, try linking with -N%s: Only registers %%g[2367] can be declared using STT_REGISTER%s: Recognised but unhandled machine type (0x%x) in Import Library Format archive%s: Relocation %s (%d) is not currently supported. +%s: Relocation %s is not supported for symbol %s.%s: Relocation %s is not yet supported for symbol %s.%s: Relocations in generic ELF (EM: %d)%s: Section %s is too large to add hole of %ld bytes%s: TLS local exec code cannot be linked into shared objects%s: TOC reloc at 0x%x to symbol `%s' with no TOC entry%s: The target (%s) of a %s relocation is in the wrong output section (%s)%s: The target (%s) of an %s relocation is in the wrong section (%s)%s: Unhandled import type; %x%s: Unknown relocation type %d +%s: Unknown section type in a.out.adobe file: %x +%s: Unknown special linker type %d%s: Unrecognised import name type; %x%s: Unrecognised import type; %x%s: Unrecognised machine type (0x%x) in Import Library Format archive%s: Unrecognized storage class %d for %s symbol `%s'%s: Warning: Arm BLX instruction targets Arm function '%s'.%s: Warning: Thumb BLX instruction targets thumb function '%s'.%s: XCOFF shared object when not producing XCOFF output%s: XMC_TC0 symbol `%s' is class %d scnlen %d%s: __gp does not cover short data segment%s: `%s' accessed both as normal and thread local symbol%s: `%s' has line numbers but no enclosing section%s: `%s' in loader reloc but not loader sym%s: `ld -r' not supported with PE MIPS objects +%s: access beyond end of merged section (%ld + %ld)%s: address 0x%s out of range for Intel Hex file%s: bad XTY_ER symbol `%s': class %d scnum %d scnlen %d%s: bad pair/reflo after refhi +%s: bad reloc address 0x%lx in section `%s'%s: bad relocation section name `%s'%s: bad section length in ihex_read_section%s: bad string table size %lu%s: bad symbol index: %d%s: base-plus-offset relocation against register symbol: %s in %s%s: base-plus-offset relocation against register symbol: (unknown) in %s%s: can not represent section `%s' in a.out object file format%s: can not represent section `%s' in oasys%s: can not represent section for symbol `%s' in a.out object file format%s: cannot allocate file name for file number %d, %d bytes +%s: cannot create stub entry %s%s: change in gp: BRSGP %s%s: check_relocs: unhandled reloc type %d%s: class %d symbol `%s' has no aux entries%s: compiled as 32-bit object and %s is 64-bit%s: compiled as 64-bit object and %s is 32-bit%s: compiled for a 64 bit system and target is 32 bit%s: compiled for a big endian system and target is little endian%s: compiled for a little endian system and target is big endian%s: compiled normally and linked with modules compiled with -mrelocatable%s: compiled with %s and linked with modules compiled with %s%s: compiled with %s and linked with modules that use non-pic relocations%s: compiled with -mrelocatable and linked with modules compiled normally%s: could not find output section %s%s: could not find output section %s for input section %s%s: could not write out added .cranges entries%s: could not write out sorted .cranges entries%s: csect `%s' not in enclosing section%s: directive LOCAL valid only with a register or absolute value%s: dtp-relative relocation against dynamic symbol %s%s: duplicate export stub %s%s: dynamic object with no .loader section%s: dynamic relocation against speculation fixup%s: encountered datalabel symbol in input%s: error: relocation %s not a multiple of 4%s: error: unaligned relocation type %d at %08x reloc %08x +%s: gp-relative relocation against dynamic symbol %s%s: illegal relocation type %d at address 0x%lx%s: illegal section name `%s'%s: illegal symbol index in reloc: %d%s: indirect symbol `%s' to `%s' is a loop%s: internal error in ihex_read_section%s: internal error, internal register section %s had contents +%s: internal error, symbol table changed size from %d to %d words +%s: invalid SHT_GROUP entry%s: invalid link %lu for reloc section %s (index %u)%s: invalid mmo file: YZ of lop_end (%ld) not equal to the number of tetras to the preceding lop_stab (%ld) +%s: invalid mmo file: expected YZ = 1 got YZ = %d for lop_quote +%s: invalid mmo file: expected y = 0, got y = %d for lop_fixrx +%s: invalid mmo file: expected z = 1 or z = 2, got z = %d for lop_fixo +%s: invalid mmo file: expected z = 1 or z = 2, got z = %d for lop_loc +%s: invalid mmo file: expected z = 16 or z = 24, got z = %d for lop_fixrx +%s: invalid mmo file: fields y and z of lop_stab non-zero, y: %d, z: %d +%s: invalid mmo file: file name for number %d was not specified before use +%s: invalid mmo file: file number %d `%s', was already entered as `%s' +%s: invalid mmo file: initialization value for $255 is not `Main' +%s: invalid mmo file: leading byte of operand word must be 0 or 1, got %d for lop_fixrx +%s: invalid mmo file: lop_end not last item in file +%s: invalid mmo file: unsupported lopcode `%d' +%s: invalid relocation type %d%s: invalid start address for initialized registers of length %ld: 0x%lx%08lx +%s: invalid string offset %u >= %lu for section `%s'%s: invalid symbol table: duplicate symbol `%s' +%s: jump too far away +%s: line number overflow: 0x%lx > 0xffff%s: linking 64-bit files with 32-bit files%s: linking PIC files with non-PIC files%s: linking UltraSPARC specific with HAL specific code%s: linking abicalls files with non-abicalls files%s: linking auto-pic files with non-auto-pic files%s: linking big-endian files with little-endian files%s: linking constant-gp files with non-constant-gp files%s: linking little endian files with big endian files%s: linking non-pic code in a shared library%s: linking trap-on-NULL-dereference with non-trapping files%s: loader reloc in read-only section %s%s: loader reloc in unrecognized section `%s'%s: misplaced XTY_LD `%s'%s: no group info for section %s%s: no initialized registers; section length 0 +%s: no such symbol%s: no symbol "%s"%s: not fully implemented%s: not implemented%s: not supported%s: object size does not match that of target %s%s: pc-relative relocation against dynamic symbol %s%s: probably compiled without -fPIC?%s: register relocation against non-register symbol: %s in %s%s: register relocation against non-register symbol: (unknown) in %s%s: reloc %s:%d not in csect%s: reloc overflow 1: 0x%lx > 0xffff%s: relocateable link from %s to %s not supported%s: relocation %s can not be used when making a shared object; recompile with -fPIC%s: relocation %s cannot be used when making a shared object%s: relocation %s in section %s with no GOT created%s: relocation %s is not allowed for global symbol: `%s' from %s section%s: relocation %s should not be used when making a shared object; recompile with -fPIC%s: relocation %s with non-zero addend %d against local symbol from %s section%s: relocation %s with non-zero addend %d against symbol `%s' from %s section%s: relocation size mismatch in %s section %s%s: relocs in section `%s', but it has no contents%s: short data segment overflowed (0x%lx >= 0x400000)%s: size field is zero in Import Library Format header%s: speculation fixup against undefined weak symbol%s: string not null terminated in ILF object file.%s: string too long (%d chars, max 65535)%s: symbol `%s' has unrecognized csect type %d%s: symbol `%s' has unrecognized smclas %d%s: symbol `%s' required but not present%s: too many initialized registers; section length %ld +%s: tp-relative relocation against dynamic symbol %s%s: unable to find ARM glue '%s' for `%s'%s: unable to find THUMB glue '%s' for `%s'%s: undefined sym `%s' in .opd section%s: undefined versioned symbol name %s%s: unexpected ATN type %d in external part%s: unexpected reloc type %u in .opd section%s: unexpected type after ATN%s: unhandled dynamic relocation against %s%s: unimplemented %s +%s: unimplemented ATI record %u for symbol %u%s: unknown relocation type %d%s: unknown relocation type %d for symbol %s%s: unrecognized symbol `%s' flags 0x%x%s: unresolvable relocation %s against symbol `%s' from %s section%s: unsupported relocation type %s%s: unsupported relocation type 0x%02x%s: unsupported wide character sequence 0x%02X 0x%02X after symbol name starting with `%s' +%s: uses _-prefixed symbols, but writing file with non-prefixed symbols%s: uses different e_flags (0x%lx) fields than previous modules (0x%lx)%s: uses different unknown e_flags (0x%lx) fields than previous modules (0x%lx)%s: uses non-prefixed symbols, but writing file with _-prefixed symbols%s: version count (%ld) does not match symbol count (%ld)%s: warning: %s relocation against symbol `%s' from %s section%s: warning: %s relocation to 0x%x from %s section%s: warning: %s: line number overflow: 0x%lx > 0xffff%s: warning: Empty loadable segment detected, is this intentional ? +%s: warning: GOT addend of %ld to `%s' does not match previous GOT addend of %ld%s: warning: PLT addend of %d to `%s' from %s section ignored%s: warning: allocated section `%s' not in segment%s: warning: duplicate line number information for `%s'%s: warning: illegal symbol index %ld in line numbers%s: warning: illegal symbol index %ld in relocs%s: warning: symbol table too large for mmo, larger than 65535 32-bit words: %d. Only `Main' will be emitted. +%s: warning: unexpected redefinition of `%s'%s: warning: unresolvable relocation %d against symbol `%s' from %s section%s: warning: unresolvable relocation against symbol `%s' from %s section%s:%d: Unexpected character `%s' in S-record file +%s:%d: unexpected character `%s' in Intel Hex file +%s:%u: bad checksum in Intel Hex file (expected %u, found %u)%s:%u: bad extended address record length in Intel Hex file%s:%u: bad extended linear address record length in Intel Hex file%s:%u: bad extended linear start address length in Intel Hex file%s:%u: bad extended start address length in Intel Hex file%s:%u: unrecognized ihex type %u in Intel Hex file +*unknown*.got section not immediately after .plt section32bits gp relative relocation occurs for an external symbol: m32r instructions: m32rx instructions@pltoff reloc against local symbolArchive has no index; run ranlib to add oneArchive object file in wrong formatAttempt to do relocateable link with %s input and %s outputBFD %s assertion fail %s:%dBFD %s internal error, aborting at %s line %d +BFD %s internal error, aborting at %s line %d in %s +Bad valueBase Relocation Directory [.reloc]Bound Import DirectoryCould not find relocation section for %sDebug DirectoryDelay Import DirectoryDeprecated %s called +Deprecated %s called at %s line %d in %s +Description DirectoryDwarf Error: Abbrev offset (%lu) greater than or equal to .debug_abbrev size (%lu).Dwarf Error: Bad abbrev number: %u.Dwarf Error: Can't find .debug_abbrev section.Dwarf Error: Can't find .debug_line section.Dwarf Error: Can't find .debug_str section.Dwarf Error: Could not find abbrev number %u.Dwarf Error: DW_FORM_strp offset (%lu) greater than or equal to .debug_str size (%lu).Dwarf Error: Invalid or unhandled FORM value: %u.Dwarf Error: Line offset (%lu) greater than or equal to .debug_line size (%lu).Dwarf Error: found address size '%u', this reader can not handle sizes greater than '%u'.Dwarf Error: found dwarf version '%u', this reader only handles version 2 information.Dwarf Error: mangled line number section (bad file number).Dwarf Error: mangled line number section.ERROR: %s is compiled as absolute position code, whereas target %s is position independentERROR: %s is compiled as position independent code, whereas target %s is absolute positionERROR: %s is compiled for APCS-%d, whereas %s is compiled for APCS-%dERROR: %s is compiled for APCS-%d, whereas target %s uses APCS-%dERROR: %s is compiled for EABI version %d, whereas %s is compiled for version %dERROR: %s passes floats in float registers, whereas %s passes them in integer registersERROR: %s passes floats in integer registers, whereas %s passes them in float registersERROR: %s uses FPA instructions, whereas %s uses VFP instructionsERROR: %s uses VFP instructions, whereas %s uses FPA instructionsERROR: %s uses hardware FP, whereas %s uses software FPERROR: %s uses software FP, whereas %s uses hardware FPEntry offset = 0x%.8lx (%ld) +Error: First section in segment (%s) starts at 0x%x whereas the segment starts at 0x%xError: out of memoryException Directory [.pdata]Export Directory [.edata (or where ever we found it)]Export Flags %lx +Export RVAFAILED to find previous HI16 reloc +File format is ambiguousFile format not recognizedFile in wrong formatFile too bigFile truncatedFlag field = 0x%.2x +Forwarder RVAGP relative relocation used when GP not definedGP relative relocation when _gp not definedGPDISP relocation did not find ldah and lda instructionsImport Address Table DirectoryImport Directory [parts of .idata]Internal inconsistency: remaining %u != max %u. + Please report this bug.Invalid bfd targetInvalid operationLength = 0x%.8lx (%ld) +Linking mips16 objects into %s format is not supportedLoad Configuration DirectoryMajor/Minor %d/%d +Malformed archiveMemory exhaustedMissing IHCONSTMissing IHIHALFName No Mem !No errorNo more archived filesNo symbolsNonrepresentable section on outputNot enough memory to sort relocationsNumber in: +Object module NOT error-free ! +Ordinal Base %ld +Output file requires shared library `%s' +Output file requires shared library `%s.so.%s' +PASSMECH not fully implementedPTA mismatch: a SHcompact address (bit 0 == 0)PTB mismatch: a SHmedia address (bit 0 == 1)Partition name = "%s" +Partition[%d] end = { 0x%.2x, 0x%.2x, 0x%.2x, 0x%.2x } +Partition[%d] length = 0x%.8lx (%ld) +Partition[%d] sector = 0x%.8lx (%ld) +Please report this bug. +Reading archive file mod timestampRegister %%g%d used incompatibly: %s in %s, previously %s in %sRegister section has contents +ReservedResource Directory [.rsrc]SDA relocation when _SDA_BASE_ not definedSEC_RELOC with no relocs in section %sSection has no contentsSecurity DirectorySize mismatch section %s=%lx, %s=%lxSpecial DirectoryStack overflow (%d) in _bfd_vms_pushStack underflow in _bfd_vms_popSymbol %s not defined for fixups +Symbol %s replaced by %s +Symbol `%s' has differing types: %s in %s, previously REGISTER in %sSymbol `%s' has differing types: REGISTER in %s, previously %s in %sSymbol needs debug section which does not existSystem call errorTOC overflow: 0x%lx > 0x10000; try -mminimal-toc when compilingTable Addresses +Thread Storage Directory [.tls]Time/Date stamp %lx +Unexpected STO_SH5_ISA32 on local symbol is not handledUnhandled OSF/1 core file section type %d +Unhandled relocation %sUnknown basic type %dUnrecognized TI COFF target id '0x%x'Unrecognized relocUnrecognized reloc type 0x%xUnsupported .stab relocationVariable `%s' cannot be in both zero and tiny data regions simultaneouslyWarning, .pdata section size (%ld) is not a multiple of %d +Warning: %s does not support interworking, whereas %s doesWarning: %s supports interworking, whereas %s does notWarning: Clearing the interworking flag of %s because non-interworking code in %s has been linked with itWarning: Clearing the interworking flag of %s due to outside requestWarning: Not setting interworking flag of %s since it has already been specified as non-interworkingWarning: Writing section `%s' to huge (ie negative) file offset 0x%lx.Warning: fixup count mismatch +Warning: size of symbol `%s' changed from %lu to %lu in %sWarning: type of symbol `%s' changed from %d to %d in %sWarning: writing archive was slow: rewriting timestamp +Writing updated armap timestamp[whose name is lost]_bfd_vms_output_counted called with too many bytes_bfd_vms_output_counted called with zero bytesbad section index in %sbfd_make_section (%s) failedbfd_set_section_flags (%s, %x) failedcan't build branch stub `%s'can't find branch stub `%s'could not locate special linker symbol __ctbpcould not locate special linker symbol __epcould not locate special linker symbol __gperror: undefined symbol __rtinitfailed to enter %signoring reloc %s +internal error: dangerous errorinternal error: dangerous relocationinternal error: out of range errorinternal error: unknown errorinternal error: unsupported relocation errorlinkage table error against `%s'local symbols in discarded section %smissing IHCONST relocmissing IHIHALF relocnon-zero addend in @fptr relocnot enough GOT space for local GOT entriesnot mapping: data=%lx mapped=%d +not mapping: env var not set +obj code %d not foundprivate flags = %lxprivate flags = %lx:private flags = %lx: private flags = %x:private flags = 0x%lx:reloc against unsupported sectionreloc not properly alignedreserved CTL cmd %dreserved OPR cmd %dreserved STA cmd %dreserved STO cmd %dsom_sizeof_headers unimplementedstack-entry-mask not fully implementedstack-from-image not implementedstack-literal not fully implementedstack-local-symbol not fully implementedstack-local-symbol-entry-point-mask not fully implementedstatic procedure (no name)stub entry for %s cannot load .plt, dp offset = %ldstubs don't match calculated sizeuncertain calling convention for non-COFF symbolunknown gsd/egsd subtype %dunsupported STA cmd %sunsupported relocunsupported reloc typeusing multiple gp valuesv850 architecturev850e architecturev850ea architecturewarning: %s section has zero sizewarning: %s: local symbol `%s' has no sectionwarning: attempt to export undefined symbol `%s'warning: relocation against removed sectionwarning: relocation against removed section; zeroingwarning: type and size of dynamic symbol `%s' are not definedProject-Id-Version: bfd 2.12.91 +POT-Creation-Date: 2002-07-23 15:55-0400 +PO-Revision-Date: 2002-09-14 23:25+0200 +Last-Translator: Keld Simonsen +Language-Team: Danish +MIME-Version: 1.0 +Content-Type: text/plain; charset=iso-8859-1 +Content-Transfer-Encoding: 8bit + Eksportadressetabel Eksportadressetabel %08lx + Navnepegertabel Ordningstalstabel [Navnepeger/Ordningstal]-tabel %08lx + kodebase %08lx toc (indlæsningsbar/reelt) %08lx/%08lx + relokalisering %4d afstand %4x [%4lx] %s vma: Tips/Ordn Medlemsnavn Bundet til + + DLL-navn: %s + + +PE-filbaserelokaliseringer (tolket indhold i .reloc-sektionen) + + Symbol slut+1: %-7ld Type: %s + Symbol slut+1: %ld + Første symbol: %ld + Lokalt symbol: %ld + Type: %s + enum; symbol slut+1: %ld + struct; symbol slut+1: %ld + union; symbol slut+1: %ld +Karakteristik 0x%x + +Dynamisk sektion: + +Eksportadressetabel -- Ordningsbase %ld + +Funktionsidentifikatorer fundet på startadressen: %04lx + +Ingen reldata-sektion! Funktionsidentifikatorer afkodedes ikke. + +Start på partition[%d] = { 0x%.2x, 0x%.2x, 0x%.2x, 0x%.2x } + +Programhoved: + +Eksporttabellerne (tolket indhold i %s-sektion) + +Funktionstabellen (tolket indhold fra .pdata-sektionen) + +Importtabellerne (tolket indhold i %s-sektion) + +Der findes en første thunk, men sektionen som indeholder den kunne ikke findes + +Der findes en eksporttabel i %s ved 0x%lx + +Der findes en eksporttabel, men sektionen som indeholder den kunne ikke findes + +Der findes en importtabel i %s på 0x%lx + +Der findes en importtabel, men sektionen som indeholder den kunne ikke findes + +Versionsreferencer: + +Versionsdefinitioner: + +Virtuel adresse: %08lx Områdesstørrelse %ld (0x%lx) Antal rettelser %ld + +[Ordningstals-/Navnepeger-]tabel + +ppcboot-hoved: + overvej omlænkning med --support-old-code aktiveret første forekomst: %s: arm-kald til thumb første forekomst: %s: thumb-kald til arm kræves fra %s: + Klisterkodesekvens Registergenskabnings millikode Registergemnings millikode [32-bittilstand] [FPA-flydende talsformat] [VFP-flydende talsformat] [Version1 EABI] [Version2 EABI] [ukendt abi] [abi=64] [abi=EABI32] [abi=EABI64] [abi=N32] [abi=O32] [abi=O64] [absolut position] [cpu32] [d-flydende tal] [dynamiske symboler bruger segmentindex] [flydende tal overført i flydendetalsregistre] [flydende tal overført i heltalsregistre] [g-flydende tal] [har startpunkt] [samvirkende er aktiveret] [samvirkendeflag er ikke initieret] [samvirken understøttes ikke] [samvirken understøttes] [m68000] [mapningssymboler foretrækkes frem for andre] [mdmx] [mips16] [mips1] [mips2] [mips32] [mips3] [mips4] [mips5] [mips64] [nyt ABI] [intet abi sat] [ikke-pic] [ikke 32-bittilstand] [gammelt ABI] [positionsuafhængigt] [relokaliseringsbar kørbar fil] [programmeret FP] [sorteret symboltabel] [symboler har et _-prefix] [ukendt ISA] [usorteret symboltabel] vma: Startadresse Slutadresse Tilbagespolings-information + vma: Start- Slut- EH- EH- Prologsluts- Undtagelses- + adresse adresse håndterer data adresse maske + vma: Tips- Tids- Fremad- DLL- Første + tabel stempel kæde navn thunk +#%s (%s): Sektionsflaget %s (0x%x) ignoreredes%s(%s): advarsel: samvirken er ikke aktiveret.%s(%s+0x%lx): %s relokalisering mod SEC_MERGE-sektion%s(%s+0x%lx): Stabpost har ugyldigt strengindex.%s(%s+0x%lx): kan ikke håndtere %s for %s%s(%s+0x%lx): kan ikke nå %s, genoversæt med -ffunction-sections%s(%s+0x%lx): retter %s%s(%s+0x%lx): relokalisering mod "%s": fejl %d%s(%s+0x%lx): uløselig relokalisering mod symbol "%s"%s, sektion %s: + relokaliseringen %s bør ikke bruges i et delt objekt; genoversæt med -fPIC%s: !samegp-relokalisering mod symbol uden .prologue: %s%s: %s+0x%lx: hop til stubrutine som ikke er jal%s: %s: ugyldig krævet version %d%s: %s: ugyldig version %u (max %d)%s: %s: relokalisering giver overløb: 0x%lx > 0xffff%s: .got-subsegment overskrider 64 kB (størrelse %d)%s: .opd er ikke en almindelig vektor med opd-poster%s: .preinit_array-sektionen er ikke tilladt i DSO%s: 0x%lx: fatalt: relokalisering giver overløb ved forenklingen%s: 0x%lx: fatalt: ujusteret grenmål for relokalisering for forenklingsunderstøttelse%s: 0x%lx: advarsel: R_SH_USES peger til ukendt instruktion 0x%x%s: 0x%lx: advarsel: fejlagtig R_SH_USES-indlæsningsafstand%s: 0x%lx: advarsel: fejlagtig R_SH_USES-afstand%s: 0x%lx: advarsel: fejlagtigt antal%s: 0x%lx: advarsel: kunne ikke finde forventet COUNT-relokalisering%s: 0x%lx: advarsel: kunne ikke finde forventet relokalisering%s: 0x%lx: advarsel: symbol i uventet sektion%s: @gprel-relokalisering mod dynamisk symbol %s%s: ABI passer ikke: lænker %s-modul med tidligere %s-moduler%s: Arkitekturen passer ikke sammen med tidligere moduler%s: Fejlagtig relokaliseringstype importeret: %d%s: Fejlagtig symboldefinition: "Main" er sat til %s i stedet for startadressen %s +%s: CALL16-relokalisering ved 0x%lx er ikke mod globalt symbol%s: Fejl: flere definitioner af "%s"; begyndelsen på %s er sat i en tidligere lænket fil +%s: GAS-fejl: uventet PTB-instruktion med R_SH_PT_16%s: ISA (%d) passer ikke med tidligere moduler (%d)%s: ISA (-mips%d) passer ikke med tidligere moduler (-mips%d)%s: Instruktionsopsætning passer ikke med tidligere moduler%s: Intern inkonsistensfejl for værdien for + lænkerallokeret globalt register: lænket: 0x%lx%08lx != afslappet: 0x%lx%08lx +%s: Intern inkonsistens; ingen relokaliseringssektion %s%s: Ugyldig relokaliseringstype eksporteret: %d%s: Ugyldig relokaliseringstype importeret: %d%s: LOCAL-direktiv: Register $%ld er ikke et lokalt register. Første globale register er $%ld.%s: Fejlagtig relokalisering for sektion %s opdaget%s: Hverken nogen PLT eller GOT for relokalisering %s mod symbol "%s" fra sektionen %s%s: Ingen kerne til at allokere et %d byte langt symbol +%s: Ingen kerne til at allokere sektionsnavn %s +%s: Ikke tilstrækkeligt med plads for programhoveder (allokerede %u, behøver %u)%s: Ikke tilstrækkeligt med plads for programhoveder, forsøg at lænke med -N%s: Kun register %%g[2367] kan deklareres med STT_REGISTER%s: Kendt men uhåndteret maskintype (0x%x) i Import Library Format-arkiv%s: Relokalisering %s (%d) understøttes ikke i øjeblikket. +%s: Relokaliseringen %s understøttes ikke for symbol %s.%s: Relokaliseringen %s understøttes ikke endnu for symbol %s.%s: Relokalisering i generisk ELF (EM: %d)%s: Sektionen %s er for stor til at stoppa hul med %ld byte i%s: lokal TLS-eksekveringskode kan ikke lænkes ind i delte objekter%s: TOC-relokalisering ved 0x%x til symbolet "%s" uden nogen TOC-post%s: Målet (%s) for en %s-relokalisering er i forkert uddatasektion (%s)%s: Målet (%s) for en %s-relokalisering er i forkert sektion (%s)%s: Uhåndteret importtype; %x%s: Ukendt relokaliseringstype %d +%s: Ukendt sektionstype i a.out.adobe-fil: %x +%s: Ukendt speciallænkertype %d%s: Ukendt importnavnstype; %x%s: Ukendt importtype; %x%s: Ukendt maskintype (0x%x) i Import Library Format-arkiv%s: Ukendt lagringsklasse %d for %s-symbolet "%s"%s: Advarsel: Arm BLX-instruktion bruger Arm-funktionen "%s" som mål.%s: Advarsel: Thumb BLX-instruktionen bruger thumb-funktionen "%s" som mål.%s: XCOFF delt objekt når ikke XCOFF-uddata produceres%s: XMC_TC0-symbol "%s" er klasse %d scnlen %d%s: __gp dækker ikke kort datasegment%s: "%s" kaldt både som lokalt normalt symbol og lokalt trådsymbol%s: "%s" har linjenumre men ingen omsluttende sektion%s: "%s" i indlæserrelokalisering men ikke indlæsersym%s: "ld -r" understøttes ikke med PE MIPS-objekt +%s: adgang udover slutningen på sammenslagt sektion (%ld + %ld)%s: adressen 0x%s er udenfor intervallet for hexadecimal Intel-fil%s: fejlagtig XTY_ER-symbol "%s": klasse %d scnum %d scnlen %d%s: fejlagtigt par/reflo efter refhi +%s: fejlagtig relokaliseringsadresse 0x%lx i sektionen "%s"%s: fejlagtig relokaliseringssektionsnavn "%s"%s: fejlagtig sektionslængde i ihex_read_sektion%s: fejlagtig strengtabelstørrelse %lu%s: fejlagtigt symbolindex: %d%s: base-plus-afstandsrelokalisering mod registersymbol: %s i %s%s: base-plus-afstandsrelokalisering mod registersymbol: (ukendt) i %s%s: kan ikke repræsentere sektionen "%s" i a.out-objektfilformat%s: kan ikke repræsentere sektionen "%s" i oasys%s: kan ikke repræsentere sektion for symbolet "%s" i a.out-objektfilformat%s: kan ikke allokere filnavn for fil nummer %d, %d byte +%s: kan ikke oprette stubstarten %s%s: ændring i gp: BRSGP %s%s: check_relocs: uhåndteret relokaliseringstype %d%s: klasse %d-symbol "%s" har ingen ydre poster%s: kompileret som 32-bitsobjekt og %s er 64-bit%s: kompileret som 64-bitsobjekt og %s er 32-bit%s: kompileret for et 64-bitssystem og målet er 32-bit%s: kompileret for et big endian-system og målet er little endian%s: kompileret for et little endian-system og målet er big endian%s: kompileret normalt og lænket med moduler som kompileredes med -mrelocatable%s: kompileret med %s og lænket med moduler som kompileredes med %s%s: kompileret med %s og lænket med moduler som bruger ikke-pic-relokalisering%s: kompileret med -mrelocatable og lænket med moduler som kompileredes normalt%s: kunne ikke finde uddatasektionen %s%s: kunne ikke finde uddatasektionen %s for inddatasektionen %s%s: kunne ikke udskrive tilføjede .cranges-poster%s: kunne ikke udskrive sorterede cranges-poster%s: csect "%s" er ikke i omsluttende sektion%s: LOCAL-direktivet er kun gyldigt med et register eller en absolutværdi%s: dtp-relativ relokalisering mod dynamisk symbol %s%s: dobbelt eksportstub %s%s: dynamisk objekt uden nogen .loader-sektion%s: dynamisk relokalisering uden spekulationsrettelser%s: mødte dataetikettesymbol i inddata%s: fejl: relokaliseringen %s er ikke en multipel af 4%s: fejl: ujusteret relokaliseringstype %d på %08x relokalisering %08x +%s: gp-relativ relokalisering mod dynamisk symbol %s%s: utilladt relokaliseringstype %d på adresse 0x%lx%s: ugyldigt sektionsnavn "%s"%s: utilladt symbolindex i relokalisering: %d%s: indirekte symbol "%s" til "%s" er en løkke%s: intern fejl i ihex_read_section%s: intern fejl, den interne registersektion %s havde indhold +%s: intern fejl, symboltabellen ændrede størrelse fra %d til %d ord +%s: ugyldig SHT_GROUP-post%s: ugyldig lænke %lu for relokaliseringssektion %s (index %u)%s: ugyldig mmo-fil: YZ i lop_end (%ld) er ikke lig med antal af tetraer til den foregående lop_stab (%ld) +%s: ugyldig mmo-fil: forventede YZ = 1 fik YZ = %d for lop_quote +%s: ugyldig mmo-fil: forventede y = 0, fik y = %d for lop_fixrx +%s: ugyldig mmo-fil: forventede z = 1 eller z = 2, fik z = %d for lop_fixo +%s: ugyldig mmo-fil: forventede z = 1 eller z = 2, fik z = %d for lop_loc +%s: ugyldig mmo-fil: forventede z = 16 eller z = 24, fik z = %d for lop_fixr +%s: ugyldig mmo-fil: felter y og z i lop_stab er ikke-tomme, y: %d, z: %d +%s: ugyldig mmo-fil: filnavnet for nummer %d blev ikke angivet inden brug +%s: ugyldig mmo-fil: fil nummer %d "%s", var allerede angivet som "%s" +%s: ugyldig mmo-fil: initieringsværdi for $255 er ikke "Main" +%s: ugyldig mmo-fil: indledende byte i operandord skal være 0 eller 1, fik %d for lop_fixrx +%s: ugyldig mmo-fil: lop_end er ikke sidste objekt i fil +%s: ugyldig mmo-fil: lopkode "%d" understøttes ikke +%s: ugyldig relokaliseringstype %d%s: ugyldig startadresse for initierede registre med længden %ld: 0x%lx%08lx +%s: ugyldig strengafstand %u >= %lu for sektionen "%s"%s: ugyldig symboltabel: dubletsymbol "%s" +%s: hop for langt bort +%s: linjenummer giver overløb: 0x%lx > 0xffff%s: lænker 64-bitfiler med 32-bitfiler%s: lænker PIC-filer med ikke-PIC-filer%s: lænker UltraSPARC-specifik med HAL-specifik kode%s: lænker abicalls-filer med ikke-abicalls-filer%s: lænker auto-pic-filer med ikke-auto-pic-filer%s: lænker big endian-filer med little endian-filer%s: lænker konstant-gp-filer med ikke-konstant-gp-filer%s: lænker little endian-filer med big endian-filer%s: lænker ikke-pic-kode i delt bibliotek%s: lænker fang-ved-NULL-dereference med ikkefangende filer%s: indlæserrelokalisering i skrivebeskyttet sektion %s%s: indlæserrelokalisering i ukendt sektion "%s"%s: fejlagtigt placeret XTY_LD "%s"%s: ingen gruppeinformation for sektionen %s%s: ingen initierede registre; sektionslængde 0 +%s: intet sådant symbol%s: intet symbol "%s"%s: ikke helt implementeret%s: ikke implementeret%s: understøttes ikke%s: objektstørrelsen stemmer ikke overens med den hos målet %s%s: pc-relativ relokalisering mod dynamisk symbol %s%s: nok kompileret uden -fPIC?%s: registerrelokalisering mod ikke-registersymbol: %s i %s%s: registerrelokalisering mod ikke-registersymbol: (ukendt) i %s%s: relokaliseringen %s:%d er ikke i csect%s: relokalisering giver overløb 1: 0x%lx > 0xffff%s: relokaliseringsbar lænke fra %s til %s understøttes ikke%s: relokaliseringen %s kan ikke bruges når et delt objekt oprettes; genoversæt med -fPIC%s: relokaliseringen %s kan ikke bruges når et delt objekt oprettes%s: relokalisering %s i sektionen %s uden GOT oprettet%s: relokaliseringen %s er ikke tilladt for globalt symbol: "%s" fra sektionen %s%s: relokaliseringen %s bør ikke bruges når et delt objekt oprettes; genoversæt med -fPIC%s: relokalisering %s med ikke-tomt addendum %d mod lokalt symbol fra sektionen %s%s: relokalisering %s med ikke-tomt addendum %d mod symbol "%s" fra sektionen %s%s: relokaliseringsstørrelsen stemmer ikke overens i %s-sektionen %s%s: relokaliseringer i sektionen "%s", men den har intet indhold%s: kort datasegment løb over (0x%lx >= 0x400000)%s: størrelsesfeltet er nul i Import Library Format-hoved%s: spekulationsfix mod udefineret svagt symbol%s: streng ikke nultermineret i ILF-objektfil.%s: strengen er for lang (%d tegn, max 65535)%s: symbol "%s" har ukendt csect-type %d%s: symbolet "%s" har ukendt smclas %d%s: symbol "%s" kræves men er ikke tilstede%s: for mange initierede registre; sektionslængde %ld +%s: tp-relativ relokalisering mod dynamisk symbol %s%s: kunne ikke finde ARM-klistret "%s" til "%s"%s: kunne ikke finde THUMB-klistret "%s" til "%s"%s: udefineret symbol "%s" i .opd-sektion%s: udefineret symbolnavn med version %s%s: uventet ATN-type %d i ekstern del%s: uventet relokaliseringstype %u i .opd-sektion%s: uventet type efter ATN%s: uhåndteret dynamisk relokalisering mod %s%s: uimplementeret %s +%s: ikke implementeret ATI-post %u for symbol %u%s: ukendt relokaliseringstype %d%s: ukendt relokaliseringstype %d for symbol %s%s: ukendt symbol "%s" flag 0x%x%s: uløselig relokalisering %s mod symbol "%s" fra sektionen %s%s: relokaliseringstypen %s understøttes ikke%s: relokaliseringstypen 0x%02x understøttes ikke%s: bred tegnsekvens som ikke understøttes 0x%02X 0x%02X efter symbolnavnet som begynder med "%s" +%s: bruger symboler med _-prefix, men skriver fil med symboler uden prefix%s: bruger andre e_flags-felter (0x%lx) end tidligere moduler (0x%lx)%s: bruger andre ukendte e_flags-felter (0x%lx) end tidligere moduler (0x%lx)%s: bruger symboler uden prefix, men skriver fil med symboler med _-prefix%s: versionsantal (%ld) stemmer ikke med symbolantal (%ld)%s: advarsel: %s-relokalisering mod symbol "%s" fra sektionen %s%s: advarsel: %s-relokalisering til 0x%x fra sektionen %s%s: advarsel: %s: linjenummer giver overløb: 0x%lx > 0xffff%s: advarsel: Tomt indlæsningsbart segment opdaget, er dette meningen? +%s: advarsel: GOT-addendum %ld til "%s" stemmer ikke overens med tidligere GOT-addendum %ld%s: advarsel: PLT-addendum %d til "%s" fra sektionen %s ignoreredes%s: advarsel: allokeret sektion "%s" ikke i segment%s: advarsel: dobbelt linjenummersinformation for "%s"%s: advarsel: utilladt symbolindex %ld i linjenumre%s: advarsel: utilladt symbolindex %ld i relokaliseringerne%s: advarsel: symboltabellen er for stor for mmo, større end 65535 32-bit ord: %d. Kun "Main" vil blive sendt. +%s: advarsel: uventet omdefinition af "%s"%s: advarsel: uløselig relokalisering %d mod symbol "%s" fra sektionen %s%s: advarsel: uløselig relokalisering mod symbol "%s" fra sektionen %s%s:%d: Uventet tegn "%s" i S-postfil +%s:%d: uventet tegn "%s" i hexadecimal Intel-fil +%s:%u: fejlagtig kontrolsum i hexadecimal Intel-fil (forventede %u, fandt %u)%s:%u: fejlagtig længde på post for udvidet adresse i hexadecimal Intel-fil%s:%u: fejlagtig længde på post for udvidet lineær adresse i hexadecimal Intel-fil%s:%u: fejlagtig længde på post for udvidet lineær startadresse i hexadecimal Intel-fil%s:%u: fejlagtig længde på udvidet startadresse i hexadecimal Intel-fil%s:%u: ukendt ihex-type %u i hexadecimal Intel-fil +*ukendt*.got-sektionen følger ikke umiddelbart efter .plt-sektion32-bit gp-relativ relokalisering forekom for et eksternt symbol: m32r-instruktioner: m32rx-instruktioner@pltoff-relokalisering mod lokalt symbolArkivet har intet index; kør ranlib til at tilføje étArkivobjektfil er i forkert formatForsøg at lave en relokaliseringsbar lænke med %s-inddata og %s-uddataBFD %s-forsikring mislykkedes %s:%dInternt BFD %s-fejl, afbryder ved %s linje %d +Intern BFD %s-fejl, afbryder ved %s linje %d i %s +Fejlagtigt værdiBaserelokaliseringskatalog [.reloc]Katalog over bundne importerKunne ikke finde relokaliseringssektion for %sFejlsøgningskatalogKatalog over forskinkede importerForældet %s kaldt +Forældet %s kaldt ved %s linje %d i %s +BeskrivelseskatalogDwarf-fejl: Forkortelsesafstanden (%lu) større end eller lig med størrelsen .debug_abbrev (%lu).Dwarf-fejl: Fejlagtigt forkortelsesnummer: %u.Dwarf-fejl: Kan ikke finde sektionen .debug_abbrev.Dwarf-fejl: Kan ikke finde sektionen .debug_line.Dwarf-fejl: Kan ikke finde sektionen .debug_str.Dwarf-fejl: Kunne ikke finde forkortelsesnumret %u.Dwarf-fejl: DW_FORM_strp-afstanden (%lu) større end eller lig med størrelsen på .debug_str (%lu).Dwarf-fejl: Ugyldig eller ubehandlet FORM-værdi: %u.Dwarf-fejl: Linjeafstanden (%lu) større end eller lig med størrelsen .debug_line (%lu).Dwarf-fejl: fandt adressestørrelsen "%u", denne læser kan ikke håndtere størrelser større end "%u".Dwarf-fejl: fandt dwarf version "%u", denne læser håndterer kun information fra version 2.Dwarf-fejl: vanskabt linjenummerssektion (fejlagtigt filnummer).Dwarf-fejl: vanskabt linjenummerssektion.FEJL: %s er kompileret som kode med absolut position, mens målet %s er positionsuafhængigtFEJL: %s er kompileret som positionsuafhængig kode, mens målet %s har absolut positionFEJL: %s kompileret for APCS-%d, mens %s er kompileret for APCS-%dFEJL: %s er kompileret for APCS-%d, mens målet %s bruger APCS-%dFEJL: %s er kompileret for EABI version %d, mens %s er kompileret for version %dFEJL: %s overfører flydende tal i flydendetalsregister, mens %s overfører dem i heltalsregisterFEJL: %s overfører flydende tal i heltalsregister, mens %s overfører dem i flydendetalsregisterFEJL: %s bruger FPA-instruktioner, mens %s bruger VFP-instruktionerFEJL: %s bruger VFP-instruktioner, mens %s bruger FPA-instruktionerFEJL: %s bruger maskinens flydende tal, mens %s bruger programmeret flydende talFEJL: %s bruger programmeret flydende tal, mens %s bruger maskinens flydende talStartefstand = 0x%.8lx (%ld) +Fejl: Første sektion i segmentet (%s) begynder ved 0x%x mens segmentet begynder ved 0x%xFejl: ikke mere hukommelseUndtagelseskatalog [.pdata]Eksportkatalog [.edata (eller hvor vi fandt det)]Eksportflag %lx +Eksport-RVAMISLYKKEDES med at finde tidligere HI16-relokalisering +Filformatet er flertydigtFilformatet ikke genkendtFilen er i forkert formatFilen er for storFilen trunkeretFlagfelt = 0x%.2x +Videresender-RVAGP-relativ relokalisering bruges når GP ikke er defineretGP-relativ relokalisering når _gp ikke var defineretGPDISP-relokalisering fandt ingen ldah- og lda-instruktionerImportadressetabelkatalogImportkatalog [dele af .idata]Intern inkonsekvens: genstående %u != max %u. + Rapportér gerne denne fejl.Ugyldigt bfd-målUgyldig handlingLængde = 0x%.8lx (%ld) +Lænkning af mips16-objekter til %s-format understøttes ikkeIndlæsningskonfigurationskatalogStørre/mindre %d/%d +Forvansket arkivHukommelsen er opbrugtIHCONST manglerIHIHALF manglerNavn Ingen hukommelse!Ingen fejlIkke flere arkiverede filerIngen symbolerIkkerepræsenterbar sektion i uddataIkke nok hukommelse til at sortere relokaliseringerTal i: +Objektmodulet IKKE fejlfri! +Ordningsbase %ld +Uddatafilen kræver delt bibliotek "%s" +Uddatafilen kræver delt bibliotek "%s.so.%s" +PASSMECH er ikke helt implementeretPTA passer ikke: en SHcompact-adresse (bit 0 == 0)PTB passer ikke: en SHmedia-adresse (bit 0 == 1)Partitionsnavn = "%s" +Slut på partition[%d] = { 0x%.2x, 0x%.2x, 0x%.2x, 0x%.2x } +Længde på partition[%d] = 0x%.8lx (%ld) +Sektor for partition[%d] = 0x%.8lx (%ld) +Rapportér gerne denne fejl. +Læser arkivfilens ændringstidsstempelRegister %%g%d brugt inkompatibelt: %s i %s, tidligere %s i %sRegistersektion har indhold +ReserveretResursekatalog [.rsrc]SDA-relokalisering når _SDA_BASE_ ikke er defineretSEC_RELOC uden relokaliseringer i sektion %sSektionen har intet indholdSikkerhedskatalogStørrelsen passer ikke på sektion %s=%lx, %s=%lxSpecialkatalogStakken giver overløb (%d) i _bfd_vms_pushStakken giver underløb i _bfd_vms_popSymbol %s er ikke defineret for rettelser +Symbol %s erstattet med %s +Symbol "%s" har forskellige typer: %s i %s, tidligere REGISTER i %sSymbol "%s" har forskellige typer: REGISTER i %s, tidligere %s i %sSymbolet kræver fejlsøgningssektion som ikke eksistererSystemkaldsfejlTOC giver overløb: 0x%lx > 0x10000; prøv -mminimal-toc ved kompileringTabeladresser +Trådlagringskatalog [.tls]Tids/datostempel %lx +Uventet STO_SH5_ISA32 på lokalt symbol håndteres ikkeUhåndteret sektionstype %d for OSF/1-hukommelsesfil +Uhåndteret relokalisering %sUkendt grundtype %dUkendt TI COFF-mål-id "0x%x"Ukendt relokaliseringUkendt relokaliseringstype 0x%x.stab-relokalisering som ikke understøttesVariabel "%s" kan ikke være i både tomme og bittesmå dataområder samtidigtAdvarsel, størrelsen på .pdata-sektionen (%ld) er ikke en multipel af %d +Advarsel: %s understøtter ikke samvirken, mens %s derimod gør detAdvarsel: %s understøtter samvirken, mens %s derimod ikke gør detAdvarsel: Fjerner samvirkendeflaget i %s eftersom ikke-samvirkende kode i %s er lænket med detAdvarsel: Fjerner samvirkeflaget for %s på grund af anmodning udefraAdvarsel: Sætter ikke samvirkeflaget for %s da den allerede er angivet som ikke-samvirkendeAdvarsel: Skrivning af sektionen "%s" til enorm (dvs negativ) afsætsbyte 0x%lx.Advarsel: antal rettelser stemmer ikke +Advarsel: størrelsen på symbol "%s" ændredes fra %lu til %lu i %sAdvarsel: typen på symbol "%s" ændredes fra %d til %d i %sAdvarsel: arkivskrivning var langsom: genskriver tidsstempel +Skriver opdateret armap-tidsstempel[hvis navn er tabt]_bfd_vms_output_counted called kaldt med for mange byte_bfd_vms_output_counted kaldt med nul bytefejlagtigt sektionsindex i %sbfd_make_section (%s) mislykkedesbfd_set_section_flags (%s, %x) mislykkedeskan ikke bygge grenstub "%s"kan ikke finde grenstub "%s"kunne ikke lokalisere specielt lænkersymbol __ctbpkunne ikke lokalisere specielt lænkersymbol __epkunne ikke lokalisere specielt lænkersymbol __gpfejl: udefineret symbol __rtinitmislykkedes med at gå ind i %signorerer relokalisering %s +intern fejl: farlig fejlintern fejl: farlig relokaliseringintern fejl: udenfor intervalletintern fejl: ukendt fejlintern fejl: relokaliseringen understøttes ikkelænketabelsfejl mod "%s"lokale symboler i bortkastet sektion %sIHCONST-relokalisering manglerIHIHALF-relokalisering manglerikke-tomt addendum i @fptr-relokaliseringikke nok med GOT-plads for lokale GOT-postermapper ikke: data=%lx mappet=%d +mapper ikke: miljøvariabel er ikke sat +objektkode %d kunne ikke findesprivate flag = %lxprivate flag = %lx:private flag = %lx: private flag = %x:private flag = 0x%lx:relokalisering mod sektion som ikke understøttesrelokalisering ikke på lige grænsereserveret CTL-kommando %dreserveret OPR-kommando %dreserveret STA-kommando %dreserveret STO-kommando %dsom_sizeof_headers er ikke implementeretstack-entry-mask er ikke helt implementeretstack-from-image er ikke implementeretstack-literal er ikke helt implementeretstack-local-symbol er ikke helt implementeretstack-local-symbol-entry-point-mask er ikke helt implementeretstatisk procedure (intet navn)stubpost for %s kan ikke læse in .plt, dp-afstand = %ldstubbe stemmer ikke overens med beregnet størrelseusikker kaldskonvention for ikke-COFF-symbolukendt gsd/egsd-undertype %dSTA-kommando %s understøttes ikkerelokaliseringen understøttes ikkerelokaliseringstypen understøttes ikkebruger flere gp-værdierv850-arkitekturv850e-arkitekturv850ea-arkitekturadvarsel: %s-sektionen har nulstørrelseadvarsel: %s: lokalt symbol "%s" har ingen sektionadvarsel: forsøg på at eksportere udefineret symbol "%s"advarsel: relokalisering mod fjernet sektionadvarsel: relokalisering mod fjernet sektion; nulstilleradvarsel: typen og størrelsen på dynamisk symbol "%s" er ikke defineret \ No newline at end of file diff -Nurpa binutils-2.13/bfd/po/da.po binutils-2.13.1/bfd/po/da.po --- binutils-2.13/bfd/po/da.po 1969-12-31 19:00:00.000000000 -0500 +++ binutils-2.13.1/bfd/po/da.po 2002-11-07 12:05:08.000000000 -0500 @@ -0,0 +1,2745 @@ +# Danish messages for bfd. +# Copyright (C) 2001, 2002 Free Software Foundation, Inc. +# Keld Simonsen , 2002 +# +msgid "" +msgstr "" +"Project-Id-Version: bfd 2.12.91\n" +"POT-Creation-Date: 2002-07-23 15:55-0400\n" +"PO-Revision-Date: 2002-09-14 23:25+0200\n" +"Last-Translator: Keld Simonsen \n" +"Language-Team: Danish \n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=iso-8859-1\n" +"Content-Transfer-Encoding: 8bit\n" + +#: aout-adobe.c:197 +#, c-format +msgid "%s: Unknown section type in a.out.adobe file: %x\n" +msgstr "%s: Ukendt sektionstype i a.out.adobe-fil: %x\n" + +#: aout-cris.c:208 +#, c-format +msgid "%s: Invalid relocation type exported: %d" +msgstr "%s: Ugyldig relokaliseringstype eksporteret: %d" + +#: aout-cris.c:252 +#, c-format +msgid "%s: Invalid relocation type imported: %d" +msgstr "%s: Ugyldig relokaliseringstype importeret: %d" + +#: aout-cris.c:263 +#, c-format +msgid "%s: Bad relocation record imported: %d" +msgstr "%s: Fejlagtig relokaliseringstype importeret: %d" + +#: aoutx.h:1282 aoutx.h:1699 +#, c-format +msgid "%s: can not represent section `%s' in a.out object file format" +msgstr "%s: kan ikke repræsentere sektionen \"%s\" i a.out-objektfilformat" + +#: aoutx.h:1669 +#, c-format +msgid "%s: can not represent section for symbol `%s' in a.out object file format" +msgstr "%s: kan ikke repræsentere sektion for symbolet \"%s\" i a.out-objektfilformat" + +#: aoutx.h:1671 +msgid "*unknown*" +msgstr "*ukendt*" + +#: aoutx.h:3732 +#, c-format +msgid "%s: relocateable link from %s to %s not supported" +msgstr "%s: relokaliseringsbar lænke fra %s til %s understøttes ikke" + +#: archive.c:1826 +msgid "Warning: writing archive was slow: rewriting timestamp\n" +msgstr "Advarsel: arkivskrivning var langsom: genskriver tidsstempel\n" + +#: archive.c:2093 +msgid "Reading archive file mod timestamp" +msgstr "Læser arkivfilens ændringstidsstempel" + +#. FIXME: bfd can't call perror. +#: archive.c:2120 +msgid "Writing updated armap timestamp" +msgstr "Skriver opdateret armap-tidsstempel" + +#: bfd.c:274 +msgid "No error" +msgstr "Ingen fejl" + +#: bfd.c:275 +msgid "System call error" +msgstr "Systemkaldsfejl" + +#: bfd.c:276 +msgid "Invalid bfd target" +msgstr "Ugyldigt bfd-mål" + +#: bfd.c:277 +msgid "File in wrong format" +msgstr "Filen er i forkert format" + +#: bfd.c:278 +msgid "Archive object file in wrong format" +msgstr "Arkivobjektfil er i forkert format" + +#: bfd.c:279 +msgid "Invalid operation" +msgstr "Ugyldig handling" + +#: bfd.c:280 +msgid "Memory exhausted" +msgstr "Hukommelsen er opbrugt" + +#: bfd.c:281 +msgid "No symbols" +msgstr "Ingen symboler" + +#: bfd.c:282 +msgid "Archive has no index; run ranlib to add one" +msgstr "Arkivet har intet index; kør ranlib til at tilføje ét" + +#: bfd.c:283 +msgid "No more archived files" +msgstr "Ikke flere arkiverede filer" + +#: bfd.c:284 +msgid "Malformed archive" +msgstr "Forvansket arkiv" + +#: bfd.c:285 +msgid "File format not recognized" +msgstr "Filformatet ikke genkendt" + +#: bfd.c:286 +msgid "File format is ambiguous" +msgstr "Filformatet er flertydigt" + +#: bfd.c:287 +msgid "Section has no contents" +msgstr "Sektionen har intet indhold" + +#: bfd.c:288 +msgid "Nonrepresentable section on output" +msgstr "Ikkerepræsenterbar sektion i uddata" + +#: bfd.c:289 +msgid "Symbol needs debug section which does not exist" +msgstr "Symbolet kræver fejlsøgningssektion som ikke eksisterer" + +#: bfd.c:290 +msgid "Bad value" +msgstr "Fejlagtigt værdi" + +#: bfd.c:291 +msgid "File truncated" +msgstr "Filen trunkeret" + +#: bfd.c:292 +msgid "File too big" +msgstr "Filen er for stor" + +#: bfd.c:293 +msgid "#" +msgstr "#" + +#: bfd.c:700 +#, c-format +msgid "BFD %s assertion fail %s:%d" +msgstr "BFD %s-forsikring mislykkedes %s:%d" + +#: bfd.c:719 +#, c-format +msgid "BFD %s internal error, aborting at %s line %d in %s\n" +msgstr "Intern BFD %s-fejl, afbryder ved %s linje %d i %s\n" + +#: bfd.c:723 +#, c-format +msgid "BFD %s internal error, aborting at %s line %d\n" +msgstr "Internt BFD %s-fejl, afbryder ved %s linje %d\n" + +#: bfd.c:725 +msgid "Please report this bug.\n" +msgstr "Rapportér gerne denne fejl.\n" + +#: binary.c:306 +#, c-format +msgid "Warning: Writing section `%s' to huge (ie negative) file offset 0x%lx." +msgstr "Advarsel: Skrivning af sektionen \"%s\" til enorm (dvs negativ) afsætsbyte 0x%lx." + +# src/menus.c:341 +#: coff-a29k.c:119 +msgid "Missing IHCONST" +msgstr "IHCONST mangler" + +# src/menus.c:341 +#: coff-a29k.c:180 +msgid "Missing IHIHALF" +msgstr "IHIHALF mangler" + +#: coff-a29k.c:212 coff-or32.c:229 +msgid "Unrecognized reloc" +msgstr "Ukendt relokalisering" + +#: coff-a29k.c:408 +msgid "missing IHCONST reloc" +msgstr "IHCONST-relokalisering mangler" + +#: coff-a29k.c:498 +msgid "missing IHIHALF reloc" +msgstr "IHIHALF-relokalisering mangler" + +#: coff-alpha.c:881 coff-alpha.c:918 coff-alpha.c:1989 coff-mips.c:1432 +msgid "GP relative relocation used when GP not defined" +msgstr "GP-relativ relokalisering bruges når GP ikke er defineret" + +#: coff-alpha.c:1485 +msgid "using multiple gp values" +msgstr "bruger flere gp-værdier" + +#: coff-arm.c:1066 elf32-arm.h:285 +#, c-format +msgid "%s: unable to find THUMB glue '%s' for `%s'" +msgstr "%s: kunne ikke finde THUMB-klistret \"%s\" til \"%s\"" + +#: coff-arm.c:1096 elf32-arm.h:320 +#, c-format +msgid "%s: unable to find ARM glue '%s' for `%s'" +msgstr "%s: kunne ikke finde ARM-klistret \"%s\" til \"%s\"" + +#: coff-arm.c:1391 coff-arm.c:1486 elf32-arm.h:887 elf32-arm.h:991 +#, c-format +msgid "%s(%s): warning: interworking not enabled." +msgstr "%s(%s): advarsel: samvirken er ikke aktiveret." + +#: coff-arm.c:1395 elf32-arm.h:994 +#, c-format +msgid " first occurrence: %s: arm call to thumb" +msgstr " første forekomst: %s: arm-kald til thumb" + +#: coff-arm.c:1490 elf32-arm.h:890 +#, c-format +msgid " first occurrence: %s: thumb call to arm" +msgstr " første forekomst: %s: thumb-kald til arm" + +#: coff-arm.c:1493 +msgid " consider relinking with --support-old-code enabled" +msgstr " overvej omlænkning med --support-old-code aktiveret" + +#: coff-arm.c:1785 coff-tic80.c:686 cofflink.c:3031 +#, c-format +msgid "%s: bad reloc address 0x%lx in section `%s'" +msgstr "%s: fejlagtig relokaliseringsadresse 0x%lx i sektionen \"%s\"" + +#: coff-arm.c:2127 +#, c-format +msgid "%s: illegal symbol index in reloc: %d" +msgstr "%s: utilladt symbolindex i relokalisering: %d" + +#: coff-arm.c:2255 +#, c-format +msgid "ERROR: %s is compiled for APCS-%d, whereas %s is compiled for APCS-%d" +msgstr "FEJL: %s kompileret for APCS-%d, mens %s er kompileret for APCS-%d" + +#: coff-arm.c:2270 elf32-arm.h:2297 +#, c-format +msgid "ERROR: %s passes floats in float registers, whereas %s passes them in integer registers" +msgstr "FEJL: %s overfører flydende tal i flydendetalsregister, mens %s overfører dem i heltalsregister" + +#: coff-arm.c:2273 elf32-arm.h:2302 +#, c-format +msgid "ERROR: %s passes floats in integer registers, whereas %s passes them in float registers" +msgstr "FEJL: %s overfører flydende tal i heltalsregister, mens %s overfører dem i flydendetalsregister" + +#: coff-arm.c:2288 +#, c-format +msgid "ERROR: %s is compiled as position independent code, whereas target %s is absolute position" +msgstr "FEJL: %s er kompileret som positionsuafhængig kode, mens målet %s har absolut position" + +#: coff-arm.c:2291 +#, c-format +msgid "ERROR: %s is compiled as absolute position code, whereas target %s is position independent" +msgstr "FEJL: %s er kompileret som kode med absolut position, mens målet %s er positionsuafhængigt" + +#: coff-arm.c:2320 elf32-arm.h:2358 +#, c-format +msgid "Warning: %s supports interworking, whereas %s does not" +msgstr "Advarsel: %s understøtter samvirken, mens %s derimod ikke gør det" + +#: coff-arm.c:2323 elf32-arm.h:2365 +#, c-format +msgid "Warning: %s does not support interworking, whereas %s does" +msgstr "Advarsel: %s understøtter ikke samvirken, mens %s derimod gør det" + +#: coff-arm.c:2350 +#, c-format +msgid "private flags = %x:" +msgstr "private flag = %x:" + +#: coff-arm.c:2358 elf32-arm.h:2418 +msgid " [floats passed in float registers]" +msgstr " [flydende tal overført i flydendetalsregistre]" + +#: coff-arm.c:2360 +msgid " [floats passed in integer registers]" +msgstr " [flydende tal overført i heltalsregistre]" + +#: coff-arm.c:2363 elf32-arm.h:2421 +msgid " [position independent]" +msgstr " [positionsuafhængigt]" + +#: coff-arm.c:2365 +msgid " [absolute position]" +msgstr " [absolut position]" + +#: coff-arm.c:2369 +msgid " [interworking flag not initialised]" +msgstr " [samvirkendeflag er ikke initieret]" + +#: coff-arm.c:2371 +msgid " [interworking supported]" +msgstr " [samvirken understøttes]" + +#: coff-arm.c:2373 +msgid " [interworking not supported]" +msgstr " [samvirken understøttes ikke]" + +#: coff-arm.c:2421 elf32-arm.h:2124 +#, c-format +msgid "Warning: Not setting interworking flag of %s since it has already been specified as non-interworking" +msgstr "Advarsel: Sætter ikke samvirkeflaget for %s da den allerede er angivet som ikke-samvirkende" + +#: coff-arm.c:2425 elf32-arm.h:2128 +#, c-format +msgid "Warning: Clearing the interworking flag of %s due to outside request" +msgstr "Advarsel: Fjerner samvirkeflaget for %s på grund af anmodning udefra" + +#: coff-i960.c:136 coff-i960.c:485 +msgid "uncertain calling convention for non-COFF symbol" +msgstr "usikker kaldskonvention for ikke-COFF-symbol" + +#: coff-m68k.c:481 coff-mips.c:2429 elf32-m68k.c:2157 elf32-mips.c:1844 +msgid "unsupported reloc type" +msgstr "relokaliseringstypen understøttes ikke" + +#: coff-mips.c:874 elf32-mips.c:1062 elf64-mips.c:1609 +msgid "GP relative relocation when _gp not defined" +msgstr "GP-relativ relokalisering når _gp ikke var defineret" + +#. No other sections should appear in -membedded-pic +#. code. +#: coff-mips.c:2466 +msgid "reloc against unsupported section" +msgstr "relokalisering mod sektion som ikke understøttes" + +#: coff-mips.c:2474 +msgid "reloc not properly aligned" +msgstr "relokalisering ikke på lige grænse" + +#: coff-rs6000.c:2766 +#, c-format +msgid "%s: unsupported relocation type 0x%02x" +msgstr "%s: relokaliseringstypen 0x%02x understøttes ikke" + +#: coff-rs6000.c:2859 +#, c-format +msgid "%s: TOC reloc at 0x%x to symbol `%s' with no TOC entry" +msgstr "%s: TOC-relokalisering ved 0x%x til symbolet \"%s\" uden nogen TOC-post" + +#: coff-rs6000.c:3590 coff64-rs6000.c:2091 +#, c-format +msgid "%s: symbol `%s' has unrecognized smclas %d" +msgstr "%s: symbolet \"%s\" har ukendt smclas %d" + +#: coff-tic54x.c:279 coff-tic80.c:449 +#, c-format +msgid "Unrecognized reloc type 0x%x" +msgstr "Ukendt relokaliseringstype 0x%x" + +#: coff-tic54x.c:390 coffcode.h:4974 +#, c-format +msgid "%s: warning: illegal symbol index %ld in relocs" +msgstr "%s: advarsel: utilladt symbolindex %ld i relokaliseringerne" + +#: coff-w65.c:363 +#, c-format +msgid "ignoring reloc %s\n" +msgstr "ignorerer relokalisering %s\n" + +#: coffcode.h:1086 +#, c-format +msgid "%s (%s): Section flag %s (0x%x) ignored" +msgstr "%s (%s): Sektionsflaget %s (0x%x) ignoreredes" + +#: coffcode.h:2143 +#, c-format +msgid "Unrecognized TI COFF target id '0x%x'" +msgstr "Ukendt TI COFF-mål-id \"0x%x\"" + +#: coffcode.h:4365 +#, c-format +msgid "%s: warning: illegal symbol index %ld in line numbers" +msgstr "%s: advarsel: utilladt symbolindex %ld i linjenumre" + +#: coffcode.h:4379 +#, c-format +msgid "%s: warning: duplicate line number information for `%s'" +msgstr "%s: advarsel: dobbelt linjenummersinformation for \"%s\"" + +#: coffcode.h:4736 +#, c-format +msgid "%s: Unrecognized storage class %d for %s symbol `%s'" +msgstr "%s: Ukendt lagringsklasse %d for %s-symbolet \"%s\"" + +#: coffcode.h:4867 +#, c-format +msgid "warning: %s: local symbol `%s' has no section" +msgstr "advarsel: %s: lokalt symbol \"%s\" har ingen sektion" + +#: coffcode.h:5012 +#, c-format +msgid "%s: illegal relocation type %d at address 0x%lx" +msgstr "%s: utilladt relokaliseringstype %d på adresse 0x%lx" + +#: coffgen.c:1661 +#, c-format +msgid "%s: bad string table size %lu" +msgstr "%s: fejlagtig strengtabelstørrelse %lu" + +#: cofflink.c:534 elflink.h:1912 +#, c-format +msgid "Warning: type of symbol `%s' changed from %d to %d in %s" +msgstr "Advarsel: typen på symbol \"%s\" ændredes fra %d til %d i %s" + +#: cofflink.c:2321 +#, c-format +msgid "%s: relocs in section `%s', but it has no contents" +msgstr "%s: relokaliseringer i sektionen \"%s\", men den har intet indhold" + +#: cofflink.c:2664 coffswap.h:877 +#, c-format +msgid "%s: %s: reloc overflow: 0x%lx > 0xffff" +msgstr "%s: %s: relokalisering giver overløb: 0x%lx > 0xffff" + +#: cofflink.c:2673 coffswap.h:864 +#, c-format +msgid "%s: warning: %s: line number overflow: 0x%lx > 0xffff" +msgstr "%s: advarsel: %s: linjenummer giver overløb: 0x%lx > 0xffff" + +#: dwarf2.c:382 +msgid "Dwarf Error: Can't find .debug_str section." +msgstr "Dwarf-fejl: Kan ikke finde sektionen .debug_str." + +#: dwarf2.c:399 +#, c-format +msgid "Dwarf Error: DW_FORM_strp offset (%lu) greater than or equal to .debug_str size (%lu)." +msgstr "Dwarf-fejl: DW_FORM_strp-afstanden (%lu) større end eller lig med størrelsen på .debug_str (%lu)." + +#: dwarf2.c:543 +msgid "Dwarf Error: Can't find .debug_abbrev section." +msgstr "Dwarf-fejl: Kan ikke finde sektionen .debug_abbrev." + +#: dwarf2.c:560 +#, c-format +msgid "Dwarf Error: Abbrev offset (%lu) greater than or equal to .debug_abbrev size (%lu)." +msgstr "Dwarf-fejl: Forkortelsesafstanden (%lu) større end eller lig med størrelsen .debug_abbrev (%lu)." + +#: dwarf2.c:757 +#, c-format +msgid "Dwarf Error: Invalid or unhandled FORM value: %u." +msgstr "Dwarf-fejl: Ugyldig eller ubehandlet FORM-værdi: %u." + +#: dwarf2.c:852 +msgid "Dwarf Error: mangled line number section (bad file number)." +msgstr "Dwarf-fejl: vanskabt linjenummerssektion (fejlagtigt filnummer)." + +#: dwarf2.c:938 +msgid "Dwarf Error: Can't find .debug_line section." +msgstr "Dwarf-fejl: Kan ikke finde sektionen .debug_line." + +#: dwarf2.c:961 +#, c-format +msgid "Dwarf Error: Line offset (%lu) greater than or equal to .debug_line size (%lu)." +msgstr "Dwarf-fejl: Linjeafstanden (%lu) større end eller lig med størrelsen .debug_line (%lu)." + +#: dwarf2.c:1159 +msgid "Dwarf Error: mangled line number section." +msgstr "Dwarf-fejl: vanskabt linjenummerssektion." + +#: dwarf2.c:1355 dwarf2.c:1566 +#, c-format +msgid "Dwarf Error: Could not find abbrev number %u." +msgstr "Dwarf-fejl: Kunne ikke finde forkortelsesnumret %u." + +#: dwarf2.c:1527 +#, c-format +msgid "Dwarf Error: found dwarf version '%u', this reader only handles version 2 information." +msgstr "Dwarf-fejl: fandt dwarf version \"%u\", denne læser håndterer kun information fra version 2." + +#: dwarf2.c:1534 +#, c-format +msgid "Dwarf Error: found address size '%u', this reader can not handle sizes greater than '%u'." +msgstr "Dwarf-fejl: fandt adressestørrelsen \"%u\", denne læser kan ikke håndtere størrelser større end \"%u\"." + +#: dwarf2.c:1557 +#, c-format +msgid "Dwarf Error: Bad abbrev number: %u." +msgstr "Dwarf-fejl: Fejlagtigt forkortelsesnummer: %u." + +#: ecoff.c:1318 +#, c-format +msgid "Unknown basic type %d" +msgstr "Ukendt grundtype %d" + +#: ecoff.c:1578 +#, c-format +msgid "" +"\n" +" End+1 symbol: %ld" +msgstr "" +"\n" +" Symbol slut+1: %ld" + +#: ecoff.c:1585 ecoff.c:1588 +#, c-format +msgid "" +"\n" +" First symbol: %ld" +msgstr "" +"\n" +" Første symbol: %ld" + +#: ecoff.c:1600 +#, c-format +msgid "" +"\n" +" End+1 symbol: %-7ld Type: %s" +msgstr "" +"\n" +" Symbol slut+1: %-7ld Type: %s" + +#: ecoff.c:1607 +#, c-format +msgid "" +"\n" +" Local symbol: %ld" +msgstr "" +"\n" +" Lokalt symbol: %ld" + +#: ecoff.c:1615 +#, c-format +msgid "" +"\n" +" struct; End+1 symbol: %ld" +msgstr "" +"\n" +" struct; symbol slut+1: %ld" + +#: ecoff.c:1620 +#, c-format +msgid "" +"\n" +" union; End+1 symbol: %ld" +msgstr "" +"\n" +" union; symbol slut+1: %ld" + +#: ecoff.c:1625 +#, c-format +msgid "" +"\n" +" enum; End+1 symbol: %ld" +msgstr "" +"\n" +" enum; symbol slut+1: %ld" + +#: ecoff.c:1631 +#, c-format +msgid "" +"\n" +" Type: %s" +msgstr "" +"\n" +" Type: %s" + +#: elf-hppa.h:1476 elf-hppa.h:1509 elf32-ppc.c:3091 elf32-sh.c:4213 +#: elf64-sh64.c:1659 +#, c-format +msgid "%s: warning: unresolvable relocation against symbol `%s' from %s section" +msgstr "%s: advarsel: uløselig relokalisering mod symbol \"%s\" fra sektionen %s" + +#: elf-m10200.c:446 elf-m10300.c:656 elf32-arm.h:2084 elf32-avr.c:833 +#: elf32-cris.c:1403 elf32-d10v.c:481 elf32-fr30.c:635 elf32-frv.c:809 +#: elf32-h8300.c:548 elf32-i860.c:1031 elf32-m32r.c:1278 elf32-openrisc.c:439 +#: elf32-v850.c:1691 elf32-xstormy16.c:933 elf64-mmix.c:1302 +msgid "internal error: out of range error" +msgstr "intern fejl: udenfor intervallet" + +#: elf-m10200.c:450 elf-m10300.c:660 elf32-arm.h:2088 elf32-avr.c:837 +#: elf32-cris.c:1407 elf32-d10v.c:485 elf32-fr30.c:639 elf32-frv.c:813 +#: elf32-h8300.c:552 elf32-i860.c:1035 elf32-m32r.c:1282 elf32-openrisc.c:443 +#: elf32-v850.c:1695 elf32-xstormy16.c:937 elf64-mmix.c:1306 elfxx-mips.c:5264 +msgid "internal error: unsupported relocation error" +msgstr "intern fejl: relokaliseringen understøttes ikke" + +#: elf-m10200.c:454 elf-m10300.c:664 elf32-arm.h:2092 elf32-d10v.c:489 +#: elf32-h8300.c:556 elf32-m32r.c:1286 +msgid "internal error: dangerous error" +msgstr "intern fejl: farlig fejl" + +#: elf-m10200.c:458 elf-m10300.c:668 elf32-arm.h:2096 elf32-avr.c:845 +#: elf32-cris.c:1415 elf32-d10v.c:493 elf32-fr30.c:647 elf32-frv.c:821 +#: elf32-h8300.c:560 elf32-i860.c:1043 elf32-m32r.c:1290 elf32-openrisc.c:451 +#: elf32-v850.c:1715 elf32-xstormy16.c:945 elf64-mmix.c:1314 +msgid "internal error: unknown error" +msgstr "intern fejl: ukendt fejl" + +#: elf.c:343 +#, c-format +msgid "%s: invalid string offset %u >= %lu for section `%s'" +msgstr "%s: ugyldig strengafstand %u >= %lu for sektionen \"%s\"" + +#: elf.c:589 +#, c-format +msgid "%s: invalid SHT_GROUP entry" +msgstr "%s: ugyldig SHT_GROUP-post" + +#: elf.c:660 +#, c-format +msgid "%s: no group info for section %s" +msgstr "%s: ingen gruppeinformation for sektionen %s" + +#: elf.c:1023 +msgid "" +"\n" +"Program Header:\n" +msgstr "" +"\n" +"Programhoved:\n" + +#: elf.c:1073 +msgid "" +"\n" +"Dynamic Section:\n" +msgstr "" +"\n" +"Dynamisk sektion:\n" + +#: elf.c:1202 +msgid "" +"\n" +"Version definitions:\n" +msgstr "" +"\n" +"Versionsdefinitioner:\n" + +#: elf.c:1225 +msgid "" +"\n" +"Version References:\n" +msgstr "" +"\n" +"Versionsreferencer:\n" + +#: elf.c:1230 +#, c-format +msgid " required from %s:\n" +msgstr " kræves fra %s:\n" + +#: elf.c:1902 +#, c-format +msgid "%s: invalid link %lu for reloc section %s (index %u)" +msgstr "%s: ugyldig lænke %lu for relokaliseringssektion %s (index %u)" + +#: elf.c:3603 +#, c-format +msgid "%s: Not enough room for program headers (allocated %u, need %u)" +msgstr "%s: Ikke tilstrækkeligt med plads for programhoveder (allokerede %u, behøver %u)" + +#: elf.c:3708 +#, c-format +msgid "%s: Not enough room for program headers, try linking with -N" +msgstr "%s: Ikke tilstrækkeligt med plads for programhoveder, forsøg at lænke med -N" + +#: elf.c:3833 +#, c-format +msgid "Error: First section in segment (%s) starts at 0x%x whereas the segment starts at 0x%x" +msgstr "Fejl: Første sektion i segmentet (%s) begynder ved 0x%x mens segmentet begynder ved 0x%x" + +#: elf.c:4148 +#, c-format +msgid "%s: warning: allocated section `%s' not in segment" +msgstr "%s: advarsel: allokeret sektion \"%s\" ikke i segment" + +#: elf.c:4472 +#, c-format +msgid "%s: symbol `%s' required but not present" +msgstr "%s: symbol \"%s\" kræves men er ikke tilstede" + +#: elf.c:4749 +#, c-format +msgid "%s: warning: Empty loadable segment detected, is this intentional ?\n" +msgstr "%s: advarsel: Tomt indlæsningsbart segment opdaget, er dette meningen?\n" + +#: elf.c:6193 +#, c-format +msgid "%s: unsupported relocation type %s" +msgstr "%s: relokaliseringstypen %s understøttes ikke" + +#: elf32-arm.h:1221 +#, c-format +msgid "%s: Warning: Arm BLX instruction targets Arm function '%s'." +msgstr "%s: Advarsel: Arm BLX-instruktion bruger Arm-funktionen \"%s\" som mål." + +#: elf32-arm.h:1417 +#, c-format +msgid "%s: Warning: Thumb BLX instruction targets thumb function '%s'." +msgstr "%s: Advarsel: Thumb BLX-instruktionen bruger thumb-funktionen \"%s\" som mål." + +#: elf32-arm.h:1914 elf32-sh.c:4125 +#, c-format +msgid "%s(%s+0x%lx): %s relocation against SEC_MERGE section" +msgstr "%s(%s+0x%lx): %s relokalisering mod SEC_MERGE-sektion" + +#: elf32-arm.h:2008 +#, c-format +msgid "%s: warning: unresolvable relocation %d against symbol `%s' from %s section" +msgstr "%s: advarsel: uløselig relokalisering %d mod symbol \"%s\" fra sektionen %s" + +#: elf32-arm.h:2176 +#, c-format +msgid "Warning: Clearing the interworking flag of %s because non-interworking code in %s has been linked with it" +msgstr "Advarsel: Fjerner samvirkendeflaget i %s eftersom ikke-samvirkende kode i %s er lænket med det" + +#: elf32-arm.h:2271 +#, c-format +msgid "ERROR: %s is compiled for EABI version %d, whereas %s is compiled for version %d" +msgstr "FEJL: %s er kompileret for EABI version %d, mens %s er kompileret for version %d" + +#: elf32-arm.h:2285 +#, c-format +msgid "ERROR: %s is compiled for APCS-%d, whereas target %s uses APCS-%d" +msgstr "FEJL: %s er kompileret for APCS-%d, mens målet %s bruger APCS-%d" + +#: elf32-arm.h:2313 +#, c-format +msgid "ERROR: %s uses VFP instructions, whereas %s uses FPA instructions" +msgstr "FEJL: %s bruger VFP-instruktioner, mens %s bruger FPA-instruktioner" + +#: elf32-arm.h:2318 +#, c-format +msgid "ERROR: %s uses FPA instructions, whereas %s uses VFP instructions" +msgstr "FEJL: %s bruger FPA-instruktioner, mens %s bruger VFP-instruktioner" + +#: elf32-arm.h:2338 +#, c-format +msgid "ERROR: %s uses software FP, whereas %s uses hardware FP" +msgstr "FEJL: %s bruger programmeret flydende tal, mens %s bruger maskinens flydende tal" + +#: elf32-arm.h:2343 +#, c-format +msgid "ERROR: %s uses hardware FP, whereas %s uses software FP" +msgstr "FEJL: %s bruger maskinens flydende tal, mens %s bruger programmeret flydende tal" + +#. Ignore init flag - it may not be set, despite the flags field +#. containing valid data. +#: elf32-arm.h:2396 elf32-cris.c:2988 elf32-m68k.c:410 elf32-vax.c:543 +#: elfxx-mips.c:7756 +#, c-format +msgid "private flags = %lx:" +msgstr "private flag = %lx:" + +#: elf32-arm.h:2405 +msgid " [interworking enabled]" +msgstr " [samvirkende er aktiveret]" + +#: elf32-arm.h:2413 +msgid " [VFP float format]" +msgstr " [VFP-flydende talsformat]" + +#: elf32-arm.h:2415 +msgid " [FPA float format]" +msgstr " [FPA-flydende talsformat]" + +#: elf32-arm.h:2424 +msgid " [new ABI]" +msgstr " [nyt ABI]" + +#: elf32-arm.h:2427 +msgid " [old ABI]" +msgstr " [gammelt ABI]" + +#: elf32-arm.h:2430 +msgid " [software FP]" +msgstr " [programmeret FP]" + +#: elf32-arm.h:2438 +msgid " [Version1 EABI]" +msgstr " [Version1 EABI]" + +#: elf32-arm.h:2441 elf32-arm.h:2452 +msgid " [sorted symbol table]" +msgstr " [sorteret symboltabel]" + +#: elf32-arm.h:2443 elf32-arm.h:2454 +msgid " [unsorted symbol table]" +msgstr " [usorteret symboltabel]" + +#: elf32-arm.h:2449 +msgid " [Version2 EABI]" +msgstr " [Version2 EABI]" + +#: elf32-arm.h:2457 +msgid " [dynamic symbols use segment index]" +msgstr " [dynamiske symboler bruger segmentindex]" + +#: elf32-arm.h:2460 +msgid " [mapping symbols precede others]" +msgstr " [mapningssymboler foretrækkes frem for andre]" + +#: elf32-arm.h:2467 +msgid " " +msgstr " " + +#: elf32-arm.h:2474 +msgid " [relocatable executable]" +msgstr " [relokaliseringsbar kørbar fil]" + +#: elf32-arm.h:2477 +msgid " [has entry point]" +msgstr " [har startpunkt]" + +#: elf32-arm.h:2482 +msgid "" +msgstr "" + +#: elf32-avr.c:841 elf32-cris.c:1411 elf32-fr30.c:643 elf32-frv.c:817 +#: elf32-i860.c:1039 elf32-openrisc.c:447 elf32-v850.c:1699 +#: elf32-xstormy16.c:941 elf64-mmix.c:1310 +msgid "internal error: dangerous relocation" +msgstr "intern fejl: farlig relokalisering" + +#: elf32-cris.c:949 +#, c-format +msgid "%s: unresolvable relocation %s against symbol `%s' from %s section" +msgstr "%s: uløselig relokalisering %s mod symbol \"%s\" fra sektionen %s" + +#: elf32-cris.c:1012 +#, c-format +msgid "%s: No PLT nor GOT for relocation %s against symbol `%s' from %s section" +msgstr "%s: Hverken nogen PLT eller GOT for relokalisering %s mod symbol \"%s\" fra sektionen %s" + +#: elf32-cris.c:1015 elf32-cris.c:1141 +msgid "[whose name is lost]" +msgstr "[hvis navn er tabt]" + +#: elf32-cris.c:1130 +#, c-format +msgid "%s: relocation %s with non-zero addend %d against local symbol from %s section" +msgstr "%s: relokalisering %s med ikke-tomt addendum %d mod lokalt symbol fra sektionen %s" + +#: elf32-cris.c:1137 +#, c-format +msgid "%s: relocation %s with non-zero addend %d against symbol `%s' from %s section" +msgstr "%s: relokalisering %s med ikke-tomt addendum %d mod symbol \"%s\" fra sektionen %s" + +#: elf32-cris.c:1155 +#, c-format +msgid "%s: relocation %s is not allowed for global symbol: `%s' from %s section" +msgstr "%s: relokaliseringen %s er ikke tilladt for globalt symbol: \"%s\" fra sektionen %s" + +#: elf32-cris.c:1170 +#, c-format +msgid "%s: relocation %s in section %s with no GOT created" +msgstr "%s: relokalisering %s i sektionen %s uden GOT oprettet" + +#: elf32-cris.c:1288 +#, c-format +msgid "%s: Internal inconsistency; no relocation section %s" +msgstr "%s: Intern inkonsistens; ingen relokaliseringssektion %s" + +#: elf32-cris.c:2514 +#, c-format +msgid "" +"%s, section %s:\n" +" relocation %s should not be used in a shared object; recompile with -fPIC" +msgstr "" +"%s, sektion %s:\n" +" relokaliseringen %s bør ikke bruges i et delt objekt; genoversæt med -fPIC" + +#: elf32-cris.c:2991 +msgid " [symbols have a _ prefix]" +msgstr " [symboler har et _-prefix]" + +#: elf32-cris.c:3030 +#, c-format +msgid "%s: uses _-prefixed symbols, but writing file with non-prefixed symbols" +msgstr "%s: bruger symboler med _-prefix, men skriver fil med symboler uden prefix" + +#: elf32-cris.c:3031 +#, c-format +msgid "%s: uses non-prefixed symbols, but writing file with _-prefixed symbols" +msgstr "%s: bruger symboler uden prefix, men skriver fil med symboler med _-prefix" + +#: elf32-frv.c:1217 +#, c-format +msgid "%s: compiled with %s and linked with modules that use non-pic relocations" +msgstr "%s: kompileret med %s og lænket med moduler som bruger ikke-pic-relokalisering" + +#: elf32-frv.c:1267 +#, c-format +msgid "%s: compiled with %s and linked with modules compiled with %s" +msgstr "%s: kompileret med %s og lænket med moduler som kompileredes med %s" + +#: elf32-frv.c:1279 +#, c-format +msgid "%s: uses different unknown e_flags (0x%lx) fields than previous modules (0x%lx)" +msgstr "%s: bruger andre ukendte e_flags-felter (0x%lx) end tidligere moduler (0x%lx)" + +#: elf32-frv.c:1315 +#, c-format +msgid "private flags = 0x%lx:" +msgstr "private flag = 0x%lx:" + +#: elf32-gen.c:82 elf64-gen.c:82 +#, c-format +msgid "%s: Relocations in generic ELF (EM: %d)" +msgstr "%s: Relokalisering i generisk ELF (EM: %d)" + +#: elf32-hppa.c:671 elf64-ppc.c:2323 +#, c-format +msgid "%s: cannot create stub entry %s" +msgstr "%s: kan ikke oprette stubstarten %s" + +#: elf32-hppa.c:956 elf32-hppa.c:3555 +#, c-format +msgid "%s(%s+0x%lx): cannot reach %s, recompile with -ffunction-sections" +msgstr "%s(%s+0x%lx): kan ikke nå %s, genoversæt med -ffunction-sections" + +#: elf32-hppa.c:1338 elf64-x86-64.c:673 +#, c-format +msgid "%s: relocation %s can not be used when making a shared object; recompile with -fPIC" +msgstr "%s: relokaliseringen %s kan ikke bruges når et delt objekt oprettes; genoversæt med -fPIC" + +#: elf32-hppa.c:1358 +#, c-format +msgid "%s: relocation %s should not be used when making a shared object; recompile with -fPIC" +msgstr "%s: relokaliseringen %s bør ikke bruges når et delt objekt oprettes; genoversæt med -fPIC" + +#: elf32-hppa.c:1551 +#, c-format +msgid "Could not find relocation section for %s" +msgstr "Kunne ikke finde relokaliseringssektion for %s" + +#: elf32-hppa.c:2855 +#, c-format +msgid "%s: duplicate export stub %s" +msgstr "%s: dobbelt eksportstub %s" + +#: elf32-hppa.c:3433 +#, c-format +msgid "%s(%s+0x%lx): fixing %s" +msgstr "%s(%s+0x%lx): retter %s" + +#: elf32-hppa.c:4080 +#, c-format +msgid "%s(%s+0x%lx): cannot handle %s for %s" +msgstr "%s(%s+0x%lx): kan ikke håndtere %s for %s" + +#: elf32-hppa.c:4393 +msgid ".got section not immediately after .plt section" +msgstr ".got-sektionen følger ikke umiddelbart efter .plt-sektion" + +#: elf32-i386.c:379 +#, c-format +msgid "%s: invalid relocation type %d" +msgstr "%s: ugyldig relokaliseringstype %d" + +#: elf32-i386.c:876 elf32-s390.c:649 elf64-s390.c:595 elf64-x86-64.c:591 +#, c-format +msgid "%s: bad symbol index: %d" +msgstr "%s: fejlagtigt symbolindex: %d" + +#: elf32-i386.c:948 +#, c-format +msgid "%s: `%s' accessed both as normal and thread local symbol" +msgstr "%s: \"%s\" kaldt både som lokalt normalt symbol og lokalt trådsymbol" + +#: elf32-i386.c:1072 elf32-s390.c:808 elf64-ppc.c:2827 elf64-s390.c:759 +#: elf64-x86-64.c:761 +#, c-format +msgid "%s: bad relocation section name `%s'" +msgstr "%s: fejlagtig relokaliseringssektionsnavn \"%s\"" + +#: elf32-i386.c:1159 elf64-alpha.c:4768 +#, c-format +msgid "%s: TLS local exec code cannot be linked into shared objects" +msgstr "%s: lokal TLS-eksekveringskode kan ikke lænkes ind i delte objekter" + +#: elf32-i386.c:2747 elf32-s390.c:1981 elf32-sparc.c:1571 elf64-ppc.c:5918 +#: elf64-s390.c:1945 elf64-sparc.c:2578 elf64-x86-64.c:1948 +#, c-format +msgid "%s(%s+0x%lx): unresolvable relocation against symbol `%s'" +msgstr "%s(%s+0x%lx): uløselig relokalisering mod symbol \"%s\"" + +#: elf32-i386.c:2784 elf32-s390.c:2019 elf64-ppc.c:5977 elf64-s390.c:1983 +#: elf64-x86-64.c:1986 +#, c-format +msgid "%s(%s+0x%lx): reloc against `%s': error %d" +msgstr "%s(%s+0x%lx): relokalisering mod \"%s\": fejl %d" + +#: elf32-m32r.c:924 +msgid "SDA relocation when _SDA_BASE_ not defined" +msgstr "SDA-relokalisering når _SDA_BASE_ ikke er defineret" + +#: elf32-ia64.c:3687 elf32-m32r.c:1013 elf32-ppc.c:2987 elf64-alpha.c:4185 +#: elf64-alpha.c:4313 elf64-ia64.c:3687 +#, c-format +msgid "%s: unknown relocation type %d" +msgstr "%s: ukendt relokaliseringstype %d" + +#: elf32-m32r.c:1221 +#, c-format +msgid "%s: The target (%s) of an %s relocation is in the wrong section (%s)" +msgstr "%s: Målet (%s) for en %s-relokalisering er i forkert sektion (%s)" + +#: elf32-m32r.c:1947 +#, c-format +msgid "%s: Instruction set mismatch with previous modules" +msgstr "%s: Instruktionsopsætning passer ikke med tidligere moduler" + +#: elf32-m32r.c:1970 +#, c-format +msgid "private flags = %lx" +msgstr "private flag = %lx" + +#: elf32-m32r.c:1975 +msgid ": m32r instructions" +msgstr ": m32r-instruktioner" + +#: elf32-m32r.c:1976 +msgid ": m32rx instructions" +msgstr ": m32rx-instruktioner" + +#: elf32-m68k.c:413 +msgid " [cpu32]" +msgstr " [cpu32]" + +#: elf32-m68k.c:416 +msgid " [m68000]" +msgstr " [m68000]" + +#: elf32-mcore.c:354 elf32-mcore.c:457 +#, c-format +msgid "%s: Relocation %s (%d) is not currently supported.\n" +msgstr "%s: Relokalisering %s (%d) understøttes ikke i øjeblikket.\n" + +#: elf32-mcore.c:442 +#, c-format +msgid "%s: Unknown relocation type %d\n" +msgstr "%s: Ukendt relokaliseringstype %d\n" + +#: elf32-mips.c:1152 elf64-mips.c:1783 +msgid "32bits gp relative relocation occurs for an external symbol" +msgstr "32-bit gp-relativ relokalisering forekom for et eksternt symbol" + +#: elf32-mips.c:1301 +#, c-format +msgid "Linking mips16 objects into %s format is not supported" +msgstr "Lænkning af mips16-objekter til %s-format understøttes ikke" + +#: elf32-ppc.c:1460 +#, c-format +msgid "%s: compiled with -mrelocatable and linked with modules compiled normally" +msgstr "%s: kompileret med -mrelocatable og lænket med moduler som kompileredes normalt" + +#: elf32-ppc.c:1468 +#, c-format +msgid "%s: compiled normally and linked with modules compiled with -mrelocatable" +msgstr "%s: kompileret normalt og lænket med moduler som kompileredes med -mrelocatable" + +#: elf32-ppc.c:1494 elf64-sparc.c:2989 elfxx-mips.c:7713 +#, c-format +msgid "%s: uses different e_flags (0x%lx) fields than previous modules (0x%lx)" +msgstr "%s: bruger andre e_flags-felter (0x%lx) end tidligere moduler (0x%lx)" + +#: elf32-ppc.c:1592 +#, c-format +msgid "%s: Unknown special linker type %d" +msgstr "%s: Ukendt speciallænkertype %d" + +#: elf32-ppc.c:2273 elf32-ppc.c:2307 elf32-ppc.c:2342 +#, c-format +msgid "%s: relocation %s cannot be used when making a shared object" +msgstr "%s: relokaliseringen %s kan ikke bruges når et delt objekt oprettes" + +#: elf32-ppc.c:3126 elf64-ppc.c:5473 +#, c-format +msgid "%s: unknown relocation type %d for symbol %s" +msgstr "%s: ukendt relokaliseringstype %d for symbol %s" + +#: elf32-ppc.c:3482 elf32-ppc.c:3503 elf32-ppc.c:3553 +#, c-format +msgid "%s: The target (%s) of a %s relocation is in the wrong output section (%s)" +msgstr "%s: Målet (%s) for en %s-relokalisering er i forkert uddatasektion (%s)" + +#: elf32-ppc.c:3619 +#, c-format +msgid "%s: Relocation %s is not yet supported for symbol %s." +msgstr "%s: Relokaliseringen %s understøttes ikke endnu for symbol %s." + +#: elf32-sh.c:1964 +#, c-format +msgid "%s: 0x%lx: warning: bad R_SH_USES offset" +msgstr "%s: 0x%lx: advarsel: fejlagtig R_SH_USES-afstand" + +#: elf32-sh.c:1976 +#, c-format +msgid "%s: 0x%lx: warning: R_SH_USES points to unrecognized insn 0x%x" +msgstr "%s: 0x%lx: advarsel: R_SH_USES peger til ukendt instruktion 0x%x" + +#: elf32-sh.c:1993 +#, c-format +msgid "%s: 0x%lx: warning: bad R_SH_USES load offset" +msgstr "%s: 0x%lx: advarsel: fejlagtig R_SH_USES-indlæsningsafstand" + +#: elf32-sh.c:2008 +#, c-format +msgid "%s: 0x%lx: warning: could not find expected reloc" +msgstr "%s: 0x%lx: advarsel: kunne ikke finde forventet relokalisering" + +#: elf32-sh.c:2036 +#, c-format +msgid "%s: 0x%lx: warning: symbol in unexpected section" +msgstr "%s: 0x%lx: advarsel: symbol i uventet sektion" + +#: elf32-sh.c:2153 +#, c-format +msgid "%s: 0x%lx: warning: could not find expected COUNT reloc" +msgstr "%s: 0x%lx: advarsel: kunne ikke finde forventet COUNT-relokalisering" + +#: elf32-sh.c:2162 +#, c-format +msgid "%s: 0x%lx: warning: bad count" +msgstr "%s: 0x%lx: advarsel: fejlagtigt antal" + +#: elf32-sh.c:2550 elf32-sh.c:2926 +#, c-format +msgid "%s: 0x%lx: fatal: reloc overflow while relaxing" +msgstr "%s: 0x%lx: fatalt: relokalisering giver overløb ved forenklingen" + +#: elf32-sh.c:4073 elf64-sh64.c:1576 +msgid "Unexpected STO_SH5_ISA32 on local symbol is not handled" +msgstr "Uventet STO_SH5_ISA32 på lokalt symbol håndteres ikke" + +#: elf32-sh.c:4284 +#, c-format +msgid "%s: 0x%lx: fatal: unaligned branch target for relax-support relocation" +msgstr "%s: 0x%lx: fatalt: ujusteret grenmål for relokalisering for forenklingsunderstøttelse" + +#: elf32-sh64.c:203 elf64-sh64.c:2364 +#, c-format +msgid "%s: compiled as 32-bit object and %s is 64-bit" +msgstr "%s: kompileret som 32-bitsobjekt og %s er 64-bit" + +#: elf32-sh64.c:206 elf64-sh64.c:2367 +#, c-format +msgid "%s: compiled as 64-bit object and %s is 32-bit" +msgstr "%s: kompileret som 64-bitsobjekt og %s er 32-bit" + +#: elf32-sh64.c:208 elf64-sh64.c:2369 +#, c-format +msgid "%s: object size does not match that of target %s" +msgstr "%s: objektstørrelsen stemmer ikke overens med den hos målet %s" + +#: elf32-sh64.c:440 elf64-sh64.c:2941 +#, c-format +msgid "%s: encountered datalabel symbol in input" +msgstr "%s: mødte dataetikettesymbol i inddata" + +#: elf32-sh64.c:523 +msgid "PTB mismatch: a SHmedia address (bit 0 == 1)" +msgstr "PTB passer ikke: en SHmedia-adresse (bit 0 == 1)" + +#: elf32-sh64.c:526 +msgid "PTA mismatch: a SHcompact address (bit 0 == 0)" +msgstr "PTA passer ikke: en SHcompact-adresse (bit 0 == 0)" + +#: elf32-sh64.c:544 +#, c-format +msgid "%s: GAS error: unexpected PTB insn with R_SH_PT_16" +msgstr "%s: GAS-fejl: uventet PTB-instruktion med R_SH_PT_16" + +#: elf32-sh64.c:593 elf64-sh64.c:1703 +#, c-format +msgid "%s: error: unaligned relocation type %d at %08x reloc %08x\n" +msgstr "%s: fejl: ujusteret relokaliseringstype %d på %08x relokalisering %08x\n" + +#: elf32-sh64.c:677 +#, c-format +msgid "%s: could not write out added .cranges entries" +msgstr "%s: kunne ikke udskrive tilføjede .cranges-poster" + +#: elf32-sh64.c:739 +#, c-format +msgid "%s: could not write out sorted .cranges entries" +msgstr "%s: kunne ikke udskrive sorterede cranges-poster" + +#: elf32-sparc.c:1535 elf64-sparc.c:2224 +#, c-format +msgid "%s: probably compiled without -fPIC?" +msgstr "%s: nok kompileret uden -fPIC?" + +#: elf32-sparc.c:2002 +#, c-format +msgid "%s: compiled for a 64 bit system and target is 32 bit" +msgstr "%s: kompileret for et 64-bitssystem og målet er 32-bit" + +#: elf32-sparc.c:2016 +#, c-format +msgid "%s: linking little endian files with big endian files" +msgstr "%s: lænker little endian-filer med big endian-filer" + +#: elf32-v850.c:682 +#, fuzzy, c-format +msgid "Variable `%s' cannot occupy in multiple small data regions" +msgstr "Variabel \"%s\" kan ikke befinde sig i flere små dataområder" + +#: elf32-v850.c:685 +#, fuzzy, c-format +msgid "Variable `%s' can only be in one of the small, zero, and tiny data regions" +msgstr "Variabel \"%s\" kan kun være i et af de små, tomme og bittesmå dataområder" + +#: elf32-v850.c:688 +#, fuzzy, c-format +msgid "Variable `%s' cannot be in both small and zero data regions simultaneously" +msgstr "Variabel \"%s\" kan ikke være i både små og tomme dataområder samtidigt" + +#: elf32-v850.c:691 +#, fuzzy, c-format +msgid "Variable `%s' cannot be in both small and tiny data regions simultaneously" +msgstr "Variabel \"%s\" kan ikke være i både små og bittesmå dataområder samtidigt" + +#: elf32-v850.c:694 +#, c-format +msgid "Variable `%s' cannot be in both zero and tiny data regions simultaneously" +msgstr "Variabel \"%s\" kan ikke være i både tomme og bittesmå dataområder samtidigt" + +#: elf32-v850.c:1072 +msgid "FAILED to find previous HI16 reloc\n" +msgstr "MISLYKKEDES med at finde tidligere HI16-relokalisering\n" + +#: elf32-v850.c:1703 +msgid "could not locate special linker symbol __gp" +msgstr "kunne ikke lokalisere specielt lænkersymbol __gp" + +#: elf32-v850.c:1707 +msgid "could not locate special linker symbol __ep" +msgstr "kunne ikke lokalisere specielt lænkersymbol __ep" + +#: elf32-v850.c:1711 +msgid "could not locate special linker symbol __ctbp" +msgstr "kunne ikke lokalisere specielt lænkersymbol __ctbp" + +#: elf32-v850.c:1875 +#, c-format +msgid "%s: Architecture mismatch with previous modules" +msgstr "%s: Arkitekturen passer ikke sammen med tidligere moduler" + +#: elf32-v850.c:1895 +#, c-format +msgid "private flags = %lx: " +msgstr "private flag = %lx: " + +#: elf32-v850.c:1900 +msgid "v850 architecture" +msgstr "v850-arkitektur" + +#: elf32-v850.c:1901 +msgid "v850e architecture" +msgstr "v850e-arkitektur" + +#: elf32-v850.c:1902 +msgid "v850ea architecture" +msgstr "v850ea-arkitektur" + +#: elf32-vax.c:546 +msgid " [nonpic]" +msgstr " [ikke-pic]" + +#: elf32-vax.c:549 +msgid " [d-float]" +msgstr " [d-flydende tal]" + +#: elf32-vax.c:552 +msgid " [g-float]" +msgstr " [g-flydende tal]" + +#: elf32-vax.c:674 +#, c-format +msgid "%s: warning: GOT addend of %ld to `%s' does not match previous GOT addend of %ld" +msgstr "%s: advarsel: GOT-addendum %ld til \"%s\" stemmer ikke overens med tidligere GOT-addendum %ld" + +#: elf32-vax.c:1679 +#, c-format +msgid "%s: warning: PLT addend of %d to `%s' from %s section ignored" +msgstr "%s: advarsel: PLT-addendum %d til \"%s\" fra sektionen %s ignoreredes" + +#: elf32-vax.c:1814 +#, c-format +msgid "%s: warning: %s relocation against symbol `%s' from %s section" +msgstr "%s: advarsel: %s-relokalisering mod symbol \"%s\" fra sektionen %s" + +#: elf32-vax.c:1820 +#, c-format +msgid "%s: warning: %s relocation to 0x%x from %s section" +msgstr "%s: advarsel: %s-relokalisering til 0x%x fra sektionen %s" + +#: elf32-ia64.c:2280 elf32-xstormy16.c:414 elf64-ia64.c:2280 +msgid "non-zero addend in @fptr reloc" +msgstr "ikke-tomt addendum i @fptr-relokalisering" + +#: elf64-alpha.c:1097 +msgid "GPDISP relocation did not find ldah and lda instructions" +msgstr "GPDISP-relokalisering fandt ingen ldah- og lda-instruktioner" + +#: elf64-alpha.c:3675 +#, c-format +msgid "%s: .got subsegment exceeds 64K (size %d)" +msgstr "%s: .got-subsegment overskrider 64 kB (størrelse %d)" + +#: elf64-alpha.c:4498 elf64-alpha.c:4510 +#, c-format +msgid "%s: gp-relative relocation against dynamic symbol %s" +msgstr "%s: gp-relativ relokalisering mod dynamisk symbol %s" + +#: elf64-alpha.c:4536 elf64-alpha.c:4676 +#, c-format +msgid "%s: pc-relative relocation against dynamic symbol %s" +msgstr "%s: pc-relativ relokalisering mod dynamisk symbol %s" + +#: elf64-alpha.c:4564 +#, c-format +msgid "%s: change in gp: BRSGP %s" +msgstr "%s: ændring i gp: BRSGP %s" + +#: elf64-alpha.c:4589 +msgid "" +msgstr "" + +#: elf64-alpha.c:4594 +#, c-format +msgid "%s: !samegp reloc against symbol without .prologue: %s" +msgstr "%s: !samegp-relokalisering mod symbol uden .prologue: %s" + +#: elf64-alpha.c:4639 +#, c-format +msgid "%s: unhandled dynamic relocation against %s" +msgstr "%s: uhåndteret dynamisk relokalisering mod %s" + +#: elf64-alpha.c:4752 +#, c-format +msgid "%s: dtp-relative relocation against dynamic symbol %s" +msgstr "%s: dtp-relativ relokalisering mod dynamisk symbol %s" + +#: elf64-alpha.c:4775 +#, c-format +msgid "%s: tp-relative relocation against dynamic symbol %s" +msgstr "%s: tp-relativ relokalisering mod dynamisk symbol %s" + +#: elf64-hppa.c:2080 +#, c-format +msgid "stub entry for %s cannot load .plt, dp offset = %ld" +msgstr "stubpost for %s kan ikke læse in .plt, dp-afstand = %ld" + +#: elf64-mmix.c:1002 +#, c-format +msgid "" +"%s: Internal inconsistency error for value for\n" +" linker-allocated global register: linked: 0x%lx%08lx != relaxed: 0x%lx%08lx\n" +msgstr "" +"%s: Intern inkonsistensfejl for værdien for\n" +" lænkerallokeret globalt register: lænket: 0x%lx%08lx != afslappet: 0x%lx%08lx\n" + +#: elf64-mmix.c:1386 +#, c-format +msgid "%s: base-plus-offset relocation against register symbol: (unknown) in %s" +msgstr "%s: base-plus-afstandsrelokalisering mod registersymbol: (ukendt) i %s" + +#: elf64-mmix.c:1391 +#, c-format +msgid "%s: base-plus-offset relocation against register symbol: %s in %s" +msgstr "%s: base-plus-afstandsrelokalisering mod registersymbol: %s i %s" + +#: elf64-mmix.c:1435 +#, c-format +msgid "%s: register relocation against non-register symbol: (unknown) in %s" +msgstr "%s: registerrelokalisering mod ikke-registersymbol: (ukendt) i %s" + +#: elf64-mmix.c:1440 +#, c-format +msgid "%s: register relocation against non-register symbol: %s in %s" +msgstr "%s: registerrelokalisering mod ikke-registersymbol: %s i %s" + +#: elf64-mmix.c:1477 +#, c-format +msgid "%s: directive LOCAL valid only with a register or absolute value" +msgstr "%s: LOCAL-direktivet er kun gyldigt med et register eller en absolutværdi" + +#: elf64-mmix.c:1505 +#, c-format +msgid "%s: LOCAL directive: Register $%ld is not a local register. First global register is $%ld." +msgstr "%s: LOCAL-direktiv: Register $%ld er ikke et lokalt register. Første globale register er $%ld." + +#: elf64-mmix.c:1965 +#, c-format +msgid "%s: Error: multiple definition of `%s'; start of %s is set in a earlier linked file\n" +msgstr "%s: Fejl: flere definitioner af \"%s\"; begyndelsen på %s er sat i en tidligere lænket fil\n" + +#: elf64-mmix.c:2024 +msgid "Register section has contents\n" +msgstr "Registersektion har indhold\n" + +#: elf64-mmix.c:2186 +#, c-format +msgid "" +"Internal inconsistency: remaining %u != max %u.\n" +" Please report this bug." +msgstr "" +"Intern inkonsekvens: genstående %u != max %u.\n" +" Rapportér gerne denne fejl." + +#: elf64-ppc.c:1669 libbfd.c:1435 +#, c-format +msgid "%s: compiled for a big endian system and target is little endian" +msgstr "%s: kompileret for et big endian-system og målet er little endian" + +#: elf64-ppc.c:1671 libbfd.c:1437 +#, c-format +msgid "%s: compiled for a little endian system and target is big endian" +msgstr "%s: kompileret for et little endian-system og målet er big endian" + +#: elf64-ppc.c:3610 +#, c-format +msgid "%s: unexpected reloc type %u in .opd section" +msgstr "%s: uventet relokaliseringstype %u i .opd-sektion" + +#: elf64-ppc.c:3630 +#, c-format +msgid "%s: .opd is not a regular array of opd entries" +msgstr "%s: .opd er ikke en almindelig vektor med opd-poster" + +#: elf64-ppc.c:3672 +#, c-format +msgid "%s: undefined sym `%s' in .opd section" +msgstr "%s: udefineret symbol \"%s\" i .opd-sektion" + +#: elf64-ppc.c:4397 +#, c-format +msgid "can't find branch stub `%s'" +msgstr "kan ikke finde grenstub \"%s\"" + +#: elf64-ppc.c:4436 elf64-ppc.c:4501 +#, c-format +msgid "linkage table error against `%s'" +msgstr "lænketabelsfejl mod \"%s\"" + +#: elf64-ppc.c:4573 +#, c-format +msgid "can't build branch stub `%s'" +msgstr "kan ikke bygge grenstub \"%s\"" + +#: elf64-ppc.c:5179 +msgid "stubs don't match calculated size" +msgstr "stubbe stemmer ikke overens med beregnet størrelse" + +#: elf64-ppc.c:5828 +#, c-format +msgid "%s: Relocation %s is not supported for symbol %s." +msgstr "%s: Relokaliseringen %s understøttes ikke for symbol %s." + +#: elf64-ppc.c:5872 +#, c-format +msgid "%s: error: relocation %s not a multiple of 4" +msgstr "%s: fejl: relokaliseringen %s er ikke en multipel af 4" + +#: elf64-sparc.c:1280 +#, c-format +msgid "%s: check_relocs: unhandled reloc type %d" +msgstr "%s: check_relocs: uhåndteret relokaliseringstype %d" + +#: elf64-sparc.c:1317 +#, c-format +msgid "%s: Only registers %%g[2367] can be declared using STT_REGISTER" +msgstr "%s: Kun register %%g[2367] kan deklareres med STT_REGISTER" + +#: elf64-sparc.c:1337 +#, c-format +msgid "Register %%g%d used incompatibly: %s in %s, previously %s in %s" +msgstr "Register %%g%d brugt inkompatibelt: %s i %s, tidligere %s i %s" + +#: elf64-sparc.c:1360 +#, c-format +msgid "Symbol `%s' has differing types: REGISTER in %s, previously %s in %s" +msgstr "Symbol \"%s\" har forskellige typer: REGISTER i %s, tidligere %s i %s" + +#: elf64-sparc.c:1406 +#, c-format +msgid "Symbol `%s' has differing types: %s in %s, previously REGISTER in %s" +msgstr "Symbol \"%s\" har forskellige typer: %s i %s, tidligere REGISTER i %s" + +#: elf64-sparc.c:2970 +#, c-format +msgid "%s: linking UltraSPARC specific with HAL specific code" +msgstr "%s: lænker UltraSPARC-specifik med HAL-specifik kode" + +#: elfcode.h:1198 +#, c-format +msgid "%s: version count (%ld) does not match symbol count (%ld)" +msgstr "%s: versionsantal (%ld) stemmer ikke med symbolantal (%ld)" + +#: elflink.c:440 +#, c-format +msgid "%s: Section %s is too large to add hole of %ld bytes" +msgstr "%s: Sektionen %s er for stor til at stoppa hul med %ld byte i" + +#: elflink.h:1090 +#, c-format +msgid "%s: warning: unexpected redefinition of `%s'" +msgstr "%s: advarsel: uventet omdefinition af \"%s\"" + +#: elflink.h:1727 +#, c-format +msgid "%s: %s: invalid version %u (max %d)" +msgstr "%s: %s: ugyldig version %u (max %d)" + +#: elflink.h:1768 +#, c-format +msgid "%s: %s: invalid needed version %d" +msgstr "%s: %s: ugyldig krævet version %d" + +#: elflink.h:1890 +#, c-format +msgid "Warning: size of symbol `%s' changed from %lu to %lu in %s" +msgstr "Advarsel: størrelsen på symbol \"%s\" ændredes fra %lu til %lu i %s" + +#: elflink.h:3174 +#, c-format +msgid "%s: .preinit_array section is not allowed in DSO" +msgstr "%s: .preinit_array-sektionen er ikke tilladt i DSO" + +#: elflink.h:4030 +#, c-format +msgid "warning: type and size of dynamic symbol `%s' are not defined" +msgstr "advarsel: typen og størrelsen på dynamisk symbol \"%s\" er ikke defineret" + +#: elflink.h:4345 +#, c-format +msgid "%s: undefined versioned symbol name %s" +msgstr "%s: udefineret symbolnavn med version %s" + +#: elflink.h:4611 elflink.h:4619 elflink.h:6508 elflink.h:7600 +msgid "Error: out of memory" +msgstr "Fejl: ikke mere hukommelse" + +#: elflink.h:4781 +msgid "Not enough memory to sort relocations" +msgstr "Ikke nok hukommelse til at sortere relokaliseringer" + +#: elflink.h:5682 elflink.h:5725 +#, c-format +msgid "%s: could not find output section %s" +msgstr "%s: kunne ikke finde uddatasektionen %s" + +#: elflink.h:5688 +#, c-format +msgid "warning: %s section has zero size" +msgstr "advarsel: %s-sektionen har nulstørrelse" + +#: elflink.h:6275 +#, c-format +msgid "%s: could not find output section %s for input section %s" +msgstr "%s: kunne ikke finde uddatasektionen %s for inddatasektionen %s" + +#: elflink.h:6486 +#, c-format +msgid "%s: relocation size mismatch in %s section %s" +msgstr "%s: relokaliseringsstørrelsen stemmer ikke overens i %s-sektionen %s" + +#: elflink.h:6849 +msgid "warning: relocation against removed section; zeroing" +msgstr "advarsel: relokalisering mod fjernet sektion; nulstiller" + +#: elflink.h:6879 +msgid "warning: relocation against removed section" +msgstr "advarsel: relokalisering mod fjernet sektion" + +#: elflink.h:6892 +#, c-format +msgid "local symbols in discarded section %s" +msgstr "lokale symboler i bortkastet sektion %s" + +#: elfxx-mips.c:734 +msgid "static procedure (no name)" +msgstr "statisk procedure (intet navn)" + +#: elfxx-mips.c:1601 +msgid "not enough GOT space for local GOT entries" +msgstr "ikke nok med GOT-plads for lokale GOT-poster" + +#: elfxx-mips.c:2750 +#, c-format +msgid "%s: %s+0x%lx: jump to stub routine which is not jal" +msgstr "%s: %s+0x%lx: hop til stubrutine som ikke er jal" + +#: elfxx-mips.c:4270 +#, c-format +msgid "%s: Malformed reloc detected for section %s" +msgstr "%s: Fejlagtig relokalisering for sektion %s opdaget" + +#: elfxx-mips.c:4348 +#, c-format +msgid "%s: CALL16 reloc at 0x%lx not against global symbol" +msgstr "%s: CALL16-relokalisering ved 0x%lx er ikke mod globalt symbol" + +#: elfxx-mips.c:7301 +#, c-format +msgid "%s: illegal section name `%s'" +msgstr "%s: ugyldigt sektionsnavn \"%s\"" + +#: elfxx-mips.c:7615 +#, c-format +msgid "%s: linking PIC files with non-PIC files" +msgstr "%s: lænker PIC-filer med ikke-PIC-filer" + +#: elfxx-mips.c:7625 +#, c-format +msgid "%s: linking abicalls files with non-abicalls files" +msgstr "%s: lænker abicalls-filer med ikke-abicalls-filer" + +#: elfxx-mips.c:7654 +#, c-format +msgid "%s: ISA mismatch (-mips%d) with previous modules (-mips%d)" +msgstr "%s: ISA (-mips%d) passer ikke med tidligere moduler (-mips%d)" + +#: elfxx-mips.c:7676 +#, c-format +msgid "%s: ISA mismatch (%d) with previous modules (%d)" +msgstr "%s: ISA (%d) passer ikke med tidligere moduler (%d)" + +#: elfxx-mips.c:7699 +#, c-format +msgid "%s: ABI mismatch: linking %s module with previous %s modules" +msgstr "%s: ABI passer ikke: lænker %s-modul med tidligere %s-moduler" + +#: elfxx-mips.c:7759 +msgid " [abi=O32]" +msgstr " [abi=O32]" + +#: elfxx-mips.c:7761 +msgid " [abi=O64]" +msgstr " [abi=O64]" + +#: elfxx-mips.c:7763 +msgid " [abi=EABI32]" +msgstr " [abi=EABI32]" + +#: elfxx-mips.c:7765 +msgid " [abi=EABI64]" +msgstr " [abi=EABI64]" + +#: elfxx-mips.c:7767 +msgid " [abi unknown]" +msgstr " [ukendt abi]" + +#: elfxx-mips.c:7769 +msgid " [abi=N32]" +msgstr " [abi=N32]" + +#: elfxx-mips.c:7771 +msgid " [abi=64]" +msgstr " [abi=64]" + +#: elfxx-mips.c:7773 +msgid " [no abi set]" +msgstr " [intet abi sat]" + +#: elfxx-mips.c:7776 +msgid " [mips1]" +msgstr " [mips1]" + +#: elfxx-mips.c:7778 +msgid " [mips2]" +msgstr " [mips2]" + +#: elfxx-mips.c:7780 +msgid " [mips3]" +msgstr " [mips3]" + +#: elfxx-mips.c:7782 +msgid " [mips4]" +msgstr " [mips4]" + +#: elfxx-mips.c:7784 +msgid " [mips5]" +msgstr " [mips5]" + +#: elfxx-mips.c:7786 +msgid " [mips32]" +msgstr " [mips32]" + +#: elfxx-mips.c:7788 +msgid " [mips64]" +msgstr " [mips64]" + +#: elfxx-mips.c:7790 +msgid " [unknown ISA]" +msgstr " [ukendt ISA]" + +#: elfxx-mips.c:7793 +msgid " [mdmx]" +msgstr " [mdmx]" + +#: elfxx-mips.c:7796 +msgid " [mips16]" +msgstr " [mips16]" + +#: elfxx-mips.c:7799 +msgid " [32bitmode]" +msgstr " [32-bittilstand]" + +#: elfxx-mips.c:7801 +msgid " [not 32bitmode]" +msgstr " [ikke 32-bittilstand]" + +#: i386linux.c:458 m68klinux.c:462 sparclinux.c:459 +#, c-format +msgid "Output file requires shared library `%s'\n" +msgstr "Uddatafilen kræver delt bibliotek \"%s\"\n" + +#: i386linux.c:466 m68klinux.c:470 sparclinux.c:467 +#, c-format +msgid "Output file requires shared library `%s.so.%s'\n" +msgstr "Uddatafilen kræver delt bibliotek \"%s.so.%s\"\n" + +#: i386linux.c:655 i386linux.c:705 m68klinux.c:662 m68klinux.c:710 +#: sparclinux.c:657 sparclinux.c:707 +#, c-format +msgid "Symbol %s not defined for fixups\n" +msgstr "Symbol %s er ikke defineret for rettelser\n" + +#: i386linux.c:729 m68klinux.c:734 sparclinux.c:731 +msgid "Warning: fixup count mismatch\n" +msgstr "Advarsel: antal rettelser stemmer ikke\n" + +#: ieee.c:235 +#, c-format +msgid "%s: string too long (%d chars, max 65535)" +msgstr "%s: strengen er for lang (%d tegn, max 65535)" + +#: ieee.c:365 +#, c-format +msgid "%s: unrecognized symbol `%s' flags 0x%x" +msgstr "%s: ukendt symbol \"%s\" flag 0x%x" + +#: ieee.c:877 +#, c-format +msgid "%s: unimplemented ATI record %u for symbol %u" +msgstr "%s: ikke implementeret ATI-post %u for symbol %u" + +#: ieee.c:902 +#, c-format +msgid "%s: unexpected ATN type %d in external part" +msgstr "%s: uventet ATN-type %d i ekstern del" + +#: ieee.c:924 +#, c-format +msgid "%s: unexpected type after ATN" +msgstr "%s: uventet type efter ATN" + +#: ihex.c:258 +#, c-format +msgid "%s:%d: unexpected character `%s' in Intel Hex file\n" +msgstr "%s:%d: uventet tegn \"%s\" i hexadecimal Intel-fil\n" + +#: ihex.c:366 +#, c-format +msgid "%s:%u: bad checksum in Intel Hex file (expected %u, found %u)" +msgstr "%s:%u: fejlagtig kontrolsum i hexadecimal Intel-fil (forventede %u, fandt %u)" + +#: ihex.c:420 +#, c-format +msgid "%s:%u: bad extended address record length in Intel Hex file" +msgstr "%s:%u: fejlagtig længde på post for udvidet adresse i hexadecimal Intel-fil" + +#: ihex.c:437 +#, c-format +msgid "%s:%u: bad extended start address length in Intel Hex file" +msgstr "%s:%u: fejlagtig længde på udvidet startadresse i hexadecimal Intel-fil" + +#: ihex.c:454 +#, c-format +msgid "%s:%u: bad extended linear address record length in Intel Hex file" +msgstr "%s:%u: fejlagtig længde på post for udvidet lineær adresse i hexadecimal Intel-fil" + +#: ihex.c:471 +#, c-format +msgid "%s:%u: bad extended linear start address length in Intel Hex file" +msgstr "%s:%u: fejlagtig længde på post for udvidet lineær startadresse i hexadecimal Intel-fil" + +#: ihex.c:488 +#, c-format +msgid "%s:%u: unrecognized ihex type %u in Intel Hex file\n" +msgstr "%s:%u: ukendt ihex-type %u i hexadecimal Intel-fil\n" + +#: ihex.c:607 +#, c-format +msgid "%s: internal error in ihex_read_section" +msgstr "%s: intern fejl i ihex_read_section" + +#: ihex.c:642 +#, c-format +msgid "%s: bad section length in ihex_read_section" +msgstr "%s: fejlagtig sektionslængde i ihex_read_sektion" + +#: ihex.c:860 +#, c-format +msgid "%s: address 0x%s out of range for Intel Hex file" +msgstr "%s: adressen 0x%s er udenfor intervallet for hexadecimal Intel-fil" + +#: libbfd.c:492 +#, c-format +msgid "not mapping: data=%lx mapped=%d\n" +msgstr "mapper ikke: data=%lx mappet=%d\n" + +#: libbfd.c:495 +msgid "not mapping: env var not set\n" +msgstr "mapper ikke: miljøvariabel er ikke sat\n" + +#: libbfd.c:1466 +#, c-format +msgid "Deprecated %s called at %s line %d in %s\n" +msgstr "Forældet %s kaldt ved %s linje %d i %s\n" + +#: libbfd.c:1469 +#, c-format +msgid "Deprecated %s called\n" +msgstr "Forældet %s kaldt\n" + +#: linker.c:1873 +#, c-format +msgid "%s: indirect symbol `%s' to `%s' is a loop" +msgstr "%s: indirekte symbol \"%s\" til \"%s\" er en løkke" + +#: linker.c:2776 +#, c-format +msgid "Attempt to do relocateable link with %s input and %s output" +msgstr "Forsøg at lave en relokaliseringsbar lænke med %s-inddata og %s-uddata" + +#: merge.c:892 +#, c-format +msgid "%s: access beyond end of merged section (%ld + %ld)" +msgstr "%s: adgang udover slutningen på sammenslagt sektion (%ld + %ld)" + +#: mmo.c:460 +#, c-format +msgid "%s: No core to allocate section name %s\n" +msgstr "%s: Ingen kerne til at allokere sektionsnavn %s\n" + +#: mmo.c:536 +#, c-format +msgid "%s: No core to allocate a symbol %d bytes long\n" +msgstr "%s: Ingen kerne til at allokere et %d byte langt symbol\n" + +#: mmo.c:1245 +#, c-format +msgid "%s: invalid mmo file: initialization value for $255 is not `Main'\n" +msgstr "%s: ugyldig mmo-fil: initieringsværdi for $255 er ikke \"Main\"\n" + +#: mmo.c:1391 +#, c-format +msgid "%s: unsupported wide character sequence 0x%02X 0x%02X after symbol name starting with `%s'\n" +msgstr "%s: bred tegnsekvens som ikke understøttes 0x%02X 0x%02X efter symbolnavnet som begynder med \"%s\"\n" + +#: mmo.c:1633 +#, c-format +msgid "%s: invalid mmo file: unsupported lopcode `%d'\n" +msgstr "%s: ugyldig mmo-fil: lopkode \"%d\" understøttes ikke\n" + +#: mmo.c:1643 +#, c-format +msgid "%s: invalid mmo file: expected YZ = 1 got YZ = %d for lop_quote\n" +msgstr "%s: ugyldig mmo-fil: forventede YZ = 1 fik YZ = %d for lop_quote\n" + +#: mmo.c:1679 +#, c-format +msgid "%s: invalid mmo file: expected z = 1 or z = 2, got z = %d for lop_loc\n" +msgstr "%s: ugyldig mmo-fil: forventede z = 1 eller z = 2, fik z = %d for lop_loc\n" + +#: mmo.c:1725 +#, c-format +msgid "%s: invalid mmo file: expected z = 1 or z = 2, got z = %d for lop_fixo\n" +msgstr "%s: ugyldig mmo-fil: forventede z = 1 eller z = 2, fik z = %d for lop_fixo\n" + +#: mmo.c:1764 +#, c-format +msgid "%s: invalid mmo file: expected y = 0, got y = %d for lop_fixrx\n" +msgstr "%s: ugyldig mmo-fil: forventede y = 0, fik y = %d for lop_fixrx\n" + +#: mmo.c:1773 +#, c-format +msgid "%s: invalid mmo file: expected z = 16 or z = 24, got z = %d for lop_fixrx\n" +msgstr "%s: ugyldig mmo-fil: forventede z = 16 eller z = 24, fik z = %d for lop_fixr\n" + +#: mmo.c:1796 +#, c-format +msgid "%s: invalid mmo file: leading byte of operand word must be 0 or 1, got %d for lop_fixrx\n" +msgstr "%s: ugyldig mmo-fil: indledende byte i operandord skal være 0 eller 1, fik %d for lop_fixrx\n" + +#: mmo.c:1819 +#, c-format +msgid "%s: cannot allocate file name for file number %d, %d bytes\n" +msgstr "%s: kan ikke allokere filnavn for fil nummer %d, %d byte\n" + +#: mmo.c:1839 +#, c-format +msgid "%s: invalid mmo file: file number %d `%s', was already entered as `%s'\n" +msgstr "%s: ugyldig mmo-fil: fil nummer %d \"%s\", var allerede angivet som \"%s\"\n" + +#: mmo.c:1852 +#, c-format +msgid "%s: invalid mmo file: file name for number %d was not specified before use\n" +msgstr "%s: ugyldig mmo-fil: filnavnet for nummer %d blev ikke angivet inden brug\n" + +#: mmo.c:1958 +#, c-format +msgid "%s: invalid mmo file: fields y and z of lop_stab non-zero, y: %d, z: %d\n" +msgstr "%s: ugyldig mmo-fil: felter y og z i lop_stab er ikke-tomme, y: %d, z: %d\n" + +#: mmo.c:1994 +#, c-format +msgid "%s: invalid mmo file: lop_end not last item in file\n" +msgstr "%s: ugyldig mmo-fil: lop_end er ikke sidste objekt i fil\n" + +#: mmo.c:2007 +#, c-format +msgid "%s: invalid mmo file: YZ of lop_end (%ld) not equal to the number of tetras to the preceding lop_stab (%ld)\n" +msgstr "%s: ugyldig mmo-fil: YZ i lop_end (%ld) er ikke lig med antal af tetraer til den foregående lop_stab (%ld)\n" + +#: mmo.c:2670 +#, c-format +msgid "%s: invalid symbol table: duplicate symbol `%s'\n" +msgstr "%s: ugyldig symboltabel: dubletsymbol \"%s\"\n" + +#: mmo.c:2921 +#, c-format +msgid "%s: Bad symbol definition: `Main' set to %s rather than the start address %s\n" +msgstr "%s: Fejlagtig symboldefinition: \"Main\" er sat til %s i stedet for startadressen %s\n" + +#: mmo.c:3011 +#, c-format +msgid "%s: warning: symbol table too large for mmo, larger than 65535 32-bit words: %d. Only `Main' will be emitted.\n" +msgstr "%s: advarsel: symboltabellen er for stor for mmo, større end 65535 32-bit ord: %d. Kun \"Main\" vil blive sendt.\n" + +#: mmo.c:3056 +#, c-format +msgid "%s: internal error, symbol table changed size from %d to %d words\n" +msgstr "%s: intern fejl, symboltabellen ændrede størrelse fra %d til %d ord\n" + +#: mmo.c:3111 +#, c-format +msgid "%s: internal error, internal register section %s had contents\n" +msgstr "%s: intern fejl, den interne registersektion %s havde indhold\n" + +#: mmo.c:3163 +#, c-format +msgid "%s: no initialized registers; section length 0\n" +msgstr "%s: ingen initierede registre; sektionslængde 0\n" + +#: mmo.c:3169 +#, c-format +msgid "%s: too many initialized registers; section length %ld\n" +msgstr "%s: for mange initierede registre; sektionslængde %ld\n" + +#: mmo.c:3174 +#, c-format +msgid "%s: invalid start address for initialized registers of length %ld: 0x%lx%08lx\n" +msgstr "%s: ugyldig startadresse for initierede registre med længden %ld: 0x%lx%08lx\n" + +#: oasys.c:1029 +#, c-format +msgid "%s: can not represent section `%s' in oasys" +msgstr "%s: kan ikke repræsentere sektionen \"%s\" i oasys" + +#: osf-core.c:132 +#, c-format +msgid "Unhandled OSF/1 core file section type %d\n" +msgstr "Uhåndteret sektionstype %d for OSF/1-hukommelsesfil\n" + +#: pe-mips.c:658 +#, c-format +msgid "%s: `ld -r' not supported with PE MIPS objects\n" +msgstr "%s: \"ld -r\" understøttes ikke med PE MIPS-objekt\n" + +#. OK, at this point the following variables are set up: +#. src = VMA of the memory we're fixing up +#. mem = pointer to memory we're fixing up +#. val = VMA of what we need to refer to +#. +#: pe-mips.c:794 +#, c-format +msgid "%s: unimplemented %s\n" +msgstr "%s: uimplementeret %s\n" + +#: pe-mips.c:820 +#, c-format +msgid "%s: jump too far away\n" +msgstr "%s: hop for langt bort\n" + +#: pe-mips.c:847 +#, c-format +msgid "%s: bad pair/reflo after refhi\n" +msgstr "%s: fejlagtigt par/reflo efter refhi\n" + +#. XXX code yet to be written. +#: peicode.h:785 +#, c-format +msgid "%s: Unhandled import type; %x" +msgstr "%s: Uhåndteret importtype; %x" + +#: peicode.h:790 +#, c-format +msgid "%s: Unrecognised import type; %x" +msgstr "%s: Ukendt importtype; %x" + +#: peicode.h:804 +#, c-format +msgid "%s: Unrecognised import name type; %x" +msgstr "%s: Ukendt importnavnstype; %x" + +#: peicode.h:1162 +#, c-format +msgid "%s: Unrecognised machine type (0x%x) in Import Library Format archive" +msgstr "%s: Ukendt maskintype (0x%x) i Import Library Format-arkiv" + +#: peicode.h:1174 +#, c-format +msgid "%s: Recognised but unhandled machine type (0x%x) in Import Library Format archive" +msgstr "%s: Kendt men uhåndteret maskintype (0x%x) i Import Library Format-arkiv" + +#: peicode.h:1191 +#, c-format +msgid "%s: size field is zero in Import Library Format header" +msgstr "%s: størrelsesfeltet er nul i Import Library Format-hoved" + +#: peicode.h:1219 +#, c-format +msgid "%s: string not null terminated in ILF object file." +msgstr "%s: streng ikke nultermineret i ILF-objektfil." + +#: ppcboot.c:416 +msgid "" +"\n" +"ppcboot header:\n" +msgstr "" +"\n" +"ppcboot-hoved:\n" + +#: ppcboot.c:417 +#, c-format +msgid "Entry offset = 0x%.8lx (%ld)\n" +msgstr "Startefstand = 0x%.8lx (%ld)\n" + +#: ppcboot.c:418 +#, c-format +msgid "Length = 0x%.8lx (%ld)\n" +msgstr "Længde = 0x%.8lx (%ld)\n" + +#: ppcboot.c:421 +#, c-format +msgid "Flag field = 0x%.2x\n" +msgstr "Flagfelt = 0x%.2x\n" + +#: ppcboot.c:427 +#, c-format +msgid "Partition name = \"%s\"\n" +msgstr "Partitionsnavn = \"%s\"\n" + +#: ppcboot.c:446 +#, c-format +msgid "" +"\n" +"Partition[%d] start = { 0x%.2x, 0x%.2x, 0x%.2x, 0x%.2x }\n" +msgstr "" +"\n" +"Start på partition[%d] = { 0x%.2x, 0x%.2x, 0x%.2x, 0x%.2x }\n" + +#: ppcboot.c:452 +#, c-format +msgid "Partition[%d] end = { 0x%.2x, 0x%.2x, 0x%.2x, 0x%.2x }\n" +msgstr "Slut på partition[%d] = { 0x%.2x, 0x%.2x, 0x%.2x, 0x%.2x }\n" + +#: ppcboot.c:458 +#, c-format +msgid "Partition[%d] sector = 0x%.8lx (%ld)\n" +msgstr "Sektor for partition[%d] = 0x%.8lx (%ld)\n" + +#: ppcboot.c:459 +#, c-format +msgid "Partition[%d] length = 0x%.8lx (%ld)\n" +msgstr "Længde på partition[%d] = 0x%.8lx (%ld)\n" + +#: som.c:5398 +msgid "som_sizeof_headers unimplemented" +msgstr "som_sizeof_headers er ikke implementeret" + +#: srec.c:301 +#, c-format +msgid "%s:%d: Unexpected character `%s' in S-record file\n" +msgstr "%s:%d: Uventet tegn \"%s\" i S-postfil\n" + +# Vad er stabs? +#: stabs.c:319 +#, c-format +msgid "%s(%s+0x%lx): Stabs entry has invalid string index." +msgstr "%s(%s+0x%lx): Stabpost har ugyldigt strengindex." + +#: syms.c:1044 +msgid "Unsupported .stab relocation" +msgstr ".stab-relokalisering som ikke understøttes" + +#: vms-gsd.c:356 +#, c-format +msgid "bfd_make_section (%s) failed" +msgstr "bfd_make_section (%s) mislykkedes" + +#: vms-gsd.c:371 +#, c-format +msgid "bfd_set_section_flags (%s, %x) failed" +msgstr "bfd_set_section_flags (%s, %x) mislykkedes" + +#: vms-gsd.c:407 +#, c-format +msgid "Size mismatch section %s=%lx, %s=%lx" +msgstr "Størrelsen passer ikke på sektion %s=%lx, %s=%lx" + +#: vms-gsd.c:702 +#, c-format +msgid "unknown gsd/egsd subtype %d" +msgstr "ukendt gsd/egsd-undertype %d" + +#: vms-hdr.c:406 +msgid "Object module NOT error-free !\n" +msgstr "Objektmodulet IKKE fejlfri!\n" + +#: vms-misc.c:543 +#, c-format +msgid "Stack overflow (%d) in _bfd_vms_push" +msgstr "Stakken giver overløb (%d) i _bfd_vms_push" + +#: vms-misc.c:561 +msgid "Stack underflow in _bfd_vms_pop" +msgstr "Stakken giver underløb i _bfd_vms_pop" + +#: vms-misc.c:919 +msgid "_bfd_vms_output_counted called with zero bytes" +msgstr "_bfd_vms_output_counted kaldt med nul byte" + +#: vms-misc.c:924 +msgid "_bfd_vms_output_counted called with too many bytes" +msgstr "_bfd_vms_output_counted called kaldt med for mange byte" + +#: vms-misc.c:1055 +#, c-format +msgid "Symbol %s replaced by %s\n" +msgstr "Symbol %s erstattet med %s\n" + +#: vms-misc.c:1117 +#, c-format +msgid "failed to enter %s" +msgstr "mislykkedes med at gå ind i %s" + +#: vms-tir.c:81 +msgid "No Mem !" +msgstr "Ingen hukommelse!" + +#: vms-tir.c:362 +#, c-format +msgid "bad section index in %s" +msgstr "fejlagtigt sektionsindex i %s" + +#: vms-tir.c:375 +#, c-format +msgid "unsupported STA cmd %s" +msgstr "STA-kommando %s understøttes ikke" + +#: vms-tir.c:380 vms-tir.c:1240 +#, c-format +msgid "reserved STA cmd %d" +msgstr "reserveret STA-kommando %d" + +#: vms-tir.c:491 vms-tir.c:514 +#, c-format +msgid "%s: no symbol \"%s\"" +msgstr "%s: intet symbol \"%s\"" + +#. unsigned shift +#. rotate +#. Redefine symbol to current location. +#. Define a literal. +#: vms-tir.c:581 vms-tir.c:693 vms-tir.c:803 vms-tir.c:821 vms-tir.c:829 +#: vms-tir.c:838 vms-tir.c:1563 +#, c-format +msgid "%s: not supported" +msgstr "%s: understøttes ikke" + +#: vms-tir.c:586 vms-tir.c:1418 +#, c-format +msgid "%s: not implemented" +msgstr "%s: ikke implementeret" + +#: vms-tir.c:590 vms-tir.c:1422 +#, c-format +msgid "reserved STO cmd %d" +msgstr "reserveret STO-kommando %d" + +#: vms-tir.c:708 vms-tir.c:1568 +#, c-format +msgid "reserved OPR cmd %d" +msgstr "reserveret OPR-kommando %d" + +#: vms-tir.c:776 vms-tir.c:1632 +#, c-format +msgid "reserved CTL cmd %d" +msgstr "reserveret CTL-kommando %d" + +#. stack byte from image +#. arg: none. +#: vms-tir.c:1148 +msgid "stack-from-image not implemented" +msgstr "stack-from-image er ikke implementeret" + +#: vms-tir.c:1166 +msgid "stack-entry-mask not fully implemented" +msgstr "stack-entry-mask er ikke helt implementeret" + +#. compare procedure argument +#. arg: cs symbol name +#. by argument index +#. da argument descriptor +#. +#. compare argument descriptor with symbol argument (ARG$V_PASSMECH) +#. and stack TRUE (args match) or FALSE (args dont match) value. +#: vms-tir.c:1180 +msgid "PASSMECH not fully implemented" +msgstr "PASSMECH er ikke helt implementeret" + +#: vms-tir.c:1199 +msgid "stack-local-symbol not fully implemented" +msgstr "stack-local-symbol er ikke helt implementeret" + +#: vms-tir.c:1212 +msgid "stack-literal not fully implemented" +msgstr "stack-literal er ikke helt implementeret" + +#: vms-tir.c:1233 +msgid "stack-local-symbol-entry-point-mask not fully implemented" +msgstr "stack-local-symbol-entry-point-mask er ikke helt implementeret" + +#: vms-tir.c:1510 vms-tir.c:1522 vms-tir.c:1534 vms-tir.c:1546 vms-tir.c:1611 +#: vms-tir.c:1619 vms-tir.c:1627 +#, c-format +msgid "%s: not fully implemented" +msgstr "%s: ikke helt implementeret" + +#: vms-tir.c:1684 +#, c-format +msgid "obj code %d not found" +msgstr "objektkode %d kunne ikke findes" + +#: vms-tir.c:2019 +#, c-format +msgid "SEC_RELOC with no relocs in section %s" +msgstr "SEC_RELOC uden relokaliseringer i sektion %s" + +#: vms-tir.c:2307 +#, c-format +msgid "Unhandled relocation %s" +msgstr "Uhåndteret relokalisering %s" + +#: xcofflink.c:1243 +#, c-format +msgid "%s: `%s' has line numbers but no enclosing section" +msgstr "%s: \"%s\" har linjenumre men ingen omsluttende sektion" + +#: xcofflink.c:1296 +#, c-format +msgid "%s: class %d symbol `%s' has no aux entries" +msgstr "%s: klasse %d-symbol \"%s\" har ingen ydre poster" + +#: xcofflink.c:1319 +#, c-format +msgid "%s: symbol `%s' has unrecognized csect type %d" +msgstr "%s: symbol \"%s\" har ukendt csect-type %d" + +#: xcofflink.c:1331 +#, c-format +msgid "%s: bad XTY_ER symbol `%s': class %d scnum %d scnlen %d" +msgstr "%s: fejlagtig XTY_ER-symbol \"%s\": klasse %d scnum %d scnlen %d" + +#: xcofflink.c:1367 +#, c-format +msgid "%s: XMC_TC0 symbol `%s' is class %d scnlen %d" +msgstr "%s: XMC_TC0-symbol \"%s\" er klasse %d scnlen %d" + +#: xcofflink.c:1519 +#, c-format +msgid "%s: csect `%s' not in enclosing section" +msgstr "%s: csect \"%s\" er ikke i omsluttende sektion" + +#: xcofflink.c:1626 +#, c-format +msgid "%s: misplaced XTY_LD `%s'" +msgstr "%s: fejlagtigt placeret XTY_LD \"%s\"" + +#: xcofflink.c:1957 +#, c-format +msgid "%s: reloc %s:%d not in csect" +msgstr "%s: relokaliseringen %s:%d er ikke i csect" + +#: xcofflink.c:2092 +#, c-format +msgid "%s: XCOFF shared object when not producing XCOFF output" +msgstr "%s: XCOFF delt objekt når ikke XCOFF-uddata produceres" + +#: xcofflink.c:2113 +#, c-format +msgid "%s: dynamic object with no .loader section" +msgstr "%s: dynamisk objekt uden nogen .loader-sektion" + +#: xcofflink.c:2758 +#, c-format +msgid "%s: no such symbol" +msgstr "%s: intet sådant symbol" + +#: xcofflink.c:2891 +msgid "error: undefined symbol __rtinit" +msgstr "fejl: udefineret symbol __rtinit" + +#: xcofflink.c:3453 +#, c-format +msgid "warning: attempt to export undefined symbol `%s'" +msgstr "advarsel: forsøg på at eksportere udefineret symbol \"%s\"" + +#: xcofflink.c:4447 +#, c-format +msgid "TOC overflow: 0x%lx > 0x10000; try -mminimal-toc when compiling" +msgstr "TOC giver overløb: 0x%lx > 0x10000; prøv -mminimal-toc ved kompilering" + +#: xcofflink.c:5287 xcofflink.c:5756 xcofflink.c:5818 xcofflink.c:6119 +#, c-format +msgid "%s: loader reloc in unrecognized section `%s'" +msgstr "%s: indlæserrelokalisering i ukendt sektion \"%s\"" + +#: xcofflink.c:5309 xcofflink.c:6130 +#, c-format +msgid "%s: `%s' in loader reloc but not loader sym" +msgstr "%s: \"%s\" i indlæserrelokalisering men ikke indlæsersym" + +#: xcofflink.c:5324 +#, c-format +msgid "%s: loader reloc in read-only section %s" +msgstr "%s: indlæserrelokalisering i skrivebeskyttet sektion %s" + +#: elf32-ia64.c:2222 elf64-ia64.c:2222 +msgid "@pltoff reloc against local symbol" +msgstr "@pltoff-relokalisering mod lokalt symbol" + +#: elf32-ia64.c:3562 elf64-ia64.c:3562 +#, c-format +msgid "%s: short data segment overflowed (0x%lx >= 0x400000)" +msgstr "%s: kort datasegment løb over (0x%lx >= 0x400000)" + +#: elf32-ia64.c:3573 elf64-ia64.c:3573 +#, c-format +msgid "%s: __gp does not cover short data segment" +msgstr "%s: __gp dækker ikke kort datasegment" + +#: elf32-ia64.c:3858 elf64-ia64.c:3858 +#, c-format +msgid "%s: linking non-pic code in a shared library" +msgstr "%s: lænker ikke-pic-kode i delt bibliotek" + +#: elf32-ia64.c:3891 elf64-ia64.c:3891 +#, c-format +msgid "%s: @gprel relocation against dynamic symbol %s" +msgstr "%s: @gprel-relokalisering mod dynamisk symbol %s" + +#: elf32-ia64.c:4030 elf64-ia64.c:4030 +#, c-format +msgid "%s: dynamic relocation against speculation fixup" +msgstr "%s: dynamisk relokalisering uden spekulationsrettelser" + +#: elf32-ia64.c:4038 elf64-ia64.c:4038 +#, c-format +msgid "%s: speculation fixup against undefined weak symbol" +msgstr "%s: spekulationsfix mod udefineret svagt symbol" + +#: elf32-ia64.c:4271 elf64-ia64.c:4271 +msgid "unsupported reloc" +msgstr "relokaliseringen understøttes ikke" + +#: elf32-ia64.c:4551 elf64-ia64.c:4551 +#, c-format +msgid "%s: linking trap-on-NULL-dereference with non-trapping files" +msgstr "%s: lænker fang-ved-NULL-dereference med ikkefangende filer" + +#: elf32-ia64.c:4560 elf64-ia64.c:4560 +#, c-format +msgid "%s: linking big-endian files with little-endian files" +msgstr "%s: lænker big endian-filer med little endian-filer" + +#: elf32-ia64.c:4569 elf64-ia64.c:4569 +#, c-format +msgid "%s: linking 64-bit files with 32-bit files" +msgstr "%s: lænker 64-bitfiler med 32-bitfiler" + +#: elf32-ia64.c:4578 elf64-ia64.c:4578 +#, c-format +msgid "%s: linking constant-gp files with non-constant-gp files" +msgstr "%s: lænker konstant-gp-filer med ikke-konstant-gp-filer" + +#: elf32-ia64.c:4588 elf64-ia64.c:4588 +#, c-format +msgid "%s: linking auto-pic files with non-auto-pic files" +msgstr "%s: lænker auto-pic-filer med ikke-auto-pic-filer" + +#: peigen.c:962 pepigen.c:962 +#, c-format +msgid "%s: line number overflow: 0x%lx > 0xffff" +msgstr "%s: linjenummer giver overløb: 0x%lx > 0xffff" + +#: peigen.c:979 pepigen.c:979 +#, c-format +msgid "%s: reloc overflow 1: 0x%lx > 0xffff" +msgstr "%s: relokalisering giver overløb 1: 0x%lx > 0xffff" + +#: peigen.c:993 pepigen.c:993 +msgid "Export Directory [.edata (or where ever we found it)]" +msgstr "Eksportkatalog [.edata (eller hvor vi fandt det)]" + +#: peigen.c:994 pepigen.c:994 +msgid "Import Directory [parts of .idata]" +msgstr "Importkatalog [dele af .idata]" + +#: peigen.c:995 pepigen.c:995 +msgid "Resource Directory [.rsrc]" +msgstr "Resursekatalog [.rsrc]" + +#: peigen.c:996 pepigen.c:996 +msgid "Exception Directory [.pdata]" +msgstr "Undtagelseskatalog [.pdata]" + +#: peigen.c:997 pepigen.c:997 +msgid "Security Directory" +msgstr "Sikkerhedskatalog" + +#: peigen.c:998 pepigen.c:998 +msgid "Base Relocation Directory [.reloc]" +msgstr "Baserelokaliseringskatalog [.reloc]" + +#: peigen.c:999 pepigen.c:999 +msgid "Debug Directory" +msgstr "Fejlsøgningskatalog" + +#: peigen.c:1000 pepigen.c:1000 +msgid "Description Directory" +msgstr "Beskrivelseskatalog" + +#: peigen.c:1001 pepigen.c:1001 +msgid "Special Directory" +msgstr "Specialkatalog" + +#: peigen.c:1002 pepigen.c:1002 +msgid "Thread Storage Directory [.tls]" +msgstr "Trådlagringskatalog [.tls]" + +#: peigen.c:1003 pepigen.c:1003 +msgid "Load Configuration Directory" +msgstr "Indlæsningskonfigurationskatalog" + +#: peigen.c:1004 pepigen.c:1004 +msgid "Bound Import Directory" +msgstr "Katalog over bundne importer" + +#: peigen.c:1005 pepigen.c:1005 +msgid "Import Address Table Directory" +msgstr "Importadressetabelkatalog" + +#: peigen.c:1006 pepigen.c:1006 +msgid "Delay Import Directory" +msgstr "Katalog over forskinkede importer" + +#: peigen.c:1007 peigen.c:1008 pepigen.c:1007 pepigen.c:1008 +msgid "Reserved" +msgstr "Reserveret" + +#: peigen.c:1071 pepigen.c:1071 +msgid "" +"\n" +"There is an import table, but the section containing it could not be found\n" +msgstr "" +"\n" +"Der findes en importtabel, men sektionen som indeholder den kunne ikke findes\n" + +#: peigen.c:1076 pepigen.c:1076 +#, c-format +msgid "" +"\n" +"There is an import table in %s at 0x%lx\n" +msgstr "" +"\n" +"Der findes en importtabel i %s på 0x%lx\n" + +#: peigen.c:1113 pepigen.c:1113 +#, c-format +msgid "" +"\n" +"Function descriptor located at the start address: %04lx\n" +msgstr "" +"\n" +"Funktionsidentifikatorer fundet på startadressen: %04lx\n" + +#: peigen.c:1116 pepigen.c:1116 +#, c-format +msgid "\tcode-base %08lx toc (loadable/actual) %08lx/%08lx\n" +msgstr "\tkodebase %08lx toc (indlæsningsbar/reelt) %08lx/%08lx\n" + +#: peigen.c:1122 pepigen.c:1122 +msgid "" +"\n" +"No reldata section! Function descriptor not decoded.\n" +msgstr "" +"\n" +"Ingen reldata-sektion! Funktionsidentifikatorer afkodedes ikke.\n" + +#: peigen.c:1127 pepigen.c:1127 +#, c-format +msgid "" +"\n" +"The Import Tables (interpreted %s section contents)\n" +msgstr "" +"\n" +"Importtabellerne (tolket indhold i %s-sektion)\n" + +# Vad er thunk? +#: peigen.c:1130 pepigen.c:1130 +msgid "" +" vma: Hint Time Forward DLL First\n" +" Table Stamp Chain Name Thunk\n" +msgstr "" +" vma: Tips- Tids- Fremad- DLL- Første\n" +" tabel stempel kæde navn thunk\n" + +#: peigen.c:1181 pepigen.c:1181 +#, c-format +msgid "" +"\n" +"\tDLL Name: %s\n" +msgstr "" +"\n" +"\tDLL-navn: %s\n" + +#: peigen.c:1192 pepigen.c:1192 +msgid "\tvma: Hint/Ord Member-Name Bound-To\n" +msgstr "\tvma: Tips/Ordn Medlemsnavn Bundet til\n" + +#: peigen.c:1217 pepigen.c:1217 +msgid "" +"\n" +"There is a first thunk, but the section containing it could not be found\n" +msgstr "" +"\n" +"Der findes en første thunk, men sektionen som indeholder den kunne ikke findes\n" + +#: peigen.c:1357 pepigen.c:1357 +msgid "" +"\n" +"There is an export table, but the section containing it could not be found\n" +msgstr "" +"\n" +"Der findes en eksporttabel, men sektionen som indeholder den kunne ikke findes\n" + +#: peigen.c:1362 pepigen.c:1362 +#, c-format +msgid "" +"\n" +"There is an export table in %s at 0x%lx\n" +msgstr "" +"\n" +"Der findes en eksporttabel i %s ved 0x%lx\n" + +#: peigen.c:1393 pepigen.c:1393 +#, c-format +msgid "" +"\n" +"The Export Tables (interpreted %s section contents)\n" +"\n" +msgstr "" +"\n" +"Eksporttabellerne (tolket indhold i %s-sektion)\n" + +#: peigen.c:1397 pepigen.c:1397 +#, c-format +msgid "Export Flags \t\t\t%lx\n" +msgstr "Eksportflag \t\t\t%lx\n" + +#: peigen.c:1400 pepigen.c:1400 +#, c-format +msgid "Time/Date stamp \t\t%lx\n" +msgstr "Tids/datostempel \t\t%lx\n" + +#: peigen.c:1403 pepigen.c:1403 +#, c-format +msgid "Major/Minor \t\t\t%d/%d\n" +msgstr "Større/mindre \t\t\t%d/%d\n" + +#: peigen.c:1406 pepigen.c:1406 +msgid "Name \t\t\t\t" +msgstr "Navn \t\t\t\t" + +#: peigen.c:1412 pepigen.c:1412 +#, c-format +msgid "Ordinal Base \t\t\t%ld\n" +msgstr "Ordningsbase \t\t\t%ld\n" + +#: peigen.c:1415 pepigen.c:1415 +msgid "Number in:\n" +msgstr "Tal i:\n" + +#: peigen.c:1418 pepigen.c:1418 +#, c-format +msgid "\tExport Address Table \t\t%08lx\n" +msgstr "\tEksportadressetabel \t\t%08lx\n" + +#: peigen.c:1422 pepigen.c:1422 +#, c-format +msgid "\t[Name Pointer/Ordinal] Table\t%08lx\n" +msgstr "\t[Navnepeger/Ordningstal]-tabel\t%08lx\n" + +#: peigen.c:1425 pepigen.c:1425 +msgid "Table Addresses\n" +msgstr "Tabeladresser\n" + +#: peigen.c:1428 pepigen.c:1428 +msgid "\tExport Address Table \t\t" +msgstr "\tEksportadressetabel \t\t" + +#: peigen.c:1433 pepigen.c:1433 +msgid "\tName Pointer Table \t\t" +msgstr "\tNavnepegertabel \t\t" + +#: peigen.c:1438 pepigen.c:1438 +msgid "\tOrdinal Table \t\t\t" +msgstr "\tOrdningstalstabel \t\t\t" + +#: peigen.c:1453 pepigen.c:1453 +#, c-format +msgid "" +"\n" +"Export Address Table -- Ordinal Base %ld\n" +msgstr "" +"\n" +"Eksportadressetabel -- Ordningsbase %ld\n" + +#: peigen.c:1472 pepigen.c:1472 +msgid "Forwarder RVA" +msgstr "Videresender-RVA" + +#: peigen.c:1483 pepigen.c:1483 +msgid "Export RVA" +msgstr "Eksport-RVA" + +#: peigen.c:1490 pepigen.c:1490 +msgid "" +"\n" +"[Ordinal/Name Pointer] Table\n" +msgstr "" +"\n" +"[Ordningstals-/Navnepeger-]tabel\n" + +#: peigen.c:1545 pepigen.c:1545 +#, c-format +msgid "Warning, .pdata section size (%ld) is not a multiple of %d\n" +msgstr "Advarsel, størrelsen på .pdata-sektionen (%ld) er ikke en multipel af %d\n" + +#: peigen.c:1549 pepigen.c:1549 +msgid "" +"\n" +"The Function Table (interpreted .pdata section contents)\n" +msgstr "" +"\n" +"Funktionstabellen (tolket indhold fra .pdata-sektionen)\n" + +#: peigen.c:1552 pepigen.c:1552 +msgid " vma:\t\t\tBegin Address End Address Unwind Info\n" +msgstr " vma:\t\t\tStartadresse Slutadresse Tilbagespolings-information\n" + +#: peigen.c:1554 pepigen.c:1554 +msgid "" +" vma:\t\tBegin End EH EH PrologEnd Exception\n" +" \t\tAddress Address Handler Data Address Mask\n" +msgstr "" +" vma:\t\tStart- Slut- EH- EH- Prologsluts- Undtagelses-\n" +" \t\tadresse adresse håndterer data adresse maske\n" + +#: peigen.c:1624 pepigen.c:1624 +msgid " Register save millicode" +msgstr " Registergemnings millikode" + +#: peigen.c:1627 pepigen.c:1627 +msgid " Register restore millicode" +msgstr " Registergenskabnings millikode" + +#: peigen.c:1630 pepigen.c:1630 +msgid " Glue code sequence" +msgstr " Klisterkodesekvens" + +#: peigen.c:1682 pepigen.c:1682 +msgid "" +"\n" +"\n" +"PE File Base Relocations (interpreted .reloc section contents)\n" +msgstr "" +"\n" +"\n" +"PE-filbaserelokaliseringer (tolket indhold i .reloc-sektionen)\n" + +#: peigen.c:1712 pepigen.c:1712 +#, c-format +msgid "" +"\n" +"Virtual Address: %08lx Chunk size %ld (0x%lx) Number of fixups %ld\n" +msgstr "" +"\n" +"Virtuel adresse: %08lx Områdesstørrelse %ld (0x%lx) Antal rettelser %ld\n" + +#: peigen.c:1725 pepigen.c:1725 +#, c-format +msgid "\treloc %4d offset %4x [%4lx] %s" +msgstr "\trelokalisering %4d afstand %4x [%4lx] %s" + +#. The MS dumpbin program reportedly ands with 0xff0f before +#. printing the characteristics field. Not sure why. No reason to +#. emulate it here. +#: peigen.c:1765 pepigen.c:1765 +#, c-format +msgid "" +"\n" +"Characteristics 0x%x\n" +msgstr "" +"\n" +"Karakteristik 0x%x\n" diff -Nurpa binutils-2.13/bfd/po/sv.gmo binutils-2.13.1/bfd/po/sv.gmo --- binutils-2.13/bfd/po/sv.gmo 2002-08-06 09:31:38.000000000 -0400 +++ binutils-2.13.1/bfd/po/sv.gmo 2002-11-07 17:40:01.000000000 -0500 @@ -13,15 +13,14 @@ F%-F SFEtF4ºF;ï www 3w">w%aw ‡w“w³w)Èw/òw"x.Ax,pxx:¹x%ôx%y@y"Yy?|y¼yÛyäy*ÿy&*zQziz$|z¡z$³zØz!øz{D4{Dy{/¾{î{?|@|Q|q|7ˆ|*À|ë|}%}?}R}o}JŒ}J×}J"~Im~:·~;ò~:.6ii D €dO€F´€û€:8U7ŽÆæ2û..‚]‚u‚%’‚¸‚Õ‚-ñ‚+ƒ+Kƒ wƒ˜ƒ«ƒ¾ƒ$Þƒ"„&„,D„ q„%’„¸„΄ä„*… .…O…m…ƒ…—…¬…Â…Ö…!í…†*†>†R†f† z†&›† †#ã†(‡90‡j‡3…‡!¹‡0Û‡ ˆ(ˆ?ˆQˆhˆˆ“ˆ¦ˆ!ºˆ-܈0 -‰+;‰4g‰=œ‰)Ú‰‹‹8‹L‹'d‹6Œ‹)Ë+í‹ŒA)Œ%kŒ‘Œ«ŒÇŒàŒïŒ! 1Rg&{7¢?Ú>ŽYŽ2iŽ<œŽ2ÙŽO *\O‡)×OQgC"Ãæ5÷,-‘,Z‘‡‘™‘¹‘Ì‘è‘’’'’=’N’ _’ l’ v’ „’ -’’ -’ -¨’³’Ç’ Ð’+Ý’& “%0“ V“c“u“&‘“¸“Г ã“(í“” ”(”1” :”D”M”V” _” i”u” ‹”—”­”¼” Ò”ó”•• ;•H•=b•~ •y–™–.«–/Ú–5 -—1@—(r—B›—Þ—-õ—6#˜bZ˜8½˜3ö˜ *™#K™4o™2¤™0×™3šD<šOš?Ñš9›/K›#{›CŸ›=ã›,!œ3Nœ<‚œ6¿œ.öœX%=~W¼3ž2Hž<{ž<¸ž{õž8qŸ-ªŸ-ØŸ` 3g Y› 8õ 1.¡P`¡M±¡=ÿ¡E=¢6ƒ¢3º¢6î¢(%£>N£?£FÍ£C¤=X¤–¤ ²¤,Ó¤¥¥;¥8S¥/Œ¥F¼¥L¦8P¦/‰¦%¹¦Bߦ5"§4X§*§;¸§Bô§<7¨$t¨9™¨-Ó¨.©$0©U©?s©D³©@ø©09ªKjª9¶ª"ðª«1.«0`«6‘«6È«=ÿ«?=¬C}¬OÁ¬C­QU­O§­'÷­>®1^®1®-®Jð®8;¯t¯/Ž¯2¾¯*ñ¯5°ER°7˜°3а±.#±/R±#‚±<¦±Dã±(²=C²j²Bì²A/³Lq³K¾³N -´KY´J¥´Dð´>5µ]tµ:Òµ, ¶!:¶L\¶7©¶-ᶷ+(·,T·'·3©·1Ý·1¸3A¸7u¸3­¸)á¸; ¹6G¹1~¹"°¹+Ó¹.ÿ¹.ºEº[ºwºŽº=º7Ûº#»;7»@s»*´»2ß»6¼\I¼D¦¼4ë¼R ½\s½RнS#¾Cw¾A»¾5ý¾83¿/l¿/œ¿/Ì¿(ü¿%%À*KÀ5vÀ7¬À0äÀ2Á*HÁ)sÁ#Á0ÁÁòÁ, Â9Â2PƒÂ/£Â"ÓÂAöÂ&8Ã*_Ã[ŠÃLæÃC3ÄJwÄLÂÄ:ÅBJÅ:Å8ÈÅFÆZHÆD£Æ2èÆ2Ç2NÇ;Çv½Ç)4ÈJ^ÈG©È'ñÈ3ÉQMÉGŸÉNçÉS6ÊCŠÊ1ÎÊË8Ë@AË‚Ë—Ë­ËÇË'ÏË:÷Ë2ÌFQÌ#˜Ì+¼Ì0èÌÍ")ÍLÍ.iͫ͘ÍËÍ(áÍ -Î^Î,}Î2ªÎ0ÝÎ/Ï2>Ï_qÏ2ÑÏSÐ_XÐ_¸Ð:Ñ$SÑXxÑUÑÑB'ÒBjÒP­ÒRþÒRQÓG¤ÓGìÓF4ÔF{Ô$ÂÔVçÔ>ÕQÕ1kÕÕ -³Õ8¾Õ÷ÕÖ,ÖBÖTÖdÖ‚Ö;–Ö4ÒÖ>×F×`×L€×Í×Þ×$í×3ØFØfØ {Ø‰Ø˜Ø§Ø ¶Ø ÀØ ÍØ×Ø òØ#Ù<$ÙaÙiÙ…Ù+™Ù1ÅÙ#÷Ù1Ú/MÚ}Ú>™Ú'ØÚ)Û*Û)GÛ?qÛ±Û -ÏÛÚÛ3ðÛ,$ÜQÜnÜ/ܯÜ*¾Ü%éÜ)Ý9Ý>TÝ>“Ý1ÒÝÞGÞ\ÞlÞ‡Þ3 Þ-ÔÞßß0ßKß`ß#~ßL¢ßIïßF9àK€à:ÌàGá=Oá=ábËáH.âfwâTÞâ$3ãCXã=œã<Úã$ä<ä9Uä-ä½ä"Úä+ýä)åGå2eå0˜å0Éå úåæ;æXæ"qæ ”æµæ(Ìæõæ* ç8çVç)tç7žç Öç(÷ç è?èUèlè„èšè)³è!Ýèÿèé5éPé(ké+”é&Àé(çé-ê>>ê}ê8›ê1Ôê,ë3ëNëië…ë¥ë¾ëÎëßë%ñë3ì8Kì-„ì:²ìKíì¾uþÕ¬Úr(e¤ÎF•å^Wä#B¯î{LQ†×ìˆGòDét9ï b +1 ?Ìjfm¢xçm3‹d®CXQ¨Â%l ›:Eп­c[M—;ÖOTpk~ÛH­Ö¾/ó,P“"zJÚ.g‰=;ÕrËõƒ Èüí +‰+;‰4g‰=œ‰)Ú‰‹‹8‹L‹'d‹6Œ‹)Ë(í‹ŒA&Œ%hŒŽŒ¨ŒÄŒÝŒìŒ! .Od&x7Ÿ?×>ŽVŽ2fŽ<™Ž2ÖŽO *YO„)ÔOþNdC|"Àã5ô,*‘,W‘„‘–‘¶‘É‘å‘ý‘’$’:’K’ \’ i’ s’ ’ +’ +š’ +¥’°’Ä’ Í’+Ú’&“%-“ S“`“r“&Ž“µ“Í“ à“(ê“” ”%”.” 7”A”J”S” \” f”r” ˆ”””ª”¹” ϔ𔕕 8•E•=_•~•y–––.¨–/×–5—1=—(o—B˜—Û—-ò—6 ˜bW˜8º˜3ó˜ '™#H™4l™2¡™0Ô™3šD9šO~š?Κ9›/H›#x›Cœ›=à›,œ3Kœ<œ6¼œ.óœX"={W¹3ž2Ež<xž<µž{òž8nŸ-§Ÿ-ÕŸ` 3d Y˜ 8ò 1+¡P]¡M®¡=ü¡E:¢6€¢3·¢6ë¢("£>K£?Š£FÊ£C¤=U¤“¤ ¯¤,Фý¤¥8¥8P¥/‰¥F¹¥L¦8M¦/†¦%¶¦Bܦ5§4U§*Š§;µ§Bñ§<4¨$q¨9–¨-Ш.þ¨$-©R©?p©D°©@õ©06ªKgª9³ª"íª«1+«0]«6Ž«6Å«=ü«?:¬Cz¬O¾¬C­QR­O¤­'ô­>®1[®1®-¿®Jí®88¯q¯/‹¯2»¯*î¯5°EO°7•°3Í°±. ±/O±#±<£±Dà±%²=@²j~²Bé²A,³Ln³K»³N´KV´J¢´Dí´>2µ]qµ:ϵ, +¶!7¶LY¶7¦¶-Þ¶ ·+%·,Q·'~·3¦·1Ú·1 ¸3>¸7r¸3ª¸)Þ¸;¹6D¹1{¹"­¹+й.ü¹+ºBºXºtº‹º=šº7غ#»;4»@p»*±»2Ü»6¼\F¼D£¼4è¼R½\p½RͽS ¾Ct¾A¸¾5ú¾80¿/i¿/™¿/É¿(ù¿%"À*HÀ5sÀ7©À0áÀ2Á*EÁ)pÁ#šÁ0¾ÁïÁ, Â6Â2M€Â/ Â"ÐÂAóÂ&5Ã*\Ã[‡ÃLãÃC0ÄJtÄL¿Ä: ÅBGÅ:ŠÅ8ÅÅFþÅZEÆD Æ2åÆ2Ç2KÇ;~ÇvºÇ)1ÈJ[ÈG¦È'îÈ3ÉQJÉGœÉNäÉS3ÊC‡Ê1ËÊýÊ8Ë@>Ë˔˪ËÄË'ÌË:ôË/ÌFNÌ#•Ì+¹Ì0åÌÍ"&ÍIÍ.f͕ͨÍÈÍ(ÞÍÎ^Î,zÎ2§Î0ÚÎ/ Ï2;Ï_nÏ2ÎÏSÐ_UÐ_µÐ:Ñ$PÑXuÑUÎÑB$ÒBgÒPªÒRûÒRNÓG¡ÓGéÓF1ÔFxÔ$¿ÔVäÔ;ÕNÕ1hÕšÕ +°Õ8»ÕôÕ Ö)Ö?ÖQÖaÖÖ;“Ö4ÏÖ>×C×]×L}×Ê×Û×$ê×3ØCØcØ xØ†Ø•Ø¤Ø ³Ø ½Ø ÊØÔØ ïØ#ýØ<!Ù^ÙfÙ‚Ù+–Ù1ÂÙ#ôÙ1Ú/JÚzÚ>–Ú'ÕÚ)ýÚ'Û)DÛ?nÛ®Û +ÌÛ×Û3íÛ,!ÜNÜkÜ/|ܬÜ*»Ü%æÜ) Ý6Ý>QÝ>Ý1ÏÝÞGÞYÞiÞ„Þ3Þ-ÑÞÿÞß-ßHß]ß#{ßLŸßIìßF6àK}à:ÉàGá=Lá=ŠábÈáH+âftâTÛâ$0ãCUã=™ã<×ã$ä9ä9Rä-Œäºä"×ä+úä&åDå2bå0•å0Æå ÷åæ8æUæ"næ ‘æ²æ(Éæòæ* +ç5çSç)qç7›ç Óç(ôçè<èRèièè—è)°è!Úèüèé2éMé(hé+‘é&½é(äé- ê>;êzê8˜ê1Ñê,ë0ëKëfë‚ë¢ë»ëËëÜë%îë3ì8Hì-ì:¯ìKêì¾uþÕ¬Úr(e¤ÎF•å^Wä#B¯î{LQ†×ìˆGòDét9ï b +1 ?Ìjfm¢xçm3‹d®CXQ¨Â%l ›:Eп­c[M—;ÖOTpk~ÛH­Ö¾/ó,P“"zJÚ.g‰=;ÕrËõƒ Èüí jŸ‚‹A£ðÊÔu²Š*!ƒ/LÞË´§~é©Ùœ»ßU  ÷À_è">•·’ÄS<hH%µÉª gÝÆߘ…äk¯nïv£YìŒ  ×|.A}úÅRýá@ùÓØÿñ™èa1ñ9!¼)[Ê@œ³¸˜…év)Ò]( *¥Í#µ 85ðOæÃ}E¡§'-'ÌêÞÈÑ°^I™¥y:obÿ 8åعŒŽ ¦žÜRx66GùYyIÏý\¶BS`°ÝÅTš“<É—«»ôÐlíû¢Fqºâ{tÍà „ÀöCfÓ$Ç€¦sÒšiˆÏû0±ÇŽÄàV‘oî„pÁi¶=¤wê¹h3w‡ò¸ ã”’_‚ 7¡€Kø?Æ”Jëc‘ºdXU½žü®N4z0ãþ`ôŸÛ†÷¼´ª>+n¬úq² –M¨ó $W2&Ùe«-ø›K5õ,³4¿ÎÑ]Á2ö7–âŠ\Z‡ç&aZÜP½Ôs‰áD±ë!·Næ|V Export Address Table Export Address Table %08lx @@ -164,7 +163,7 @@ ppcboot header: not mapping: env var not set obj code %d not foundprivate flags = %lxprivate flags = %lx:private flags = %lx: private flags = %x:private flags = 0x%lx:reloc against unsupported sectionreloc not properly alignedreserved CTL cmd %dreserved OPR cmd %dreserved STA cmd %dreserved STO cmd %dsom_sizeof_headers unimplementedstack-entry-mask not fully implementedstack-from-image not implementedstack-literal not fully implementedstack-local-symbol not fully implementedstack-local-symbol-entry-point-mask not fully implementedstatic procedure (no name)stub entry for %s cannot load .plt, dp offset = %ldstubs don't match calculated sizeuncertain calling convention for non-COFF symbolunknown gsd/egsd subtype %dunsupported STA cmd %sunsupported relocunsupported reloc typeusing multiple gp valuesv850 architecturev850e architecturev850ea architecturewarning: %s section has zero sizewarning: %s: local symbol `%s' has no sectionwarning: attempt to export undefined symbol `%s'warning: relocation against removed sectionwarning: relocation against removed section; zeroingwarning: type and size of dynamic symbol `%s' are not definedProject-Id-Version: bfd 2.12.91 POT-Creation-Date: 2002-07-23 15:55-0400 -PO-Revision-Date: 2002-07-29 16:34+0200 +PO-Revision-Date: 2002-07-30 21:55+0200 Last-Translator: Christian Rose Language-Team: Swedish MIME-Version: 1.0 @@ -173,7 +172,7 @@ Content-Transfer-Encoding: 8bit Exportadresstabell Exportadresstabell %08lx Namnpekartabell Ordningstalstabell [Namnpekare/Ordningstal]-tabell %08lx kodbas %08lx toc (inläsningsbar/verklig) %08lx/%08lx - omlokalisering %4d avstånd %4x [%4lx] %s vma: Tips/Ordning Medlemsnamn Bundet till + omlokalisering %4d avstånd %4x [%4lx] %s vma: Tips/Ordn Medlemsnamn Bundet till DLL-namn: %s diff -Nurpa binutils-2.13/bfd/po/sv.po binutils-2.13.1/bfd/po/sv.po --- binutils-2.13/bfd/po/sv.po 2002-07-30 14:19:42.000000000 -0400 +++ binutils-2.13.1/bfd/po/sv.po 2002-09-23 18:12:43.000000000 -0400 @@ -6,7 +6,7 @@ msgid "" msgstr "" "Project-Id-Version: bfd 2.12.91\n" "POT-Creation-Date: 2002-07-23 15:55-0400\n" -"PO-Revision-Date: 2002-07-29 16:34+0200\n" +"PO-Revision-Date: 2002-07-30 21:55+0200\n" "Last-Translator: Christian Rose \n" "Language-Team: Swedish \n" "MIME-Version: 1.0\n" @@ -2555,7 +2555,7 @@ msgstr "" #: peigen.c:1192 pepigen.c:1192 msgid "\tvma: Hint/Ord Member-Name Bound-To\n" -msgstr "\tvma: Tips/Ordning Medlemsnamn Bundet till\n" +msgstr "\tvma: Tips/Ordn Medlemsnamn Bundet till\n" #: peigen.c:1217 pepigen.c:1217 msgid "" diff -Nurpa binutils-2.13/bfd/po/tr.gmo binutils-2.13.1/bfd/po/tr.gmo --- binutils-2.13/bfd/po/tr.gmo 2002-08-06 09:31:38.000000000 -0400 +++ binutils-2.13.1/bfd/po/tr.gmo 2002-11-07 17:40:01.000000000 -0500 @@ -1,31 +1,34 @@ -Þ•´ÅL!`,a,,˜,·,Î,-á,'-$7-3\--°-Í-AÝ-&.F._.x.‘.¡. À.á.//*+/9V/6/;Ç/060:L05‡0)½0Lç0)41L^1«1Á1DØ12<2;N2<Š24Ç2)ü2)&3P3f3{3˜3¬3È3 á3 -î3 -ù344,4=4N4 ]4 g4 u4 -ƒ4 -Ž4 -™4¤4¹4$Â4#ç4% 515D5$\55Ÿ5!¹5Û5ä5 í5÷56 6 6 -6 '656 -F6Q6i6ƒ6’6©6Ä6Ó6ì667@97<z7·7'Í7*õ75 8%V8A|8¾8*Ö899[;93—9!Ë9#í9&:)8:/b:F’:>Ù:-;(F;o;7;1Å;0÷;/(<<X</•<&Å<Mì<3:=Xn=XÇ=> >T_>T´>T ?0^?:?2Ê?4ý?(2@([@[„@+à@H A/UA(…A?®A<îA?+BQkB3½B1ñB5#C'YC4C6¶CJíCD8D}D›D1»D"íD%E 6EEWE4E;ÒE?F7NF-†F*´F2ßF+G/>G3nG0¢G7ÓG H++H$WH+|H¨HÆH>ßH+IIJI;”IÐI)ðI+J5FJ@|J@½JIþJIHK9’K'ÌK@ôK5L*RL0}L,®L4ÛL/M@M%^M*„M'¯M>×MBNYN4uNlªN@O?XOG˜OFàOJ'PHrPK»PGQBOQX’Q4ëQ/ RPRNoR4¾R0óR$S(;S*dS(S6¸S2ïS2"T5UT8‹T5ÄT,úT<'U(dU-U»U ÕU/öU&V$9V=^VœV$¹V1ÞVSW<dWH¡WVêWNAXMX2ÞX5Y6GY3~Y2²Y)åY.Z*>Z(iZ7’Z)ÊZ+ôZ& [+G[s[‘[.§[Ö[,õ['"\BJ\"\&°\[×\G3]G{]GÃ]9 ^5E^-{^2©^7Ü^5_/J_oz_,ê_K`Hc`2¬`3ß`=a;QaBaAÐa:b3Mb b ‹b/•b;Åbcc*c"Gc.jc+™c#Åc;éc%d4Ad-vd$¤d Éd"Ódöd( e6eFe]ereJˆe#Óe.÷e,&f+Sf-fT­f1gF4gY{gWÕg;-h)ih!“h µh!Öhøhi8iXixi—i¶i Öi&÷i%j"Dj!gj$‰jB®jMñjT?kT”k<ék<&l7cl7›lVÓl*m?m5\m’m -§m#²mÖmïm -n n,n;n Yn/gn*—n+Ân8în'o"Foio|o$Žo6³oêopp/p@pPp `pjpsp|p -“p"žp%Áp çpóp q)q)>q/hq˜q·q:Óq%r%4rZr"sr*–rÁràrérýrs%s9s*Ts&s¦s¾s$Ñsös$t-t&Mt tt#•t(¹t9ât!u>u)Xu/‚u²u'Äu'ìu'vw*Uw€w˜w±w%Çwíwxx:xJQxJœxJçxI2y:|y;·y:óy6.zfezAÌzD{aS{eµ{F|b|F|BÈ|: }8F}7}·}×}2ì}.~N~%k~-‘~+¿~+ë~O gˆ›®$Î"ó€,4€#a€%…€«€Á€×€*ö€ !B`t‰Ÿ!³Õ ð‚3,‚/`‚0‚Á‚݂ƒ1ƒDƒ-Xƒ0†ƒ+·ƒ4ãƒ=„`V„·…Ð…è…† †$1†V†#q†8•†+Άú†‡?$‡&d‡‹‡¥‡¼‡Õ‡ä‡ˆ#$ˆHˆZˆ)kˆ8•ˆ8Έ<‰D‰0W‰1ˆ‰/º‰*ê‰:Š.PŠ:ŠºŠЊ?ãŠ#‹C‹;V‹<’‹;Ï‹- Œ-9ŒgŒ„Œ™Œ³ŒÌŒéŒ  - -%?Yhw ‰ “ ¡ -¯ -º -ÅÐà/é,Ž.FŽuŽ#ŠŽ.®Ž!ÝŽ ÿŽ0 QZ cmv ˆ ’ž¯ ÂÎá +HZy:—>Ò:‘L‘+b‘0Ž‘/¿‘-ï‘@’^’*|’8§’ià’1J“!|“'ž“.Æ“+õ“4!”EV”:œ”8×”0•A•7`•0˜•,É•+ö•;"–*^–3‰–]½–=—JY—J¤—Bï—]2˜]˜dî˜9S™C™'Ñ™,ù™2&š2Yš\Œš/éšN›@h›'©›DÑ›Eœ?\œXœœ/õœ8%8^(—AÀ>žEAžB‡ž!Êž#ìž5Ÿ%FŸ"lŸŸG­Ÿ=õŸ53 :i :¤ ,ß & ¡=3¡?q¡:±¡=ì¡7*¢;b¢&ž¢>Å¢'£.,£![£}£8£'Ö£:þ£79¤"q¤3”¤3Ȥ3ü¤:0¥:k¥E¦¥Fì¥93¦'m¦K•¦ á¦(§)+§(U§1~§9°§ê§0¨.7¨ f¨0‡¨?¸¨ø¨B©oZ©JÊ©HªV^ªVµªY «Tf«V»«L¬B_¬d¢¬<­5D­ z­Q›­Bí­60®g®*®6ª®3á®7¯=M¯=‹¯:ɯC°:H°4ƒ°I¸°2±35±i±!…±*§±Ò±(ë±A²'V²(~²9§²\á²?>³K~³ZʳY%´]´:Ý´1µ9Jµ4„µ7¹µ2ñµ0$¶%U¶+{¶3§¶6Û¶9·(L·'u·!·¿·-Õ·"¸;&¸*b¸N¸%ܸ/¹j2¹L¹Qê¹L<º9‰º5ú*ùº2$»8W»:»:Ë»p¼2w¼Nª¼Iù¼5C½=y½Y·½B¾IT¾Mž¾Gì¾?4¿ t¿ ¿0Ž¿?¿¿ÿ¿À#"À!FÀ1hÀ7šÀ"ÒÀ5õÀ +ÁCLÁ4Á'ÅÁíÁ üÁÂ(0ÂYÂnÂ…Â¥ÂgµÂ-Ã.KÃ,zÃ+§Ã.ÓÃmÄ;pÄ`¬ÄX Å^fÅGÅÅ* Æ"8Æ![Æ"}Æ  Æ ÁÆ âÆ Ç$ÇDÇ dÇ!…Ç$§Ç#ÌÇ#ðÇ"È$7È@\ÈHÈkæÈkRÉ>¾É>ýÉX<ÊX•ÊBîÊ1ËFË/^ËŽË -§Ë#²ËÖËìËÌÌ +Ì9ÌWÌ:jÌ.¥Ì,ÔÌ3Í5Í#PÍt͈Í$—Í6¼ÍóÍÎ Î)Î 8Î DÎ PÎ ZÎgÎpÎ -ŒÎ—Î0´Î åÎóÎ Ï)Ï4>Ï:sÏ®ÏÅÏ7áÏ#Ð"=Ð`Ð,|Ð5©ÐßÐüÐÑÑ3ÑJÑaÑ.wÑ,¦ÑÓÑæÑ%öÑ -Ò#'Ò!KÒmÒÒ¬Ò!ÇÒ2éÒ*ÓGÓ6gÓ.žÓÍÓáÓÔ!ÔAÔ _Ô €Ô¡Ô¿ÔAÝÔÕ0ÕJÕ0dÕ•Õ²ÕÎÕ'æÕÖ#(Ö LÖmÖMŠÖFØÖG×Fg×:®×1é×NØNjØe¹ØDÙ>dÙc£Ù`ÚMhÚ!¶ÚNØÚN'Û@vÛJ·ÛAÜ*DÜoÜ/Ü/¯ÜßÜ(ÿÜ((Ý&QÝ&xÝPŸÝ#ðÝÞ)ÞGÞ]Þ|Þ˜Þ*±ÞÜÞ$ûÞ ß?ß*^ß-‰ß ·ß&Øßÿßà*à@à%Uà!{à à¾à<Ùà-á1Dává–á"°á#Óá÷áââ+'â2Sâ †â.§â9ÖâMö?¹ûÝ ,è• -Ë+LO¦¥Fz«”؇²ÄªÉ|¼Ï<äw-Ýɳ*—fkò7¡ùBâAÎÛgP:®NoÃ܃RÍ5H/ Bþ O¾Ê¾‡í¼©‘Ð)#_çÚ§…üäSEúcbñ¿ãQ.<óK ƒaŽŽ›Wœéì 3ZX[Z±‹³½„9 Ÿ qyÀGˆ˜ž›„I¯Š ÷3µ|Yà;M~Ì7“>šÖ^…PØ iÍðC™ÅºÎ×I¦:"DS†ÿ-Çõ£/à ü€¸˜'zAËß!½Q‰6K묶·ÜuR{{CýoÁ ûVè‹jqUï,\Ó+9€êªÕ™yT^s¯þ?”—vÇ•â%j·­ÂnEÖÏfkÕwù¤> ~}$"ÒïÁ1å‚@m¢v4eë»m’1Ìrbn&Œñ;!­NƲ¨D0“ÖêÄTÙž®‚»Òк]Ÿ}`%¶ °UXšÆ¥´œhhøÞ6î8Y¹]pc–dæÑ(@`Ôò×t=u_8HaáJ‰edµ¡sF«¢ÀŒß´Èˆæôçtôð\Å£#5V±x°lîég -©G’÷ ú$Ñøá‘=x2.Þ*§W¸Ó[ý&ö L0õ)Û¬Ú(¤¨å -¿riì'4ãŠÿÙ†Èípó2ÊJlÔ  >>> Ran out of IAT members! - Export Address Table Export Address Table %08lx - Name Pointer Table Ordinal Table The Import Address Table (difference found) - The Import Address Table is identical - [Name Pointer/Ordinal] Table %08lx +Þ•!$×,"ˆ-‰-¢-Á-Ø-$ë-3.D.%d.Š.Aš.&Ü.//5/N/^/ }/ž/¾/Õ/*è/906M0;„0À06Ò0: 15D1Jz1)Å1Lï1)<2Lf2³2É2Dà2%3D34V3)‹3)µ3ß3ô34%4A4 Z4g4{44 4±4 À4 Ê4 Ø4 +æ4 +ñ4 +ü455 +%5$05#U5%y5 +Ÿ5ª5½5$Õ5ú56 26!<6^6 f6p6y6 ‚6Œ6•6ž6 §6 +±6 ¼6 Ê6Ô6 +å6ð67"717H7c7r76‹7{Â7x>8·8'Í8*õ85 93V9%Š9A°9ò9* +:95:[o:6Ë:3;!6;#X;&|;)£;.Í;0ü;/-<F]<>¤<-ã<(=:=7X=1=0Â=/ó=<#>/`>&>M·>3?T9?2Ž?0Á?:ò?2-@|`@4Ý@(A(;A[dA+ÀAHìA/5B(eB?ŽB<ÎB? CQKC3C1ÑC5D'9D4aD<–D6ÓDJ +EDUEšE¸E1ØE" +F%-F SFEtF4ºF;ïF?+G7kG-£G*ÑG8üG25H+hH/”H3ÄH0øH7)IaI+I$­I+ÒIþIJA5JHwJ>ÀJ+ÿJI+K;uK±KÑK)ìK+L.BL.qL5 L@ÖL@MIXM=¢MIàMI*N$tN9™N.ÓN/O'2O@ZO5›OÑO*îO0P)JP,tP;¡P4ÝP/QBQ%`Q*†Q'±Q>ÙQBR4wRl¬R@S?ZSGšSFâSJ)THtTK½TG UBQUX”U4íU/"VRVNqV4ÀV0õV&W(=W*fW(‘W6ºW2ñW2$X5WX8X5ÆX,üX<)Y(fY-Y½Y ×Y/øY(Z;ZNZhZ|Z0ŽZ4¿Z$ôZ=[DW[œ[$¹[1Þ[S\<d\3¡\HÕ\V]Nu]MÄ]-^2@^5s^6©^3à^2_)G_.q_* _(Ë_7ô_4,`)a`+‹`&·`&Þ`+a,1a^a+|a¨a-¾aìa, b'8bB`b"£b&Æb[íbGIcG‘cOÙcG)d9qd>«d2êd5eDSeP˜e=ée2'f7Zf5’f/Èfoøf,hgK•gHág2*h3]h=‘h;ÏhB iANi:i3Ëi ÿi/ j;9juj‰jžj »j"Åj+èj#k;8ktk.k4¿k ôk"þk!l(8lalqlˆl)žlÈlSÞl#2m.Vm,…m+²m-ÞmV n1cnO•nYånV?o;–o)ÒoZüoZWpE²pAøpP:qW‹qWãqA;rA}r7¿r7÷r$/sVTs«sÀs5Ýst +(t#3tWtpt‹t  t­t¼t Út/èt+u8Du}u"œuI¿u vv$.v6SvŠv§v½vÏvàvðv w +www +3w">w%aw ‡w“w³w)Èw/òw"x.Ax,pxx:¹x%ôx%y@y"Yy?|y¼yÛyäy*ÿy&*zQziz$|z¡z$³zØz!øz{D4{Dy{/¾{î{?|@|Q|q|7ˆ|*À|ë|}%}?}R}o}JŒ}J×}J"~Im~:·~;ò~:.6ii D +€dO€F´€û€:8U7ŽÆæ2û..‚]‚u‚%’‚¸‚Õ‚-ñ‚+ƒ+Kƒ wƒ˜ƒ«ƒ¾ƒ$Þƒ"„&„,D„ q„%’„¸„΄ä„*… .…O…m…ƒ…—…¬…Â…Ö…!í…†*†>†R†f† z†&›† †#ã†(‡90‡j‡3…‡!¹‡0Û‡ ˆ(ˆ?ˆQˆhˆˆ“ˆ¦ˆ!ºˆ-܈0 +‰+;‰4g‰=œ‰TÚ‰/‹I‹i‹…‹%–‹:¼‹.÷‹&&ŒMŒH]Œ(¦ŒÏŒêŒ +!L%n”§+º<æ@#ŽAdŽ¦Ž:¿Ž:úŽ85;n,ª?×/>G†ŸC¶!ú‘?3‘4s‘4¨‘Ý‘ò‘’)’F’ _’l’‡’¢’³’Ä’ Ö’ à’ î’ +ü’ +“ +““0“ +9“2D“/w“2§“ +Ú“å“(û“7$”$\”#” ¥”4¯”ä” ì”ö”ÿ” •••$• -• 7•C• V•`• t•€• –•·•Ç•ç•–!–=9–|w–{ô–p—1‡—5¹—4ï—7$˜/\˜CŒ˜И-ï˜>™s\™<Й5 š$Cš*hš2“š0Æš0÷š/(›<X›N•›<ä›<!œ3^œ!’œ;´œ4ðœ/%.UB„-Ç8õf.žA•žlמ@DŸ<…ŸFŸ.  Š8 5à9ù 83¡bl¡6Ï¡U¢C\¢, ¢LÍ¢M£Bh£^«£2 +¤==¤={¤*¹¤Iä¤E.¥At¥O¶¥H¦#O¦'s¦:›¦+Ö¦%§ (§NI§B˜§8Û§>¨BS¨/–¨,ƨ@ó¨C4©Ex©:¾©Gù©>Aª?€ª(ÀªDéª..«2]«"« ³«MÔ«Q"¬=t¬+²¬?Þ¬=­&\­%ƒ­7©­5á­2®2J®5}®A³®Aõ®I7¯?¯?Á¯J°%L°Dr°+·°1ã°+±PA±6’±#ɱ+í±-².G²-v²X¤²5ý²>3³r³3’³/Ƴ!ö³9´GR´š´Jº´xµM~µK̵Y¶Yr¶\̶Z)·_„·Qä·J6¸j¸?ì¸7,¹%d¹YŠ¹Gä¹9,ºfº.€º8¯º6èº;»@[»@œ»AÝ»F¼Af¼9¨¼Nâ¼81½9j½¤½$½.ç½¾0¾F¾Z¾n¾0¾5²¾,è¾F¿J\¿+§¿,Ó¿<Àc=ÀF¡ÀUèÀS>Áa’Á`ôÁeUÂE»ÂAÃ6CÃCzÃ<¾Ã<ûÃ28Ä3kÄ&ŸÄ-ÆÄ9ôÄ5.Å9dÅ<žÅ3ÛÅ.Æ,>Æ7kÆ"£Æ,ÆÆóÆ8 Ç&DÇAkÇ+­ÇXÙÇ)2È2\ÈmÈPýÈWNÉ]¦ÉPÊAUÊF—Ê=ÞÊ:ËLWËZ¤ËSÿË<SÌ>Ì>ÏÌ>ÍvMÍ5ÄÍXúÍSSÎ7§Î@ßÎ_ ÏH€ÏOÉÏUÐOoÐF¿Ð Ñ9ÑGMѕѧÑ%ºÑ àÑ!íÑ<Ò'LÒ<tÒ#±Ò9ÕÒIÓYÓ"jÓÓ/£ÓÓÓéÓ(ÔF*ÔqÔpƒÔ1ôÔ3&Õ1ZÕ0ŒÕ2½ÕtðÕ>eÖi¤Ö]×dl×PÑ×0"ØOSØO£ØDóØE8ÙQ~ÙuÐÙuFÚB¼ÚBÿÚ_BÛ_¢Û%ÜH(Üq܇Ü1 ÜÒÜ îÜ&ûÜ"Ý9ÝTÝlÝ€ÝÝ®ÝCÂÝ1Þ78ÞpÞ'ŒÞI´ÞþÞß$$ß8Iß‚ß—ß ¯ß¼ß Ìß Øß +äß ïßýßà +%à"0à4Sàˆà"˜à»à=ÐàCáRá/ká-›áÉá9èá&"â&Iâpâ1Žâ\Àâ!ã ?ãKã3aã3•ãÉãßã)ðã ä(&ä&Oä0vä"§äjÊäg5å3åÑåCéå-æ>æXæ+sæ5ŸæÕæôæ) ç7ç'Tç"|çVŸçMöçPDèL•èAâè6$éT[éT°ésêGyêqÁêW3ë%‹ëF±ëRøëHKì/”ìÄì3Öì5 +í"@í"cí+†í²íÐí.îí,î,Jî&wîžî!·îÙî!óî ï6ï.Pïï*Ÿï Êï ëï. ð.;ð#jð,Žð»ðÔðêðññ.ñ)Gñ&qñ˜ñ²ñÌñæñ"ò%#ò&Iòpò'ò;¸òôò@ó'Pó8xó!±óÓóðó& ô&3ôZôiôyô$Šô1¯ô9áô%õ7AõAyõ¾uþÕ¬Úr(e¤ÎF•å^Wä#B¯î{LQ†×ìˆGòDét9ï b +1 ?Ìjfm¢xçm3‹d®CXQ¨Â%l ›:Eп­c[M—;ÖOTpk~ÛH­Ö¾/ó,P“"zJÚ.g‰=;ÕrËõƒ Èüí +jŸ‚‹A£ðÊÔu²Š*!ƒ/LÞË´§~é©Ùœ»ßU  ÷À_è">•·’ÄS<hH%µÉª gÝÆߘ…äk¯nïv£YìŒ  ×|.A}úÅRýá@ùÓØÿñ™èa1ñ9!¼)[Ê@œ³¸˜…év)Ò]( *¥Í#µ +85ðOæÃ}E¡§'-'ÌêÞÈÑ°^I™¥y:obÿ +8åعŒŽ ¦žÜRx66GùYyIÏý\¶BS`°ÝÅTš“<É—«»ôÐlíû¢Fqºâ{tÍà „ÀöCfÓ$Ç€¦sÒšiˆÏû0±ÇŽÄàV‘oî„pÁi¶=¤wê¹h3w‡ò¸ ã”’_‚ 7¡€Kø?Æ”Jëc‘ºdXU½žü®N4z0ãþ`ôŸÛ†÷¼´ª>+n¬úq² –M¨ó $W2&Ùe«-ø›K5õ,³4¿ÎÑ]Á2ö7–âŠ\Z‡ç&aZÜP½Ôs‰áD±ë!·Næ|V Export Address Table Export Address Table %08lx + Name Pointer Table Ordinal Table [Name Pointer/Ordinal] Table %08lx code-base %08lx toc (loadable/actual) %08lx/%08lx - reloc %4d offset %4x [%4lx] %s vma: Hint/Ord Member-Name + reloc %4d offset %4x [%4lx] %s vma: Hint/Ord Member-Name Bound-To DLL Name: %s @@ -61,6 +64,8 @@ The Function Table (interpreted .pdata s The Import Tables (interpreted %s section contents) +There is a first thunk, but the section containing it could not be found + There is an export table in %s at 0x%lx There is an export table, but the section containing it could not be found @@ -78,25 +83,27 @@ Virtual Address: %08lx Chunk size %ld (0 [Ordinal/Name Pointer] Table ppcboot header: - Address Address Handler Data Address Mask - Table Stamp Chain Name Thunk - consider relinking with --support-old-code enabled first occurrence: %s: arm call to thumb first occurrence: %s: thumb call to arm previously %s in %s required from %s: - Glue code sequence Register restore millicode Register save millicode [32bitmode] [APCS-26] [APCS-32] [FPA float format] [VFP float format] [Version1 EABI] [Version2 EABI] [abi unknown] [abi=64] [abi=EABI32] [abi=EABI64] [abi=N32] [abi=O32] [abi=O64] [absolute position] [cpu32] [dynamic symbols use segment index] [floats passed in float registers] [floats passed in integer registers] [has entry point] [interworking enabled] [interworking flag not initialised] [interworking not supported] [interworking supported] [mapping symbols precede others] [mips1] [mips2] [mips32] [mips3] [mips4] [mips5] [mips64] [new ABI] [no abi set] [not 32bitmode] [old ABI] [position independent] [relocatable executable] [software FP] [sorted symbol table] [symbols have a _ prefix] [unknown ISA] [unsorted symbol table] at %s line %d in %s - vma: Begin Address End Address Unwind Info + consider relinking with --support-old-code enabled first occurrence: %s: arm call to thumb first occurrence: %s: thumb call to arm required from %s: + Glue code sequence Register restore millicode Register save millicode [32bitmode] [FPA float format] [VFP float format] [Version1 EABI] [Version2 EABI] [abi unknown] [abi=64] [abi=EABI32] [abi=EABI64] [abi=N32] [abi=O32] [abi=O64] [absolute position] [cpu32] [d-float] [dynamic symbols use segment index] [floats passed in float registers] [floats passed in integer registers] [g-float] [has entry point] [interworking enabled] [interworking flag not initialised] [interworking not supported] [interworking supported] [m68000] [mapping symbols precede others] [mdmx] [mips16] [mips1] [mips2] [mips32] [mips3] [mips4] [mips5] [mips64] [new ABI] [no abi set] [nonpic] [not 32bitmode] [old ABI] [position independent] [relocatable executable] [software FP] [sorted symbol table] [symbols have a _ prefix] [unknown ISA] [unsorted symbol table] vma: Begin Address End Address Unwind Info vma: Begin End EH EH PrologEnd Exception + Address Address Handler Data Address Mask vma: Hint Time Forward DLL First -#%s (%s): Section flag %s (0x%x) ignored%s(%s): warning: interworking not enabled.%s(%s+0x%lx): %s relocation against SEC_MERGE section%s(%s+0x%lx): cannot handle %s for %s%s(%s+0x%lx): cannot reach %s, recompile with -ffunction-sections%s(%s+0x%lx): fixing %s%s(%s+0x%lx): reloc against `%s': error %d%s(%s+0x%lx): unresolvable relocation against symbol `%s'%s, section %s: - relocation %s should not be used in a shared object; recompile with -fPIC%s: %s+0x%lx: jump to stub routine which is not jal%s: %s: invalid needed version %d%s: %s: invalid version %u (max %d)%s: %s: reloc overflow: 0x%lx > 0xffff%s: .got subsegment exceeds 64K (size %d)%s: 0x%lx: fatal: reloc overflow while relaxing%s: 0x%lx: fatal: unaligned branch target for relax-support relocation%s: 0x%lx: warning: R_SH_USES points to unrecognized insn 0x%x%s: 0x%lx: warning: bad R_SH_USES load offset%s: 0x%lx: warning: bad R_SH_USES offset%s: 0x%lx: warning: bad count%s: 0x%lx: warning: could not find expected COUNT reloc%s: 0x%lx: warning: could not find expected reloc%s: 0x%lx: warning: symbol in unexpected section%s: @gprel relocation against dynamic symbol %s%s: ABI mismatch: linking %s module with previous %s modules%s: Architecture mismatch with previous modules%s: Bad relocation record imported: %d%s: Bad symbol definition: `Main' set to %s rather than the start address %s -%s: CALL16 reloc at 0x%lx not against global symbol%s: ERROR: compiled as absolute position code, whereas target %s is position independent%s: ERROR: compiled as position independent code, whereas target %s is absolute position%s: ERROR: compiled for APCS-%d whereas target %s uses APCS-%d%s: ERROR: passes floats in float registers whereas target %s uses integer registers%s: ERROR: passes floats in integer registers whereas target %s uses float registers%s: Error: multiple definition of `%s'; start of %s is set in a earlier linked file -%s: ISA mismatch (%d) with previous modules (%d)%s: ISA mismatch (-mips%d) with previous modules (-mips%d)%s: Instruction set mismatch with previous modules%s: Internal inconsistency; no relocation section %s%s: Invalid relocation type exported: %d%s: Invalid relocation type imported: %d%s: LOCAL directive: Register $%ld is not a local register. First global register is $%ld.%s: Malformed reloc detected for section %s%s: No PLT nor GOT for relocation %s against symbol `%s' from %s section%s: No core to allocate a symbol %d bytes long + Table Stamp Chain Name Thunk +#%s (%s): Section flag %s (0x%x) ignored%s(%s): warning: interworking not enabled.%s(%s+0x%lx): %s relocation against SEC_MERGE section%s(%s+0x%lx): Stabs entry has invalid string index.%s(%s+0x%lx): cannot handle %s for %s%s(%s+0x%lx): cannot reach %s, recompile with -ffunction-sections%s(%s+0x%lx): fixing %s%s(%s+0x%lx): reloc against `%s': error %d%s(%s+0x%lx): unresolvable relocation against symbol `%s'%s, section %s: + relocation %s should not be used in a shared object; recompile with -fPIC%s: !samegp reloc against symbol without .prologue: %s%s: %s+0x%lx: jump to stub routine which is not jal%s: %s: invalid needed version %d%s: %s: invalid version %u (max %d)%s: %s: reloc overflow: 0x%lx > 0xffff%s: .got subsegment exceeds 64K (size %d)%s: .opd is not a regular array of opd entries%s: .preinit_array section is not allowed in DSO%s: 0x%lx: fatal: reloc overflow while relaxing%s: 0x%lx: fatal: unaligned branch target for relax-support relocation%s: 0x%lx: warning: R_SH_USES points to unrecognized insn 0x%x%s: 0x%lx: warning: bad R_SH_USES load offset%s: 0x%lx: warning: bad R_SH_USES offset%s: 0x%lx: warning: bad count%s: 0x%lx: warning: could not find expected COUNT reloc%s: 0x%lx: warning: could not find expected reloc%s: 0x%lx: warning: symbol in unexpected section%s: @gprel relocation against dynamic symbol %s%s: ABI mismatch: linking %s module with previous %s modules%s: Architecture mismatch with previous modules%s: Bad relocation record imported: %d%s: Bad symbol definition: `Main' set to %s rather than the start address %s +%s: CALL16 reloc at 0x%lx not against global symbol%s: Error: multiple definition of `%s'; start of %s is set in a earlier linked file +%s: GAS error: unexpected PTB insn with R_SH_PT_16%s: ISA mismatch (%d) with previous modules (%d)%s: ISA mismatch (-mips%d) with previous modules (-mips%d)%s: Instruction set mismatch with previous modules%s: Internal inconsistency error for value for + linker-allocated global register: linked: 0x%lx%08lx != relaxed: 0x%lx%08lx +%s: Internal inconsistency; no relocation section %s%s: Invalid relocation type exported: %d%s: Invalid relocation type imported: %d%s: LOCAL directive: Register $%ld is not a local register. First global register is $%ld.%s: Malformed reloc detected for section %s%s: No PLT nor GOT for relocation %s against symbol `%s' from %s section%s: No core to allocate a symbol %d bytes long %s: No core to allocate section name %s %s: Not enough room for program headers (allocated %u, need %u)%s: Not enough room for program headers, try linking with -N%s: Only registers %%g[2367] can be declared using STT_REGISTER%s: Recognised but unhandled machine type (0x%x) in Import Library Format archive%s: Relocation %s (%d) is not currently supported. -%s: Relocation %s is not supported for symbol %s.%s: Relocation %s is not yet supported for symbol %s.%s: Relocations in generic ELF (EM: %d)%s: Section %s is too large to add hole of %ld bytes%s: TOC reloc at 0x%x to symbol `%s' with no TOC entry%s: The target (%s) of a %s relocation is in the wrong output section (%s)%s: The target (%s) of an %s relocation is in the wrong section (%s)%s: Unhandled import type; %x%s: Unknown relocation type %d +%s: Relocation %s is not supported for symbol %s.%s: Relocation %s is not yet supported for symbol %s.%s: Relocations in generic ELF (EM: %d)%s: Section %s is too large to add hole of %ld bytes%s: TLS local exec code cannot be linked into shared objects%s: TOC reloc at 0x%x to symbol `%s' with no TOC entry%s: The target (%s) of a %s relocation is in the wrong output section (%s)%s: The target (%s) of an %s relocation is in the wrong section (%s)%s: Unhandled import type; %x%s: Unknown relocation type %d %s: Unknown section type in a.out.adobe file: %x -%s: Unknown special linker type %d%s: Unrecognised import name type; %x%s: Unrecognised import type; %x%s: Unrecognised machine type (0x%x) in Import Library Format archive%s: Unrecognized storage class %d for %s symbol `%s'%s: Warning: Arm BLX instruction targets Arm function '%s'.%s: Warning: Thumb BLX instruction targets thumb function '%s'.%s: XCOFF shared object when not producing XCOFF output%s: XMC_TC0 symbol `%s' is class %d scnlen %d%s: __gp does not cover short data segment%s: `%s' has line numbers but no enclosing section%s: `%s' in loader reloc but not loader sym%s: `ld -r' not supported with PE MIPS objects -%s: access beyond end of merged section (%ld + %ld)%s: address 0x%s out of range for Intex Hex file%s: bad XTY_ER symbol `%s': class %d scnum %d scnlen %d%s: bad pair/reflo after refhi -%s: bad reloc address 0x%lx in section `%s'%s: bad relocation section name `%s'%s: bad section length in ihex_read_section%s: bad string table size %lu%s: bad symbol index: %d%s: can not represent section `%s' in a.out object file format%s: can not represent section `%s' in oasys%s: can not represent section for symbol `%s' in a.out object file format%s: cannot allocate file name for file number %d, %d bytes -%s: cannot create stub entry %s%s: check_relocs: unhandled reloc type %d%s: class %d symbol `%s' has no aux entries%s: compiled for a 64 bit system and target is 32 bit%s: compiled for a big endian system and target is little endian%s: compiled for a little endian system and target is big endian%s: compiled normally and linked with modules compiled with -mrelocatable%s: compiled with -mrelocatable and linked with modules compiled normally%s: could not find output section %s for input section %s%s: csect `%s' not in enclosing section%s: directive LOCAL valid only with a register or absolute value%s: duplicate export stub %s%s: dynamic object with no .loader section%s: dynamic relocation against speculation fixup%s: error: relocation %s not a multiple of 4%s: gp-relative relocation against dynamic symbol %s%s: illegal relocation type %d at address 0x%lx%s: illegal section name `%s'%s: illegal symbol index in reloc: %d%s: indirect symbol `%s' to `%s' is a loop%s: internal error in ihex_read_section%s: internal error, internal register section %s had contents +%s: Unknown special linker type %d%s: Unrecognised import name type; %x%s: Unrecognised import type; %x%s: Unrecognised machine type (0x%x) in Import Library Format archive%s: Unrecognized storage class %d for %s symbol `%s'%s: Warning: Arm BLX instruction targets Arm function '%s'.%s: Warning: Thumb BLX instruction targets thumb function '%s'.%s: XCOFF shared object when not producing XCOFF output%s: XMC_TC0 symbol `%s' is class %d scnlen %d%s: __gp does not cover short data segment%s: `%s' accessed both as normal and thread local symbol%s: `%s' has line numbers but no enclosing section%s: `%s' in loader reloc but not loader sym%s: `ld -r' not supported with PE MIPS objects +%s: access beyond end of merged section (%ld + %ld)%s: address 0x%s out of range for Intel Hex file%s: bad XTY_ER symbol `%s': class %d scnum %d scnlen %d%s: bad pair/reflo after refhi +%s: bad reloc address 0x%lx in section `%s'%s: bad relocation section name `%s'%s: bad section length in ihex_read_section%s: bad string table size %lu%s: bad symbol index: %d%s: base-plus-offset relocation against register symbol: %s in %s%s: base-plus-offset relocation against register symbol: (unknown) in %s%s: can not represent section `%s' in a.out object file format%s: can not represent section `%s' in oasys%s: can not represent section for symbol `%s' in a.out object file format%s: cannot allocate file name for file number %d, %d bytes +%s: cannot create stub entry %s%s: change in gp: BRSGP %s%s: check_relocs: unhandled reloc type %d%s: class %d symbol `%s' has no aux entries%s: compiled as 32-bit object and %s is 64-bit%s: compiled as 64-bit object and %s is 32-bit%s: compiled for a 64 bit system and target is 32 bit%s: compiled for a big endian system and target is little endian%s: compiled for a little endian system and target is big endian%s: compiled normally and linked with modules compiled with -mrelocatable%s: compiled with %s and linked with modules compiled with %s%s: compiled with %s and linked with modules that use non-pic relocations%s: compiled with -mrelocatable and linked with modules compiled normally%s: could not find output section %s%s: could not find output section %s for input section %s%s: could not write out added .cranges entries%s: could not write out sorted .cranges entries%s: csect `%s' not in enclosing section%s: directive LOCAL valid only with a register or absolute value%s: dtp-relative relocation against dynamic symbol %s%s: duplicate export stub %s%s: dynamic object with no .loader section%s: dynamic relocation against speculation fixup%s: encountered datalabel symbol in input%s: error: relocation %s not a multiple of 4%s: error: unaligned relocation type %d at %08x reloc %08x +%s: gp-relative relocation against dynamic symbol %s%s: illegal relocation type %d at address 0x%lx%s: illegal section name `%s'%s: illegal symbol index in reloc: %d%s: indirect symbol `%s' to `%s' is a loop%s: internal error in ihex_read_section%s: internal error, internal register section %s had contents %s: internal error, symbol table changed size from %d to %d words %s: invalid SHT_GROUP entry%s: invalid link %lu for reloc section %s (index %u)%s: invalid mmo file: YZ of lop_end (%ld) not equal to the number of tetras to the preceding lop_stab (%ld) %s: invalid mmo file: expected YZ = 1 got YZ = %d for lop_quote @@ -115,208 +122,214 @@ ppcboot header: %s: invalid string offset %u >= %lu for section `%s'%s: invalid symbol table: duplicate symbol `%s' %s: jump too far away %s: line number overflow: 0x%lx > 0xffff%s: linking 64-bit files with 32-bit files%s: linking PIC files with non-PIC files%s: linking UltraSPARC specific with HAL specific code%s: linking abicalls files with non-abicalls files%s: linking auto-pic files with non-auto-pic files%s: linking big-endian files with little-endian files%s: linking constant-gp files with non-constant-gp files%s: linking little endian files with big endian files%s: linking non-pic code in a shared library%s: linking trap-on-NULL-dereference with non-trapping files%s: loader reloc in read-only section %s%s: loader reloc in unrecognized section `%s'%s: misplaced XTY_LD `%s'%s: no group info for section %s%s: no initialized registers; section length 0 -%s: no such symbol%s: probably compiled without -fPIC?%s: register relocation against non-register symbol: %s in %s%s: reloc %s:%d not in csect%s: reloc overflow 1: 0x%lx > 0xffff%s: relocateable link from %s to %s not supported%s: relocation %s can not be used when making a shared object; recompile with -fPIC%s: relocation %s cannot be used when making a shared object%s: relocation %s is not allowed for global symbol: `%s' from %s section%s: relocation %s should not be used when making a shared object; recompile with -fPIC%s: relocation %s with non-zero addend %d against local symbol from %s section%s: relocation %s with non-zero addend %d against symbol `%s' from %s section%s: relocs in section `%s', but it has no contents%s: short data segment overflowed (0x%lx >= 0x400000)%s: size field is zero in Import Library Format header%s: speculation fixup against undefined weak symbol%s: string not null terminated in ILF object file.%s: string too long (%d chars, max 65535)%s: symbol `%s' has unrecognized csect type %d%s: symbol `%s' has unrecognized smclas %d%s: symbol `%s' required but not present%s: too many initialized registers; section length %ld -%s: unable to find ARM glue '%s' for `%s'%s: unable to find THUMB glue '%s' for `%s'%s: undefined versioned symbol name %s%s: unexpected ATN type %d in external part%s: unexpected type after ATN%s: unimplemented %s -%s: unimplemented ATI record %u for symbol %u%s: unknown relocation type %d%s: unknown relocation type %d for symbol %s%s: unrecognized symbol `%s' flags 0x%x%s: unresolvable relocation %s against symbol `%s' from %s section%s: unsupported relocation type %s%s: unsupported relocation type 0x%02x%s: unsupported wide character sequence 0x%02X 0x%02X after symbol name starting with `%s' -%s: uses _-prefixed symbols, but writing file with non-prefixed symbols%s: uses different e_flags (0x%lx) fields than previous modules (0x%lx)%s: uses non-prefixed symbols, but writing file with _-prefixed symbols%s: version count (%ld) does not match symbol count (%ld)%s: warning: %s: line number overflow: 0x%lx > 0xffff%s: warning: Empty loadable segment detected -%s: warning: allocated section `%s' not in segment%s: warning: duplicate line number information for `%s'%s: warning: illegal symbol index %ld in line numbers%s: warning: illegal symbol index %ld in relocs%s: warning: symbol table too large for mmo, larger than 65535 32-bit words: %d. Only `Main' will be emitted. +%s: no such symbol%s: no symbol "%s"%s: not fully implemented%s: not implemented%s: not supported%s: object size does not match that of target %s%s: pc-relative relocation against dynamic symbol %s%s: probably compiled without -fPIC?%s: register relocation against non-register symbol: %s in %s%s: register relocation against non-register symbol: (unknown) in %s%s: reloc %s:%d not in csect%s: reloc overflow 1: 0x%lx > 0xffff%s: relocateable link from %s to %s not supported%s: relocation %s can not be used when making a shared object; recompile with -fPIC%s: relocation %s cannot be used when making a shared object%s: relocation %s in section %s with no GOT created%s: relocation %s is not allowed for global symbol: `%s' from %s section%s: relocation %s should not be used when making a shared object; recompile with -fPIC%s: relocation %s with non-zero addend %d against local symbol from %s section%s: relocation %s with non-zero addend %d against symbol `%s' from %s section%s: relocation size mismatch in %s section %s%s: relocs in section `%s', but it has no contents%s: short data segment overflowed (0x%lx >= 0x400000)%s: size field is zero in Import Library Format header%s: speculation fixup against undefined weak symbol%s: string not null terminated in ILF object file.%s: string too long (%d chars, max 65535)%s: symbol `%s' has unrecognized csect type %d%s: symbol `%s' has unrecognized smclas %d%s: symbol `%s' required but not present%s: too many initialized registers; section length %ld +%s: tp-relative relocation against dynamic symbol %s%s: unable to find ARM glue '%s' for `%s'%s: unable to find THUMB glue '%s' for `%s'%s: undefined sym `%s' in .opd section%s: undefined versioned symbol name %s%s: unexpected ATN type %d in external part%s: unexpected reloc type %u in .opd section%s: unexpected type after ATN%s: unhandled dynamic relocation against %s%s: unimplemented %s +%s: unimplemented ATI record %u for symbol %u%s: unknown relocation type %d%s: unknown relocation type %d for symbol %s%s: unrecognized symbol `%s' flags 0x%x%s: unresolvable relocation %s against symbol `%s' from %s section%s: unsupported relocation type %s%s: unsupported relocation type 0x%02x%s: unsupported wide character sequence 0x%02X 0x%02X after symbol name starting with `%s' +%s: uses _-prefixed symbols, but writing file with non-prefixed symbols%s: uses different e_flags (0x%lx) fields than previous modules (0x%lx)%s: uses different unknown e_flags (0x%lx) fields than previous modules (0x%lx)%s: uses non-prefixed symbols, but writing file with _-prefixed symbols%s: version count (%ld) does not match symbol count (%ld)%s: warning: %s relocation against symbol `%s' from %s section%s: warning: %s relocation to 0x%x from %s section%s: warning: %s: line number overflow: 0x%lx > 0xffff%s: warning: Empty loadable segment detected, is this intentional ? +%s: warning: GOT addend of %ld to `%s' does not match previous GOT addend of %ld%s: warning: PLT addend of %d to `%s' from %s section ignored%s: warning: allocated section `%s' not in segment%s: warning: duplicate line number information for `%s'%s: warning: illegal symbol index %ld in line numbers%s: warning: illegal symbol index %ld in relocs%s: warning: symbol table too large for mmo, larger than 65535 32-bit words: %d. Only `Main' will be emitted. %s: warning: unexpected redefinition of `%s'%s: warning: unresolvable relocation %d against symbol `%s' from %s section%s: warning: unresolvable relocation against symbol `%s' from %s section%s:%d: Unexpected character `%s' in S-record file %s:%d: unexpected character `%s' in Intel Hex file %s:%u: bad checksum in Intel Hex file (expected %u, found %u)%s:%u: bad extended address record length in Intel Hex file%s:%u: bad extended linear address record length in Intel Hex file%s:%u: bad extended linear start address length in Intel Hex file%s:%u: bad extended start address length in Intel Hex file%s:%u: unrecognized ihex type %u in Intel Hex file -(unknown)*unknown*.got section not immediately after .plt section32bits gp relative relocation occurs for an external symbol: m32r instructions: m32rx instructions@pltoff reloc against local symbolAUX tagndx %ld ttlsiz 0x%lx lnnos %ld next %ldArchive has no index; run ranlib to add oneArchive object file in wrong formatAttempt to do relocateable link with %s input and %s outputBFD %s assertion fail %s:%dBFD %s internal error, aborting at %s line %d in %s -BFD %sinternal error, aborting at %s line %d -Bad section index in ETIR_S_C_STA_PQBad valueBase Relocation Directory [.reloc]Bound Import DirectoryCould not find relocation section for %sDebug DirectoryDelay Import DirectoryDeprecated %s calledDescription DirectoryDwarf Error: Abbrev offset (%u) greater than or equal to abbrev size (%u).Dwarf Error: Bad abbrev number: %d.Dwarf Error: Can't find .debug_abbrev section.Dwarf Error: Can't find .debug_line section.Dwarf Error: Can't find .debug_str section.Dwarf Error: Could not find abbrev number %d.Dwarf Error: DW_FORM_strp offset (%u) greater than or equal to .debug_str size (%u).Dwarf Error: Invalid or unhandled FORM value: %d.Dwarf Error: Line offset (%u) greater than or equal to line size (%u).Dwarf Error: found address size '%u', this reader can not handle sizes greater than '%u'.Dwarf Error: found dwarf version '%hu', this reader only handles version 2 information.Dwarf Error: mangled line number section (bad file number).Dwarf Error: mangled line number section.ETIR_S_C_OPR_DFLIT: Not supportedETIR_S_C_OPR_INSV: Not supportedETIR_S_C_OPR_REDEF: Not supportedETIR_S_C_OPR_ROT: Not supportedETIR_S_C_OPR_USH: Not supportedETIR_S_C_STC_GBL: not supportedETIR_S_C_STC_GCA: not supportedETIR_S_C_STC_LP: not supportedETIR_S_C_STC_PS: not supportedETIR_S_C_STO_CA: no symbol "%s"ETIR_S_C_STO_GBL: no symbol "%s"ETIR_S_C_STO_HINT_GBL: not implementedETIR_S_C_STO_HINT_PS: not implementedETIR_S_C_STO_LP_PSB: Not supportedETIR_S_C_STO_RB/AB: Not supportedEntry offset = 0x%.8lx (%ld) -Error: %s compiled for APCS-%d, whereas %s is compiled for APCS-%dError: %s compiled for EABI version %d, whereas %s is compiled for version %dError: %s passes floats in FP registers, whereas %s passes them in integer registersError: %s passes floats in integer registers, whereas %s passes them in FP registersError: %s uses FPA instructions, whereas %s VFP instructionsError: %s uses VFP instructions, whereas %s FPA instructionsError: %s uses hardware FP, whereas %s uses software FPError: %s uses software FP, whereas %s uses hardware FPError: First section in segment (%s) starts at 0x%x whereas the segment starts at 0x%xError: out of memoryException Directory [.pdata]Export Directory [.edata (or where ever we found it)]Export Flags %lx +*unknown*.got section not immediately after .plt section32bits gp relative relocation occurs for an external symbol: m32r instructions: m32rx instructions@pltoff reloc against local symbolArchive has no index; run ranlib to add oneArchive object file in wrong formatAttempt to do relocateable link with %s input and %s outputBFD %s assertion fail %s:%dBFD %s internal error, aborting at %s line %d +BFD %s internal error, aborting at %s line %d in %s +Bad valueBase Relocation Directory [.reloc]Bound Import DirectoryCould not find relocation section for %sDebug DirectoryDelay Import DirectoryDeprecated %s called +Deprecated %s called at %s line %d in %s +Description DirectoryDwarf Error: Abbrev offset (%lu) greater than or equal to .debug_abbrev size (%lu).Dwarf Error: Bad abbrev number: %u.Dwarf Error: Can't find .debug_abbrev section.Dwarf Error: Can't find .debug_line section.Dwarf Error: Can't find .debug_str section.Dwarf Error: Could not find abbrev number %u.Dwarf Error: DW_FORM_strp offset (%lu) greater than or equal to .debug_str size (%lu).Dwarf Error: Invalid or unhandled FORM value: %u.Dwarf Error: Line offset (%lu) greater than or equal to .debug_line size (%lu).Dwarf Error: found address size '%u', this reader can not handle sizes greater than '%u'.Dwarf Error: found dwarf version '%u', this reader only handles version 2 information.Dwarf Error: mangled line number section (bad file number).Dwarf Error: mangled line number section.ERROR: %s is compiled as absolute position code, whereas target %s is position independentERROR: %s is compiled as position independent code, whereas target %s is absolute positionERROR: %s is compiled for APCS-%d, whereas %s is compiled for APCS-%dERROR: %s is compiled for APCS-%d, whereas target %s uses APCS-%dERROR: %s is compiled for EABI version %d, whereas %s is compiled for version %dERROR: %s passes floats in float registers, whereas %s passes them in integer registersERROR: %s passes floats in integer registers, whereas %s passes them in float registersERROR: %s uses FPA instructions, whereas %s uses VFP instructionsERROR: %s uses VFP instructions, whereas %s uses FPA instructionsERROR: %s uses hardware FP, whereas %s uses software FPERROR: %s uses software FP, whereas %s uses hardware FPEntry offset = 0x%.8lx (%ld) +Error: First section in segment (%s) starts at 0x%x whereas the segment starts at 0x%xError: out of memoryException Directory [.pdata]Export Directory [.edata (or where ever we found it)]Export Flags %lx Export RVAFAILED to find previous HI16 reloc File format is ambiguousFile format not recognizedFile in wrong formatFile too bigFile truncatedFlag field = 0x%.2x -Forwarder RVAGP relative relocation used when GP not definedGP relative relocation when GP not definedGP relative relocation when _gp not definedGPDISP relocation did not find ldah and lda instructionsImport Address Table DirectoryImport Directory [parts of .idata]Invalid bfd targetInvalid operationLength = 0x%.8lx (%ld) +Forwarder RVAGP relative relocation used when GP not definedGP relative relocation when _gp not definedGPDISP relocation did not find ldah and lda instructionsImport Address Table DirectoryImport Directory [parts of .idata]Internal inconsistency: remaining %u != max %u. + Please report this bug.Invalid bfd targetInvalid operationLength = 0x%.8lx (%ld) Linking mips16 objects into %s format is not supportedLoad Configuration DirectoryMajor/Minor %d/%d Malformed archiveMemory exhaustedMissing IHCONSTMissing IHIHALFName No Mem !No errorNo more archived filesNo symbolsNonrepresentable section on outputNot enough memory to sort relocationsNumber in: -Obj code %d not foundObject module NOT error-free ! +Object module NOT error-free ! Ordinal Base %ld Output file requires shared library `%s' Output file requires shared library `%s.so.%s' -PASSMECH not fully implementedPartition name = "%s" +PASSMECH not fully implementedPTA mismatch: a SHcompact address (bit 0 == 0)PTB mismatch: a SHmedia address (bit 0 == 1)Partition name = "%s" Partition[%d] end = { 0x%.2x, 0x%.2x, 0x%.2x, 0x%.2x } Partition[%d] length = 0x%.8lx (%ld) Partition[%d] sector = 0x%.8lx (%ld) Please report this bug. -Reading archive file mod timestampRegister %%g%d used incompatibly: %s in %sRegister section has contents -ReservedReserved CTL cmd %dReserved OPR cmd %dReserved STA cmd %dReserved STO cmd %dResource Directory [.rsrc]SDA relocation when _SDA_BASE_ not definedSEC_RELOC with no relocs in section %sSection has no contentsSecurity DirectorySize mismatch section %s=%lx, %s=%lxSpecial DirectoryStack overflow (%d) in _bfd_vms_pushStack underflow in _bfd_vms_popStack-entry-mask not fully implementedStack-from-image not implementedStack-literal not fully implementedStack-local-symbol not fully implementedStack-local-symbol-entry-point-mask not fully implementedSymbol %s not defined for fixups +Reading archive file mod timestampRegister %%g%d used incompatibly: %s in %s, previously %s in %sRegister section has contents +ReservedResource Directory [.rsrc]SDA relocation when _SDA_BASE_ not definedSEC_RELOC with no relocs in section %sSection has no contentsSecurity DirectorySize mismatch section %s=%lx, %s=%lxSpecial DirectoryStack overflow (%d) in _bfd_vms_pushStack underflow in _bfd_vms_popSymbol %s not defined for fixups Symbol %s replaced by %s -Symbol `%s' has differing types: %s in %sSymbol needs debug section which does not existSystem call errorTIR_S_C_CTL_DFLOC not fully implementedTIR_S_C_CTL_STKDL not fully implementedTIR_S_C_CTL_STLOC not fully implementedTIR_S_C_OPR_ASH incompleteTIR_S_C_OPR_DFLIT not supportedTIR_S_C_OPR_REDEF not supportedTIR_S_C_OPR_ROT incompleteTIR_S_C_OPR_USH incompleteTOC overflow: 0x%lx > 0x10000; try -mminimal-toc when compilingTable Addresses +Symbol `%s' has differing types: %s in %s, previously REGISTER in %sSymbol `%s' has differing types: REGISTER in %s, previously %s in %sSymbol needs debug section which does not existSystem call errorTOC overflow: 0x%lx > 0x10000; try -mminimal-toc when compilingTable Addresses Thread Storage Directory [.tls]Time/Date stamp %lx -Unhandled OSF/1 core file section type %d -Unhandled relocation %sUnimplemented STO cmd %dUnknown basic type %dUnrecognized TI COFF target id '0x%x'Unrecognized relocUnrecognized reloc type 0x%xUnsupported .stab relocationUnsupported STA cmd %dVariable `%s' can only be in one of the small, zero, and tiny data regionsVariable `%s' cannot be in both small and tiny data regions simultaneouslyVariable `%s' cannot be in both small and zero data regions simultaneouslyVariable `%s' cannot be in both zero and tiny data regions simultaneouslyVariable `%s' cannot occupy in multiple small data regionsWarning, .pdata section size (%ld) is not a multiple of %d -Warning: %s does not support interworking, whereas %s doesWarning: %s supports interworking, whereas %s does notWarning: Clearing the interwork flag in %s because non-interworking code in %s has been linked with itWarning: Clearing the interwork flag of %s due to outside requestWarning: Clearing the interworking flag of %s due to outside requestWarning: Not setting interwork flag of %s since it has already been specified as non-interworkingWarning: Not setting interworking flag of %s, since it has already been specified as non-interworkingWarning: Writing section `%s' to huge (ie negative) file offset 0x%lx.Warning: fixup count mismatch -Warning: input file %s does not support interworking, whereas %s does.Warning: input file %s supports interworking, whereas %s does not.Warning: size of symbol `%s' changed from %lu to %lu in %sWarning: type of symbol `%s' changed from %d to %d in %sWarning: writing archive was slow: rewriting timestamp -Writing updated armap timestamp[whose name is lost]_bfd_vms_output_counted called with too many bytes_bfd_vms_output_counted called with zero bytesbfd_make_section (%s) failedbfd_set_section_flags (%s, %x) failedcould not locate special linker symbol __ctbpcould not locate special linker symbol __epcould not locate special linker symbol __gpelf_symbol_from_bfd_symbol 0x%.8lx, name = %s, sym num = %d, flags = 0x%.8lx%s -error: undefined symbol __rtinitfailed to enter %signoring reloc %s -internal error: dangerous errorinternal error: dangerous relocationinternal error: out of range errorinternal error: unknown errorinternal error: unsupported relocation errorlinkage table overflow against `%s'local symbols in discarded section %smissing IHCONST relocmissing IHIHALF relocnon-zero addend in @fptr relocnot enough GOT space for local GOT entriesnot mapping: data=%lx mapped=%d +Unexpected STO_SH5_ISA32 on local symbol is not handledUnhandled OSF/1 core file section type %d +Unhandled relocation %sUnknown basic type %dUnrecognized TI COFF target id '0x%x'Unrecognized relocUnrecognized reloc type 0x%xUnsupported .stab relocationVariable `%s' can only be in one of the small, zero, and tiny data regionsVariable `%s' cannot be in both small and tiny data regions simultaneouslyVariable `%s' cannot be in both small and zero data regions simultaneouslyVariable `%s' cannot be in both zero and tiny data regions simultaneouslyVariable `%s' cannot occupy in multiple small data regionsWarning, .pdata section size (%ld) is not a multiple of %d +Warning: %s does not support interworking, whereas %s doesWarning: %s supports interworking, whereas %s does notWarning: Clearing the interworking flag of %s because non-interworking code in %s has been linked with itWarning: Clearing the interworking flag of %s due to outside requestWarning: Not setting interworking flag of %s since it has already been specified as non-interworkingWarning: Writing section `%s' to huge (ie negative) file offset 0x%lx.Warning: fixup count mismatch +Warning: size of symbol `%s' changed from %lu to %lu in %sWarning: type of symbol `%s' changed from %d to %d in %sWarning: writing archive was slow: rewriting timestamp +Writing updated armap timestamp[whose name is lost]_bfd_vms_output_counted called with too many bytes_bfd_vms_output_counted called with zero bytesbad section index in %sbfd_make_section (%s) failedbfd_set_section_flags (%s, %x) failedcan't build branch stub `%s'can't find branch stub `%s'could not locate special linker symbol __ctbpcould not locate special linker symbol __epcould not locate special linker symbol __gperror: undefined symbol __rtinitfailed to enter %signoring reloc %s +internal error: dangerous errorinternal error: dangerous relocationinternal error: out of range errorinternal error: unknown errorinternal error: unsupported relocation errorlinkage table error against `%s'local symbols in discarded section %smissing IHCONST relocmissing IHIHALF relocnon-zero addend in @fptr relocnot enough GOT space for local GOT entriesnot mapping: data=%lx mapped=%d not mapping: env var not set -private flags = %lxprivate flags = %lx:private flags = %lx: private flags = %x:reloc against unsupported sectionreloc not properly alignedsom_sizeof_headers unimplementedstatic procedure (no name)stub entry for %s cannot load .plt, dp offset = %ldstub section size doesn't match calculated sizeuncertain calling convention for non-COFF symbolunknown gsd/egsd subtype %dunsupported relocunsupported reloc typeusing multiple gp valuesv850 architecturev850e architecturev850ea architecturewarning: %s: local symbol `%s' has no sectionwarning: attempt to export undefined symbol `%s'warning: relocation against removed sectionwarning: relocation against removed section; zeroingwarning: type and size of dynamic symbol `%s' are not definedProject-Id-Version: bfd 2.12-pre020121 -POT-Creation-Date: 2002-01-17 12:55+0000 -PO-Revision-Date: 2002-01-24 13:11EET +obj code %d not foundprivate flags = %lxprivate flags = %lx:private flags = %lx: private flags = %x:private flags = 0x%lx:reloc against unsupported sectionreloc not properly alignedreserved CTL cmd %dreserved OPR cmd %dreserved STA cmd %dreserved STO cmd %dsom_sizeof_headers unimplementedstack-entry-mask not fully implementedstack-from-image not implementedstack-literal not fully implementedstack-local-symbol not fully implementedstack-local-symbol-entry-point-mask not fully implementedstatic procedure (no name)stub entry for %s cannot load .plt, dp offset = %ldstubs don't match calculated sizeuncertain calling convention for non-COFF symbolunknown gsd/egsd subtype %dunsupported STA cmd %sunsupported relocunsupported reloc typeusing multiple gp valuesv850 architecturev850e architecturev850ea architecturewarning: %s section has zero sizewarning: %s: local symbol `%s' has no sectionwarning: attempt to export undefined symbol `%s'warning: relocation against removed sectionwarning: relocation against removed section; zeroingwarning: type and size of dynamic symbol `%s' are not definedProject-Id-Version: bfd 2.12.91 +POT-Creation-Date: 2002-07-23 15:55-0400 +PO-Revision-Date: 2002-08-10 13:11EET Last-Translator: Deniz Akkus Kanca Language-Team: Turkish MIME-Version: 1.0 -Content-Type: text/plain; charset=ISO-8859-9 +Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Generator: KBabel 0.9.5 - >>> IAT üyeleri bitti! - Ýhraç Adres Tablosu Ýhraç Adres Tablosu %08lx - Ýsim Gösterge Tablosu Onluk Tablo Ýthal Adres Tablosu (fark bulundu) - Ýthal Adres Tablosu ayný - [Ýsim Gösterge/Onluk] Tablo %08lx - kod temeli %08lx toc (yüklenebilir/gerçek) %08lx/%08lx - yer deðiþim %4d göreli konum %4x [%4lx] %s vma: Ýpucu/Sýra Üye-Adý + Ä°hraç Adres Tablosu Ä°hraç Adres Tablosu %08lx + Ä°sim Gösterge Tablosu Onluk Tablo [Ä°sim Gösterge/Onluk] Tablo %08lx + kod temeli %08lx toc (yüklenebilir/gerçek) %08lx/%08lx + yer deÄŸiÅŸim %4d göreli konum %4x [%4lx] %s vma: Ä°pucu/Sıra Ãœye-Adı Sınır - DLL Adý: %s + DLL Adı: %s -PE Dosya Temel Yerdeðiþimi (.reloc bölüm içeriði çözümlendi) +PE Dosya Temel YerdeÄŸiÅŸimi (.reloc bölüm içeriÄŸi çözümlendi) - Son+1 sembolü: %-7ld Tür: %s - Son+1 sembolü: %ld - Ýlk sembol: %ld + Son+1 sembolü: %-7ld Tür: %s + Son+1 sembolü: %ld + Ä°lk sembol: %ld Yerel sembol: %ld - Tür: %s - enum; Son+1 sembolü: %ld - yapý; Son+1 sembolü: %ld - birleþim; Son+1 sembolü: %ld -Özellikler 0x%x + Tür: %s + enum; Son+1 sembolü: %ld + yapı; Son+1 sembolü: %ld + birleÅŸim; Son+1 sembolü: %ld +Özellikler 0x%x -Dinamik Bölüm: +Dinamik Bölüm: -Ýhraç Adres Tablosu -- Onluk Sistem %ld +Ä°hraç Adres Tablosu -- Onluk Sistem %ld -Baþlangýç adresinde iþlev betimleyicisi bulundu: %04lx +BaÅŸlangıç adresinde iÅŸlev betimleyicisi bulundu: %04lx -Reldata bölümü yok! Ýþlev betimleyicisi çözümlenemedi. +Reldata bölümü yok! Ä°ÅŸlev betimleyicisi çözümlenemedi. -Bölüm[%d] baþlangýcý = { 0x%.2x, 0x%.2x, 0x%.2x, 0x%.2x } +Bölüm[%d] baÅŸlangıcı = { 0x%.2x, 0x%.2x, 0x%.2x, 0x%.2x } -Yazýlým Baþlýðý: +Yazılım BaÅŸlığı: -Ýhraç Tablolarý (%s bölüm içeriði çözümlendi) +Ä°hraç Tabloları (%s bölüm içeriÄŸi çözümlendi) -Ýþlev Tablosu (.pdata bölüm içeriði çözümlendi) +Ä°ÅŸlev Tablosu (.pdata bölüm içeriÄŸi çözümlendi) -Ýthal Tablolarý (%s bölüm içeriði çözümlendi) +Ä°thal Tabloları (%s bölüm içeriÄŸi çözümlendi) -%s içinde 0x%lx'de bir ihraç tablosu var +Bir ilk parça var, fakat onu içeren bölüm bulunamadı -Bir ihraç tablosu var, fakat onu içeren bölüm bulunamadý +%s içinde 0x%lx'de bir ihraç tablosu var -%s içerisinde 0x%lx'de bir ithal tablosu var - -Bir ithal tablosu var, fakat onu içeren bölüm bulunamadý - -Sürüm Referanslarý: - -Sürüm tanýmlarý: - -Sanal Adres: %08lx Parça boyu %ld (0x%lx) Düzeltme Sayýsý %ld - -[Onluk/Ýsim Gösterge] Tablosu - -ppcboot baþlýðý: - Adres Adres Yön. Veri Adres Mask - Tablo Damga Zincir Ýsim Parça - --support-old-code seçeneði ile yeniden baðlamayý deneyin ilk ortaya çýkýþ: %s: thumb'a arm'dan çaðrý ilk ortaya çýkýþ: %s: arm'a thumb'dan çaðrý daha önce %2$s içinde %1$s %s'den isteniyor: - Birleþtirici kod dizisi Geri alma milikodunu kaydet Yazma milikodunu kaydet [32bitkipi] [APCS-26] [APCS-32] [FPA kayan nokta biçemi] [VFP kayan nokta biçemi] [Sürüm1 EABI] [Sürüm2 EABI] [abi bilinmiyor] [abi=64] [abi=EABI32] [abi=EABI64] [abi=N32] [abi=O32] [abi=O64] [yere baðýmlý] [cpu32] [dinamik semboller bölüm indeksini kullanýyor] [kayan sayýlar kayan yazmaçlarda geçirildi] [kayan sayýlar tamsayý yazmaçlarda geçirildi] [girdi noktasý var] [beraber çalýþma etkinleþtirilmiþ] [beraber çalýþma bayraðýna öndeðer atanmamýþ] [beraber çalýþma desteklenmiyor] [beraber çalýþma destekleniyor] [eþleþme sembolleri diðerlerinden önceliklidir] [mips1] [mips2] [mips32] [mips3] [mips4] [mips5] [mips64] [yeni ABI] [abi atanmamýþ] [32bitkipi deðil] [eski ABI] [yerden baðýmsýz] [yer deðiþtirebilir uygulama] [yazýlým FP] [sýralanmýþ sembol tablosu] [semboller _ önekine sahip] [bilinmeyen ISA] [sýralanmamýþ sembol tablosu]%s, %d satýrý, %s içerisinde - vma: Baþlangýç Adresi Sonlanma Adresi Geri Al Bilgisi - vma: Baþl. Son EH EH PrologSon Ýstisna - vma: Ýpucu Zaman Ýleri DLL Ýlk -#%s (%s): Bölüm bayraðý %s (0x%x) yoksayýldý%s(%s): uyarý: beraber çalýþma kipi etkin deðil.%s(%s+0x%lx): SEC_MERGE bölümüne %s yerdeðiþimi%1$s(%2$s+0x%3$lx): %5$s için %4$s iþlenemedi%s(%s+0x%lx): %s'e ulaþýlamadý, -ffunction-sections ile derleyin%s(%s+0x%lx): %s düzeltiliyor%s(%s+0x%lx): %s'e yer deðiþimi: %d hatasý%s(%s+0x%lx): `%s' sembolüne çözümlenemeyen yer deðiþimi%s, %s bölümü: - %s yer deðiþimi paylaþýmlý nesne oluþtururken kullanýlamaz; - -fPIC ile yeniden derleyin%s: %s+0x%lx: jal olmayan koçan yordamýna sýçrama%s: %s: geçersiz gerekli sürüm %d%s: %s: geçersiz sürüm %u (maksimum %d)%s: %s: yer deðiþtirme taþmasý: 0x%lx > 0xffff%s: .got alt parçasý 64K'yý aþýyor (boy %d)%s: 0x%lx: ölümcül: gevþetilirken yerdeðiþim taþmasý%s: 0x%lx: ölümcül: gevþetme destek yerdeðiþimi için hizalanmamýþ dal%s: 0x%lx: uyarý: R_SH_USES bilinmeyen insn 0x%x'ý imliyor%s: 0x%lx: uyarý: hatalý R_SH_USES yükleme göreli konumu%s: 0x%lx: uyarý: hatalý R_SH_USES göreli konumu%s: 0x%lx: uyarý: hatalý sayým%s: 0x%lx: uyarý: beklenen COUNT yerdeðiþimi bulunamadý%s: 0x%lx: uyarý: beklenen yerdeðiþim bulunamadý%s: 0x%lx: uyarý: beklenmeyen bölümde sembol%s: %s dinamik sembolüne @gprel yerdeðiþimi%s: ABI uyumsuzluðu: %s modülü önceki %s modülle baðlanýyor%s: Önceki modüllerle platform uyumsuzluðu%s: Geçersiz yer deðiþtirme kaydý ithal edilmiþ: %d%1$s: Hatalý sembol tanýmý: `Main' baþlangýç adresi %3$s yerine - %2$s olarak tanýmlanmýþ -%s: 0x%lx'deki CALL16 yerdeðiþimi evrensel sembole göre deðil%s: HATA: yere baðýmlý kod olarak derlendi, fakat hedef %s yerden baðýmsýz%s: HATA: yerden baðýmsýz kod olarak derlendi, fakat hedef %s yere baðýmlý%s: HATA: APCS-%d için derlenmiþ fakat hedef %s APCS-%d kullanýyor%s: HATA: kayan sayýlarý kayan yazmaçlarda geçiriyor fakat hedef %s tamsayý yazmaç kullanýyor%s: HATA: kayan sayýlarý tamsayý yazmaçlarda geçiriyor fakat hedef %s kayan yazmaç kullanýyor%s: Hata: `%s' birden fazla defa tanýmlanmýþ; %s'nin baþlangýcý daha önce - baðlanan bir dosyada. -%1$s: Önceki modüllerle (%3$d) ile ISA uyumsuzluðu (%2$d)%1$s: Önceki modüllerle (-mips%3$d) ile ISA uyumsuzluðu (-mips%2$d)%s: Önceki modüllerle iþlem uyuþmazlýðý%s: Ýç tutarsýzlýk; %s yerdeðiþim bölümü yok%s: Geçersiz yer deðiþtirme türü ihraç edilmiþ: %d%s: Geçersiz yer deðiþtirme türü ithal edilmiþ: %d%s: YEREL (LOCAL) yönergesi: $%ld yazmacý yerel yazmaç deðil. - Ýlk evrensel yazmaç: $%ld.%s: %s bölümü için geçersiz yer deðiþim bulundu%1$s: %4$s bölümünden `%3$s' sembolüne %2$s yer deðiþimi için PLT veya GOT yok%s: %d bayt uzunluðunda bir sembole yer ayýrmak için `core' yok -%s: %s bölüm adýný ayýracak `core' yok -%s: Yazýlým baþlýklarý için yeterli yer yok (%u ayrýldý, %u gerekli)%s: yazýlým baþlýklarý için gerekli yer yok, -N ile baðlamayý deneyin%s: Yalnýz %%g[2367] yazmaçlarý STT_REGISTER ile bildirilebilir%s: Ýthal Kitaplýk Biçem (ILF) arþivinde bilinen fakat desteklenmeyen makina türü (0x%x)%s: %s (%d) yer deðiþimi henüz desteklenmiyor. -%s: %s yerdeðiþimi %s sembolü için henüz desteklenmiyor.%s: %s yerdeðiþimi %s sembolü için henüz desteklenmiyor.%s: Normal ELF'de yerdeðiþimler (EM: %d)%s: %s bölümü içine %ld baytlýk bir delik koymak için fazla büyük%s: 0x%x'da TOC girdisi olmayan `%s' sembolüne TOC yerdeðiþimi%1$s: %3$s yerdeðiþiminin hedefi (%2$s) yanlýþ çýktý bölümünde (%4$s)%1$s: Bir %3$s yer deðiþiminin hedefi (%2$s) yanlýþ bölümde (%4$s)%s: Desteklenmeyen ithal türü; %x%s: Bilinmeyen yer deðiþim türü %d -%s: a.out.adobe dosyasýnda bilinmeyen bölüm türü: %x -%s: Bilinmeyen özel baðlayýcý türü %d%s: Tanýnmayan ithal isim türü; %x%s: Tanýnmayan ithal türü; %x%s: Ýthal Kitaplýk Biçem (ILF) arþivinde tanýnmayan makina türü (0x%x) %1$s: %3$s sembolü `%4$s' için bilinmeyen saklama sýnýfý %2$d%s: Uyarý: Arm BLX iþlemi Arm iþlevi '%s' hedefliyor.%s: Uyarý: Thumb BLX iþlemi thumb iþlevi '%s'ý hedefliyor.%s: XCOFF çýktýsý oluþturulmazken XCOFF paylaþýmlý nesnesi%s: XMC_TC0 sembolü `%s': sýnýf %d scnlen %d%s: __gp kýsa veri bölümünü kapsamýyor%s: `%s' satýr numaralarýna sahip fakat onu içeren bölümü yok%s: `%s' yükleyici yerdeðiþiminde fakat yükleyici sembolü deðil%s: `ld -r' PE MIPS nesneleri ile birlikte desteklenmiyor -%s: karýþtýrýlmýþ bölümün sonundan ileride eriþim (%ld + %ld)%s: Intex Onaltýlýk dosyasý için 0x%s adresi kapsamdýþý%s: hatalý XTY_ER sembolü `%s': sýnýf %d scnum %d scnlen %d%s: refhi'den sonra hatalý çift/reflo -%1$s: `%3$s' bölümünde geçersiz yer deðiþtirme adresi 0x%2$lx%s: geçersiz yerdeðiþim bölümü adý `%s'%s: ihex_read_section'da hatalý bölüm uzunluðu%s: geçersiz dizge tablo boyu %lu%s: geçersiz sembol indeksi: %d%s: `%s' bölümü a.out nesne dosya biçeminde gösterilemez%s: oasys'de `%s' bölümü gösterilemiyor%s: `%s' sembol bölümü a.out nesne dosyasýnda gösterilemez%s: %d sayýlý dosya için dosya adý ayrýlamadý, %d bayt -%s: koçan giriþi %s oluþturulamadý%s: check_relocs: desteklenmeyen yerdeðiþim türü %d%s: sýnýf %d sembol `%s'un alternatif girdileri yok%s: 64 bitlik sistem için derlenmiþ ve hedef 32 bit%s: büyük sonlu sistem için derlenmiþ ve hedef küçük sonlu%s: küçük sonlu sistem için derlenmiþ ve hedef büyük sonlu%s: normal derlendi ve -mrelocatable ile derlenmiþ modüllere baðlandý%s: -mrelocatable ile derlendi ve normal derlenmiþ modüllerle baðlandý%1$s: girdi bölümü %3$s için çýktý bölümü %2$s bulunamadý%s: csect `%s' onu içeren bölümde deðil%s: YEREL (LOCAL) yönergesi yalnýz bir yazmaç veya kesin deðerle geçerlidir%s: birden fazla ihraç koçaný %s%s: .loader bölümü olmayan dinamik nesne%s: kuþkulu düzeltmeye dinamik yerdeðiþim%s: hata: %s yerdeðiþimi 4'ün katý deðil%s: %s dinamik sembolüne gp göreceli yer deðiþimi%1$s: 0x%3$lx adresinde geçersiz yer deðiþtirme türü %2$d%s: geçersiz bölüm adý `%s'%s: yer deðiþtirmede geçersiz sembol indeksi: %d%1$s: `%3$s'den endirekt sembol `%2$s'e çevrim%s: ihex_read_section'da iç hata%s: iç hata, %s iç yazmaç bölümü içerik taþýyor -%s: iç hata, sembol tablosu büyüklüðü %d'den %d word'e deðiþti -%s: geçersiz SHT_GROUP girdisi%1$s: yerdeðiþim bölümü %3$s (indeks %4$u) için geçersiz bað %2$lu%s: geçersiz mmo dosyasý: lop_end'in YZ'si (%ld); bir önceki - lop_stab'in (%ld) dörtlü sayýsýna eþit deðil -%s: geçersiz mmo dosyasý: YZ = 1 beklendi, lop_quote için YZ = %d bulundu -%s: geçersiz mmo dosyasý: y = 0 beklendi; lop_fixrx için y = %d bulundu -%s: geçersiz mmo dosyasý: z = 1 veya z = 2 beklendi; lop_fixo için z = %d bulundu -%s: geçersiz mmo dosyasý: z = 1 veya z = 2 beklendi, - lop_loc için z = %d bulundu -%s: geçersiz mmo dosyasý: z = 16 veya z = 24 beklendi; - lop_fixrx için z = %d bulundu -%s: geçersiz mmo dosyasý: lop_stab'in y ve z alanlarý sýfýr deðil; +Bir ihraç tablosu var, fakat onu içeren bölüm bulunamadı + +%s içerisinde 0x%lx'de bir ithal tablosu var + +Bir ithal tablosu var, fakat onu içeren bölüm bulunamadı + +Sürüm Referansları: + +Sürüm tanımları: + +Sanal Adres: %08lx Parça boyu %ld (0x%lx) Düzeltme Sayısı %ld + +[Onluk/Ä°sim Gösterge] Tablosu + +ppcboot baÅŸlığı: + --support-old-code seçeneÄŸi ile yeniden baÄŸlamayı deneyin ilk ortaya çıkış: %s: thumb'a arm'dan çaÄŸrı ilk ortaya çıkış: %s: arm'a thumb'dan çaÄŸrı %s'den isteniyor: + BirleÅŸtirici kod dizisi Geri alma milikodunu kaydet Yazma milikodunu kaydet [32bitkipi] [FPA kayan nokta biçemi] [VFP kayan nokta biçemi] [Sürüm1 EABI] [Sürüm2 EABI] [abi bilinmiyor] [abi=64] [abi=EABI32] [abi=EABI64] [abi=N32] [abi=O32] [abi=O64] [yere bağımlı] [cpu32] [d-float] [dinamik semboller bölüm indeksini kullanıyor] [kayan sayılar kayan yazmaçlarda geçirildi] [kayan sayılar tamsayı yazmaçlarda geçirildi] [g-float] [girdi noktası var] [beraber çalışma etkinleÅŸtirilmiÅŸ] [beraber çalışma bayrağına öndeÄŸer atanmamış] [beraber çalışma desteklenmiyor] [beraber çalışma destekleniyor] [m68000] [eÅŸleÅŸme sembolleri diÄŸerlerinden önceliklidir] [mdmx] [mips16] [mips1] [mips2] [mips32] [mips3] [mips4] [mips5] [mips64] [yeni ABI] [abi atanmamış] [nonpic] [32bitkipi deÄŸil] [eski ABI] [yerden bağımsız] [yer deÄŸiÅŸtirebilir uygulama] [yazılım FP] [sıralanmış sembol tablosu] [semboller _ önekine sahip] [bilinmeyen ISA] [sıralanmamış sembol tablosu] vma: BaÅŸlangıç Adresi Sonlanma Adresi Geri Al Bilgisi + vma: BaÅŸl. Son EH EH PrologSon Ä°stisna + Adres Adres Yakalay Veri Adres Maske + vma: Ä°pucu Zaman Ä°leri DLL Ä°lk + Tablo Damga Zincir Ä°sim Parça +#%s (%s): Bölüm bayrağı %s (0x%x) yoksayıldı%s(%s): uyarı: beraber çalışma kipi etkin deÄŸil.%s(%s+0x%lx): SEC_MERGE bölümüne %s yerdeÄŸiÅŸimi%s(%s+0x%lx): Stabs girdisinde geçersiz dizge indeksi.%1$s(%2$s+0x%3$lx): %5$s için %4$s iÅŸlenemedi%s(%s+0x%lx): %s'e ulaşılamadı, -ffunction-sections ile derleyin%s(%s+0x%lx): %s düzeltiliyor%s(%s+0x%lx): %s'e yer deÄŸiÅŸimi: %d hatası%s(%s+0x%lx): `%s' sembolüne çözümlenemeyen yer deÄŸiÅŸimi%s, %s bölümü: + %s yer deÄŸiÅŸimi paylaşımlı nesne oluÅŸtururken kullanılamaz; + -fPIC ile yeniden derleyin%s: .prologue olmaksızın sembole !samegp yerdeÄŸiÅŸimi: %s%s: %s+0x%lx: jal olmayan koçan yordamına sıçrama%s: %s: geçersiz gerekli sürüm %d%s: %s: geçersiz sürüm %u (maksimum %d)%s: %s: yer deÄŸiÅŸtirme taÅŸması: 0x%lx > 0xffff%s: .got alt parçası 64K'yı aşıyor (boy %d)%s: opd, opd girdilerinin düzenli dizisi deÄŸil%s: DSO içinde preinit_array'e izin verilmiyor%s: 0x%lx: ölümcül: gevÅŸetilirken yerdeÄŸiÅŸim taÅŸması%s: 0x%lx: ölümcül: gevÅŸetme destek yerdeÄŸiÅŸimi için hizalanmamış dal%s: 0x%lx: uyarı: R_SH_USES bilinmeyen insn 0x%x'ı imliyor%s: 0x%lx: uyarı: hatalı R_SH_USES yükleme göreli konumu%s: 0x%lx: uyarı: hatalı R_SH_USES göreli konumu%s: 0x%lx: uyarı: hatalı sayım%s: 0x%lx: uyarı: beklenen COUNT yerdeÄŸiÅŸimi bulunamadı%s: 0x%lx: uyarı: beklenen yerdeÄŸiÅŸim bulunamadı%s: 0x%lx: uyarı: beklenmeyen bölümde sembol%s: %s dinamik sembolüne @gprel yerdeÄŸiÅŸimi%s: ABI uyumsuzluÄŸu: %s modülü önceki %s modülle baÄŸlanıyor%s: Önceki modüllerle platform uyumsuzluÄŸu%s: Geçersiz yer deÄŸiÅŸtirme kaydı ithal edilmiÅŸ: %d%1$s: Hatalı sembol tanımı: `Main' baÅŸlangıç adresi %3$s yerine + %2$s olarak tanımlanmış +%s: 0x%lx'deki CALL16 yerdeÄŸiÅŸimi evrensel sembole göre deÄŸil%s: Hata: `%s' birden fazla defa tanımlanmış; %s'nin baÅŸlangıcı daha önce + baÄŸlanan bir dosyada. +%s: GAS hatası: R_SH_PT_16 içeren PTB yönergesi beklenmiyordu%1$s: Önceki modüllerle (%3$d) ile ISA uyumsuzluÄŸu (%2$d)%1$s: Önceki modüllerle (-mips%3$d) ile ISA uyumsuzluÄŸu (-mips%2$d)%s: Önceki modüllerle iÅŸlem uyuÅŸmazlığı%s: baÄŸlayıcı tarafından ayrılmış global yazmaç deÄŸeri için iç tutarsızlık hatası: + 0x%lx%08lx != gevÅŸetilmiÅŸ: 0x%lx%08lx +%s: İç tutarsızlık; %s yerdeÄŸiÅŸim bölümü yok%s: Geçersiz yer deÄŸiÅŸtirme türü ihraç edilmiÅŸ: %d%s: Geçersiz yer deÄŸiÅŸtirme türü ithal edilmiÅŸ: %d%s: YEREL (LOCAL) yönergesi: $%ld yazmacı yerel yazmaç deÄŸil. + Ä°lk evrensel yazmaç: $%ld.%s: %s bölümü için geçersiz yer deÄŸiÅŸim bulundu%1$s: %4$s bölümünden `%3$s' sembolüne %2$s yer deÄŸiÅŸimi için PLT veya GOT yok%s: %d bayt uzunluÄŸunda bir sembole yer ayırmak için `core' yok +%s: %s bölüm adını ayıracak `core' yok +%s: Yazılım baÅŸlıkları için yeterli yer yok (%u ayrıldı, %u gerekli)%s: yazılım baÅŸlıkları için gerekli yer yok, -N ile baÄŸlamayı deneyin%s: Yalnız %%g[2367] yazmaçları STT_REGISTER ile bildirilebilir%s: Ä°thal Kitaplık Biçem (ILF) arÅŸivinde bilinen fakat desteklenmeyen makina türü (0x%x)%s: %s (%d) yer deÄŸiÅŸimi henüz desteklenmiyor. +%s: %s yerdeÄŸiÅŸimi %s sembolü için henüz desteklenmiyor.%s: %s yerdeÄŸiÅŸimi %s sembolü için henüz desteklenmiyor.%s: Normal ELF'de yerdeÄŸiÅŸimler (EM: %d)%s: %s bölümü içine %ld baytlık bir delik koymak için fazla büyük%s: TLS yerel çalıştırma kodu paylaşımlı nesnelere baÄŸlanamaz%s: 0x%x'da TOC girdisi olmayan `%s' sembolüne TOC yerdeÄŸiÅŸimi%1$s: %3$s yerdeÄŸiÅŸiminin hedefi (%2$s) yanlış çıktı bölümünde (%4$s)%1$s: Bir %3$s yer deÄŸiÅŸiminin hedefi (%2$s) yanlış bölümde (%4$s)%s: Desteklenmeyen ithal türü; %x%s: Bilinmeyen yer deÄŸiÅŸim türü %d +%s: a.out.adobe dosyasında bilinmeyen bölüm türü: %x +%s: Bilinmeyen özel baÄŸlayıcı türü %d%s: Tanınmayan ithal isim türü; %x%s: Tanınmayan ithal türü; %x%s: Ä°thal Kitaplık Biçem (ILF) arÅŸivinde tanınmayan makina türü (0x%x) %1$s: %3$s sembolü `%4$s' için bilinmeyen saklama sınıfı %2$d%s: Uyarı: Arm BLX iÅŸlemi Arm iÅŸlevi '%s' hedefliyor.%s: Uyarı: Thumb BLX iÅŸlemi thumb iÅŸlevi '%s'ı hedefliyor.%s: XCOFF çıktısı oluÅŸturulmazken XCOFF paylaşımlı nesnesi%s: XMC_TC0 sembolü `%s': sınıf %d scnlen %d%s: __gp kısa veri bölümünü kapsamıyor%s: `%s'a hem normal, hem de dal yerel sembolü olarak eriÅŸildi%s: `%s' satır numaralarına sahip fakat onu içeren bölümü yok%s: `%s' yükleyici yerdeÄŸiÅŸiminde fakat yükleyici sembolü deÄŸil%s: `ld -r' PE MIPS nesneleri ile birlikte desteklenmiyor +%s: karıştırılmış bölümün sonundan ileride eriÅŸim (%ld + %ld)%s: Intex Onaltılık dosyası için 0x%s adresi kapsamdışı%s: hatalı XTY_ER sembolü `%s': sınıf %d scnum %d scnlen %d%s: refhi'den sonra hatalı çift/reflo +%1$s: `%3$s' bölümünde geçersiz yer deÄŸiÅŸtirme adresi 0x%2$lx%s: geçersiz yerdeÄŸiÅŸim bölümü adı `%s'%s: ihex_read_section'da hatalı bölüm uzunluÄŸu%s: geçersiz dizge tablo boyu %lu%s: geçersiz sembol indeksi: %d%1$s: yazmaç sembolüne temel artı görece yerdeÄŸiÅŸimi: %3$s içinde %2$s%s: yazmaç sembolüne temel artı görece yerdeÄŸiÅŸimi: %s içinde (bilinmeyen)%s: `%s' bölümü a.out nesne dosya biçeminde gösterilemez%s: oasys'de `%s' bölümü gösterilemiyor%s: `%s' sembol bölümü a.out nesne dosyasında gösterilemez%s: %d sayılı dosya için dosya adı ayrılamadı, %d bayt +%s: koçan giriÅŸi %s oluÅŸturulamadı%s: gp içinde deÄŸiÅŸiklik: BRSGP %s%s: check_relocs: desteklenmeyen yerdeÄŸiÅŸim türü %d%s: sınıf %d sembol `%s'un alternatif girdileri yok%s: 32 bitlik sistem için derlenmiÅŸ ve %s 64 bit%s: 64 bitlik sistem için derlenmiÅŸ ve %s 32 bit%s: 64 bitlik sistem için derlenmiÅŸ ve hedef 32 bit%s: büyük sonlu sistem için derlenmiÅŸ ve hedef küçük sonlu%s: küçük sonlu sistem için derlenmiÅŸ ve hedef büyük sonlu%s: normal derlendi ve -mrelocatable ile derlenmiÅŸ modüllere baÄŸlandı%s: %s ile derlendi ve %s ile derlenmiÅŸ modüllerle baÄŸlandı%s: %s ile derlendi ve normal derlenmiÅŸ modüllerle baÄŸlandı%s: -mrelocatable ile derlendi ve normal derlenmiÅŸ modüllerle baÄŸlandı%s: çıktı bölümü %s bulunamadı%1$s: girdi bölümü %3$s için çıktı bölümü %2$s bulunamadı%s: eklenen .cranges girdileri yazılamadı%s: sıralanmış .cranges girdileri yazılamadı%s: csect `%s' onu içeren bölümde deÄŸil%s: YEREL (LOCAL) yönergesi yalnız bir yazmaç veya kesin deÄŸerle geçerlidir%s: %s dinamik sembolüne dtp göreceli yer deÄŸiÅŸimi%s: birden fazla ihraç koçanı %s%s: .loader bölümü olmayan dinamik nesne%s: kuÅŸkulu düzeltmeye dinamik yerdeÄŸiÅŸim%s: girdide veri etiketi sembolüne rastlandı%s: hata: %s yerdeÄŸiÅŸimi 4'ün katı deÄŸil%1$s: %3$08x ve %4$08x yerdeÄŸiÅŸtirmesinde hizalanmamış yer deÄŸiÅŸtirme türü %2$d +%s: %s dinamik sembolüne gp göreceli yer deÄŸiÅŸimi%1$s: 0x%3$lx adresinde geçersiz yer deÄŸiÅŸtirme türü %2$d%s: geçersiz bölüm adı `%s'%s: yer deÄŸiÅŸtirmede geçersiz sembol indeksi: %d%1$s: `%3$s'den endirekt sembol `%2$s'e çevrim%s: ihex_read_section'da iç hata%s: iç hata, %s iç yazmaç bölümü içerik taşıyor +%s: iç hata, sembol tablosu büyüklüğü %d'den %d word'e deÄŸiÅŸti +%s: geçersiz SHT_GROUP girdisi%1$s: yerdeÄŸiÅŸim bölümü %3$s (indeks %4$u) için geçersiz baÄŸ %2$lu%s: geçersiz mmo dosyası: lop_end'in YZ'si (%ld); bir önceki + lop_stab'in (%ld) dörtlü sayısına eÅŸit deÄŸil +%s: geçersiz mmo dosyası: YZ = 1 beklendi, lop_quote için YZ = %d bulundu +%s: geçersiz mmo dosyası: y = 0 beklendi; lop_fixrx için y = %d bulundu +%s: geçersiz mmo dosyası: z = 1 veya z = 2 beklendi; lop_fixo için z = %d bulundu +%s: geçersiz mmo dosyası: z = 1 veya z = 2 beklendi, + lop_loc için z = %d bulundu +%s: geçersiz mmo dosyası: z = 16 veya z = 24 beklendi; + lop_fixrx için z = %d bulundu +%s: geçersiz mmo dosyası: lop_stab'in y ve z alanları sıfır deÄŸil; y: %d, z: %d -%s: geçersiz mmo dosyasý: %d sayýsý için dosya adý kullanýmdan - önce belirtilmemiþ -%s: geçersiz mmo dosyasý: %d sayýlý dosya, `%s', zaten `%s' olarak girilmiþ -%s: geçersiz mmo dosyasý: $255 için baþlangýç deðeri `Main' deðil -%s: geçersiz mmo dosyasý: iþlenen word'un ilk baytý 0 veya 1 olmalý; - lop_fixrx için %d bulundu -%s: geçersiz mmo dosyasý: lop_end dosyadaki son girdi deðil -%s: geçersiz mmo dosyasý: desteklenmeyen lopkod `%d' -%s: geçersiz yer deðiþim türü %d%s: %ld uzunluðunda ilklenmiþ yazmaçlar için hatalý baþlangýç adresi: 0x%lx%08lx -%1$s: `%4$s' bölümünde geçersiz dizge göreli konumu %2$u >= %3$lu%s: geçersiz sembol tablosu: tekrarlanmýþ sembol `%s' -%s: sýçrama fazla uzak -%s: satýr numarasý taþmasý: 0x%lx > 0xffff%s: 64 bitlik dosyalar 32 bitlik dosyalarla baðlanýyor%s: PIC dosyalarý PIC olmayan dosyalarla baðlanýyor%s: UltraSPARC'a özel kod HAL'e özel kod ile baðlanýyor%s: abicalls dosyalarý abicalls olmayan dosyalarla baðlanýyor%s: auto-pic dosyalarý auto-pic olmayan dosyalarla baðlanýyor%s: büyük sonlu dosyalar küçük sonlu dosyalarla baðlanýyor%s: constant-gp dosyalarý constant-gp olmayan dosyalarla baðlanýyor%s: küçük sonlu dosyalar büyük sonlu dosyalarla baðlanýyor%s: pic olmayan kod paylaþmalý kitaplýkta baðlanýyor%s: NULL-halinde-tuzakla karþý-baþvurusu tuzaklamayan dosyalarla baðlandý%s: %s salt-okunur bölümünde yükleyici yerdeðiþimi%s: bilinmeyen `%s' bölümünde yükleyici yerdeðiþimi%s: XTY_LD `%s'yanlýþ yerde%s: %s bölümünde grup bilgisi yok%s: ilklenen yazmaç yok; bölüm uzunluðu 0 -%s: böyle bir sembol yok%s: acaba -fPIC olmaksýzýn mý derlenmiþ?%1$s: yazmaç olmayan sembole yazmaç yerdeðiþimi: %3$s içinde %2$s%s: yerdeðiþim %s:%d csect içinde deðil%s: yerdeðiþim taþmasý 1: 0x%lx > 0xffff%s: %s'dan %s'ya yeri deðiþtirilebilen bað desteklenmiyor%s: %s yer deðiþimi paylaþýmlý nesne oluþturulurken kullanýlamaz; -fPIC ile yeniden derleyin%s: %s yerdeðiþimi paylaþýmlý nesne oluþturulurken kullanýlamaz%1$s: %4$s bölümünden %3$s evrensel sembolü için %2$s yerdeðiþimi yapýlamaz%s: %s yer deðiþimi paylaþýmlý nesne oluþtururken kullanýlamaz; -fPIC ile yeniden derleyin%1$s: %4$s bölümünden yerel sembol sýfýr olmayan %3$d eklemesi ile - %2$s yerdeðiþimi%1$s: %5$s bölümünden `%4$s' sembolüne sýfýr olmayan %3$d eklemesi ile %2$s yerdeðiþimi%s: `%s' bölümünde yer deðiþtirmeler mevcut, fakat içi boþ%s: kýsa veri bölümünde taþma (0x%lx >= 0x400000)%s: Ýthal Kitaplýk Biçem (ILF) baþlýðýnda boy alaný sýfýr%s: tanýmlanmamýþ gevþek sembole tartýþmalý düzeltme%s: ILF nesne dosyasýnda dizge boþ deðerle sonlanmamýþ.%s: dizge fazla uzun (%d karakter, en fazla 65535)%s: `%s' sembolünde bilinmeyen csect türü %d var%s: `%s' sembolünde bilinmeyen %d var%s: `%s' sembolü gerekli fakat mevcut deðil%s: çok fazla ilklenmiþ yazmaç; bölüm uzunluðu %ld -%1$s: `%3$s' için ARM birleþtiricisi '%2$s' bulunamadý%1$s: `%3$s' için THUMB birleþtiricisi '%2$s' bulunamadý %s: sürümlü sembol ismi %s tanýmlý deðil%s: dýþ parçada beklenmeyen ATN türü %d%s: ATN'den sonra beklenmeyen tür%s: tamamlanmamýþ %s -%1$s: %3$u için desteklenmeyen ATI kaydý %2$u%s: bilinmeyen yer deðiþim türü %d%1$s: %3$s sembolü için bilinmeyen %2$d türünde yerdeðiþimi%s: bilinmeyen `%s' sembol bayraklarý 0x%x%1$s: uyarý: %4$s bölümünden `%3$s' sembolüne çözümlenemeyen %2$s yer deðiþimi%s: desteklenmeyen yerdeðiþim türü %s%s: desteklenmeyen yükleyici yerdeðiþimi 0x%02x%1$s: `%4$s' ile baþlayan sembol adýndan sonra desteklenmeyen - geniþ karakter dizisi 0x%2$02X 0x%3$02X -%s: _-önekli sembolleri kullanýyor, fakat dosyaya öneksiz sembolleri yazýyor%1$s: önceki modüllerden (0x%3$lx) farklý e_flags (0x%2$lx) alanlarý kullanýlýyor%s: öneksiz sembolleri kullanýyor, fakat dosyaya _-önekli sembolleri yazýyor%s: sürüm sayýsý (%ld) sembol sayýsý (%ld) ile eþleþmiyor%s: uyarý: %s: satýr numarasý taþmasý: 0x%lx > 0xffff%s: uyarý: Boþ yüklenebilir parça bulundu -%s: uyarý: ayrýlmýþ `%s' bölümü parça içinde deðil%s: uyarý: `%s' için tekrarlanmýþ satýr numarasý bilgisi%s: uyarý: satýr numaralarýnda geçersiz sembol indeksi %ld%s: uyarý: yer deðiþtirmelerde geçersiz sembol indeksi %ld%s: uyarý: sembol tablosu mmo için fazla büyük, 65535 32-bit word'den - fazla: %d. Yalnýz `Main' üretilecek. -%s: uyarý: `%s' için beklenmeyen yeniden tanýmlama%1$s: uyarý: %4$s bölümünden `%3$s' sembolüne çözümlenemeyen %2$d yer deðiþimi%1$s: uyarý: %3$s bölümünden `%2$s' sembolüne çözümlenemeyen yer deðiþimi%s:%d: S-kayýt dosyasýnda beklenmeyen `%s' karakteri -%s:%d: Intel Onaltýlýk dosyasýnda beklenmeyen `%s' karakteri -%s:%u: Intel Onaltýlýk dosyasýnda hatalý saðlama toplamý - (%u beklendi, %u bulundu)%s:%u: Intel Onaltýlýk dosyasýnda hatalý uzun adres kaydý uzunluðu%s:%u: Intel Onaltýlýk dosyasýnda hatalý uzun lineer adres kaydý uzunluðu%s:%u: Intel Onaltýlýk dosyasýnda hatalý uzun lineer baþlangýç adres uzunluðu%s:%u: Intel Onaltýlýk dosyasýnda hatalý uzun baþlangýç adresi uzunluðu%s:%u: Intel Onaltýlýk dosyasýnda bilinmeyen onaltýlýk türü %u -(bilinmeyen)*bilinmeyen*.got bölümü .plt bölümünün hemen arkasýnda deðil32 bitlik gp göreceli yer deðiþim bir dýþ sembol için yapýlýyor: m32r iþlemleri: m32rx iþlemleriyerel sembole @pltoff yerdegisimiAUX tagndx %ld ttlsiz 0x%lx lnnos %ld sonraki %ldArþivin indeksi yok; ranlib çalýþtýrarak indeks ekleyinArþiv nesne dosyasý yanlýþ biçemde%s girdi ve %s çýktýsý ile yerdeðiþimli bað deneniyorBFD %s, olumlama baþarýsýz %s:%dBFD %s iç hatasý, %s'da, %d satýrý, %s içerisinde iþlem durduruldu -BFD %s iç hatasý, %s, %d satýrýnda iþlem durduruldu -ETIR_S_C_STA_PQ'de hatalý bölüm indeksiGeçersiz deðerTemel Yerdeðiþim Dizini [.reloc]Sýnýr Ýthal Dizini%s için yer deðiþtirme bölümü bulunamadýHata Ayýklama DiziniGecikmeli Ýthal DiziniGeçerliliði kalkmýþ %s çaðrýldýAçýklama DiziniDwarf Hatasý: Kýsaltma göreli konumu (%u) kýsaltma boyutundan (%u) - daha büyük veya eþit.Dwarf Hatasý: Geçersiz kýsaltma numarasý: %d.Dwarf Hatasý: .debug_abbrev bölümü bulunamadý.Dwarf Hatasý: .debug_line bölümü bulunamadý.Dwarf Hatasý: .debug_str bölümü bulunamadý.Dwarf Hatasý: Kýsaltma numarasý %d bulunamadý.Dwarf Hatasý: DW_FORM_strp göreli konumu (%u) .debug_str boyutundan (%u) - daha büyük veya eþit.Dwarf Hatasý: Geçersiz veya desteklenmeyen FORM deðeri: %d.Dwarf Hatasý: Satýr göreli konumu (%u) satýr boyutundan (%u) - daha büyük veya eþit.Dwarf Hatasý: adres boyu '%u' bulundu, bu okuyucu '%u'dan daha büyük boylarý okuyamýyor.Dwarf Hatasý: dwarf sürümü '%hu' bulundu, bu okuyucu yalnýzca sürüm 2 bilgisini anlayabiliyor.Dwarf Hatasý: bozulmuþ satýr numarasý bölümü (geçersiz dosya numarasý).Dwarf Hatasý: bozuk satýr numarasý bölümü.ETIR_S_C_OPR_DFLIT: DesteklenmiyorETIR_S_C_OPR_INSV: DesteklenmiyorETIR_S_C_OPR_REDEF: DesteklenmiyorETIR_S_C_OPR_ROT: DesteklenmiyorETIR_S_C_OPR_USH: DesteklenmiyorETIR_S_C_STC_GBL: desteklenmiyorETIR_S_C_STC_GCA: desteklenmiyorETIR_S_C_STC_LP: desteklenmiyorETIR_S_C_STC_PS: desteklenmiyorETIR_S_C_STO_CA: sembol yok "%s"ETIR_S_C_STO_GBL: sembol yok "%s"ETIR_S_C_STO_HINT_GBL: tamamlanmamýþETIR_S_C_STO_HINT_PS: tamamlanmamýþETIR_S_C_STO_LP_PSB: DesteklenmiyorETIR_S_C_STO_RB/AB: DesteklenmiyorGirdi göreli konumu = 0x%.8lx (%ld) -Hata: %s APCS-%d için derlenmiþ, fakat %s APCS-%d için derlenmiþHata: %s EABI sürüm %d için derlenmiþ, fakat %s %d sürümü için derlenmiþHata: %s kayan sayýlarý kayan sayý yazmaçlarýnda geçiriyor, - fakat %s tamsayý yazmaçlarýnda geçiriyorHata: %s kayan sayýlarý tamsayý yazmaçlarýnda geçiriyor, - fakat %s kayan sayý yazmaçlarýnda geçiriyorHata: %s FPA iþlemi kullanýyor, fakat %s VFP iþlemi kullanýyorHata: %s VFP iþlemi kullanýyor, fakat %s FPA iþlemi kullanýyorHata: %s donanýmda kayan sayý kullanýyor, - fakat %s yazýlýmda kayan sayý kullanýyorHata: %s yazýlýmda kayan sayý kullanýyor, - fakat %s donanýmda kayan sayý kullanýyorHata: Parçadaki (%s) ilk bölüm 0x%x'de, parça ise 0x%x'de baþlýyorHata: bellek tükendiÝstisna Dizini [.pdata]Ýhraç Dizini [.edata (veya nerede bulundu ise)]Ýhraç Bayraklarý %lx -RVA Ýhracýönceki HI16 yerdeðiþimi BULUNAMADI -Dosya biçemi belirsizDosya biçemi tanýnmýyorDosya yanlýþ biçemdeDosya fazla büyükDosya budandýBayrak alaný = 0x%.2x -RVA YönlendiricisiGP tanýmlanmamýþken GP göreli yer deðiþtirmesi kullanýlmýþGP tanýmlanmamýþken GP göreli yer deðiþtirmesi_gp tanýmsýz iken GP göreli yer deðiþtirmesiGPDISP yerdeðiþimi ldah ve lda iþlemlerini bulamadýAdres Tablosu Ýthal DiziniÝthal Dizini [.idata'nýn parçalarý]Geçersiz bfd hedefiGeçersiz iþlemUzunluk = 0x%.8lx (%ld) -mips16 nesnelerini %s biçemine baðlamak desteklenmiyorAyar Yükleme DiziniMajör/Minör %d/%d -Bozuk arþivBellek tükendiIHCONST yokIHIHALF yokÝsim Hafýza Yok !Hata yokBaþka arþivlenmiþ dosya yokSembol yokÇýktýda gösterilemeyen bölümYerdeðiþimleri sýralamak için gerekli bellek yokSayý içinde: -Nesne kodu %d bulunmadýNesne modülü hatasýz DEÐÝL ! +%s: geçersiz mmo dosyası: %d sayısı için dosya adı kullanımdan + önce belirtilmemiÅŸ +%s: geçersiz mmo dosyası: %d sayılı dosya, `%s', zaten `%s' olarak girilmiÅŸ +%s: geçersiz mmo dosyası: $255 için baÅŸlangıç deÄŸeri `Main' deÄŸil +%s: geçersiz mmo dosyası: iÅŸlenen word'un ilk baytı 0 veya 1 olmalı; + lop_fixrx için %d bulundu +%s: geçersiz mmo dosyası: lop_end dosyadaki son girdi deÄŸil +%s: geçersiz mmo dosyası: desteklenmeyen lopkod `%d' +%s: geçersiz yer deÄŸiÅŸim türü %d%s: %ld uzunluÄŸunda ilklenmiÅŸ yazmaçlar için hatalı baÅŸlangıç adresi: 0x%lx%08lx +%1$s: `%4$s' bölümünde geçersiz dizge göreli konumu %2$u >= %3$lu%s: geçersiz sembol tablosu: tekrarlanmış sembol `%s' +%s: sıçrama fazla uzak +%s: satır numarası taÅŸması: 0x%lx > 0xffff%s: 64 bitlik dosyalar 32 bitlik dosyalarla baÄŸlanıyor%s: PIC dosyaları PIC olmayan dosyalarla baÄŸlanıyor%s: UltraSPARC'a özel kod HAL'e özel kod ile baÄŸlanıyor%s: abicalls dosyaları abicalls olmayan dosyalarla baÄŸlanıyor%s: auto-pic dosyaları auto-pic olmayan dosyalarla baÄŸlanıyor%s: büyük sonlu dosyalar küçük sonlu dosyalarla baÄŸlanıyor%s: constant-gp dosyaları constant-gp olmayan dosyalarla baÄŸlanıyor%s: küçük sonlu dosyalar büyük sonlu dosyalarla baÄŸlanıyor%s: pic olmayan kod paylaÅŸmalı kitaplıkta baÄŸlanıyor%s: NULL-halinde-tuzakla karşı-baÅŸvurusu tuzaklamayan dosyalarla baÄŸlandı%s: %s salt-okunur bölümünde yükleyici yerdeÄŸiÅŸimi%s: bilinmeyen `%s' bölümünde yükleyici yerdeÄŸiÅŸimi%s: XTY_LD `%s'yanlış yerde%s: %s bölümünde grup bilgisi yok%s: ilklenen yazmaç yok; bölüm uzunluÄŸu 0 +%s: böyle bir sembol yok%s: "%s" sembolü yok%s: tamamlanmamış%s: tamamlanmamış%s: desteklenmiyor%s: nesne boyu hedef %s'nin boyuyla eÅŸleÅŸmiyor%s: %s dinamik sembolüne pc göreceli yer deÄŸiÅŸimi%s: acaba -fPIC olmaksızın mı derlenmiÅŸ?%1$s: yazmaç olmayan sembole yazmaç yerdeÄŸiÅŸimi: %3$s içinde %2$s%s: yazmaç olmayan sembole yazmaç yerdeÄŸiÅŸimi: %s içinde (bilinmeyen)%s: yerdeÄŸiÅŸim %s:%d csect içinde deÄŸil%s: yerdeÄŸiÅŸim taÅŸması 1: 0x%lx > 0xffff%s: %s'dan %s'ya yeri deÄŸiÅŸtirilebilen baÄŸ desteklenmiyor%s: %s yer deÄŸiÅŸimi paylaşımlı nesne oluÅŸturulurken kullanılamaz; -fPIC ile yeniden derleyin%s: %s yerdeÄŸiÅŸimi paylaşımlı nesne oluÅŸturulurken kullanılamaz%1$s: `%3$s' bölümünde %2$s yer deÄŸiÅŸtirmesi mevcut, fakat GOT oluÅŸturulmamış%1$s: %4$s bölümünden %3$s evrensel sembolü için %2$s yerdeÄŸiÅŸimi yapılamaz%s: %s yer deÄŸiÅŸimi paylaşımlı nesne oluÅŸtururken kullanılamaz; -fPIC ile yeniden derleyin%1$s: %4$s bölümünden yerel sembol sıfır olmayan %3$d eklemesi ile + %2$s yerdeÄŸiÅŸimi%1$s: %5$s bölümünden `%4$s' sembolüne sıfır olmayan %3$d eklemesi ile %2$s yerdeÄŸiÅŸimi%1$s: %3$s bölümünde %2$s içinde yerdeÄŸiÅŸim boy uyuÅŸmazlığı%s: `%s' bölümünde yer deÄŸiÅŸtirmeler mevcut, fakat içi boÅŸ%s: kısa veri bölümünde taÅŸma (0x%lx >= 0x400000)%s: Ä°thal Kitaplık Biçem (ILF) baÅŸlığında boy alanı sıfır%s: tanımlanmamış gevÅŸek sembole tartışmalı düzeltme%s: ILF nesne dosyasında dizge boÅŸ deÄŸerle sonlanmamış.%s: dizge fazla uzun (%d karakter, en fazla 65535)%s: `%s' sembolünde bilinmeyen csect türü %d var%s: `%s' sembolünde bilinmeyen %d var%s: `%s' sembolü gerekli fakat mevcut deÄŸil%s: çok fazla ilklenmiÅŸ yazmaç; bölüm uzunluÄŸu %ld +%s: %s dinamik sembolüne tp göreceli yer deÄŸiÅŸimi%1$s: `%3$s' için ARM birleÅŸtiricisi '%2$s' bulunamadı%1$s: `%3$s' için THUMB birleÅŸtiricisi '%2$s' bulunamadı %s: opd bölümünde tanımlanmamış `%s' sembolü%s: sürümlü sembol ismi %s tanımlı deÄŸil%s: dış parçada beklenmeyen ATN türü %d%s: opd bölümünde beklenmeyen yerdeÄŸiÅŸim türü %u%s: ATN'den sonra beklenmeyen tür%s: %s'e desteklenmeyen dinamik yerdeÄŸiÅŸim%s: tamamlanmamış %s +%1$s: %3$u sembolü için desteklenmeyen ATI kaydı %2$u%s: bilinmeyen yer deÄŸiÅŸim türü %d%1$s: %3$s sembolü için bilinmeyen %2$d türünde yerdeÄŸiÅŸimi%s: bilinmeyen `%s' sembol bayrakları 0x%x%1$s: uyarı: %4$s bölümünden `%3$s' sembolüne çözümlenemeyen %2$s yer deÄŸiÅŸimi%s: desteklenmeyen yerdeÄŸiÅŸim türü %s%s: desteklenmeyen yükleyici yerdeÄŸiÅŸimi 0x%02x%1$s: `%4$s' ile baÅŸlayan sembol adından sonra desteklenmeyen + geniÅŸ karakter dizisi 0x%2$02X 0x%3$02X +%s: _-önekli sembolleri kullanıyor, fakat dosyaya öneksiz sembolleri yazıyor%1$s: önceki modüllerden (0x%3$lx) farklı e_flags (0x%2$lx) alanları kullanılıyor%s: önceki modüllerden farklı bilinmeyen e_flags (0x%lx) alanları kullanılıyor (0x%lx)%s: öneksiz sembolleri kullanıyor, fakat dosyaya _-önekli sembolleri yazıyor%s: sürüm sayısı (%ld) sembol sayısı (%ld) ile eÅŸleÅŸmiyor%1$s: uyarı: %4$s bölümünden `%3$s' sembolüne %2$s yer deÄŸiÅŸimi%1$s: uyarı: %4$s bölümünden 0x%3$x'e %2$s yer deÄŸiÅŸimi%s: uyarı: %s: satır numarası taÅŸması: 0x%lx > 0xffff%s: uyarı: BoÅŸ yüklenebilir parça bulundu, bu isteyerek mi yapılıyor? +%1$s: uyarı: `%3$s'ye GOT %2$ld eklentisi bir önceki %4$ld GOT eklentisiyle eÅŸleÅŸmiyor%1$s: uyarı: %4$s bölümünden `%3$s' sembolüne PLT eklentisi %2$d yok sayıldı%s: uyarı: ayrılmış `%s' bölümü parça içinde deÄŸil%s: uyarı: `%s' için tekrarlanmış satır numarası bilgisi%s: uyarı: satır numaralarında geçersiz sembol indeksi %ld%s: uyarı: yer deÄŸiÅŸtirmelerde geçersiz sembol indeksi %ld%s: uyarı: sembol tablosu mmo için fazla büyük, 65535 32-bit word'den + fazla: %d. Yalnız `Main' üretilecek. +%s: uyarı: `%s' için beklenmeyen yeniden tanımlama%1$s: uyarı: %4$s bölümünden `%3$s' sembolüne çözümlenemeyen %2$d yer deÄŸiÅŸimi%1$s: uyarı: %3$s bölümünden `%2$s' sembolüne çözümlenemeyen yer deÄŸiÅŸimi%s:%d: S-kayıt dosyasında beklenmeyen `%s' karakteri +%s:%d: Intel Onaltılık dosyasında beklenmeyen `%s' karakteri +%s:%u: Intel Onaltılık dosyasında hatalı saÄŸlama toplamı + (%u beklendi, %u bulundu)%s:%u: Intel Onaltılık dosyasında hatalı uzun adres kaydı uzunluÄŸu%s:%u: Intel Onaltılık dosyasında hatalı uzun lineer adres kaydı uzunluÄŸu%s:%u: Intel Onaltılık dosyasında hatalı uzun lineer baÅŸlangıç adres uzunluÄŸu%s:%u: Intel Onaltılık dosyasında hatalı uzun baÅŸlangıç adresi uzunluÄŸu%s:%u: Intel Onaltılık dosyasında bilinmeyen onaltılık türü %u +*bilinmeyen*.got bölümü .plt bölümünün hemen arkasında deÄŸil32 bitlik gp göreceli yer deÄŸiÅŸim bir dış sembol için yapılıyor: m32r iÅŸlemleri: m32rx iÅŸlemleriyerel sembole @pltoff yerdegisimiArÅŸivin indeksi yok; ranlib çalıştırarak indeks ekleyinArÅŸiv nesne dosyası yanlış biçemde%s girdi ve %s çıktısı ile yerdeÄŸiÅŸimli baÄŸ deneniyorBFD %s, olumlama baÅŸarısız %s:%dBFD %s iç hatası, %s, %d satırında iÅŸlem durduruldu +BFD %s iç hatası, %s'da, %d satırı, %s içerisinde iÅŸlem durduruldu +Geçersiz deÄŸerTemel YerdeÄŸiÅŸim Dizini [.reloc]Sınır Ä°thal Dizini%s için yer deÄŸiÅŸtirme bölümü bulunamadıHata Ayıklama DiziniGecikmeli Ä°thal DiziniGeçerliliÄŸi kalkmış %s çaÄŸrıldı +GeçersizleÅŸmiÅŸ %s, %s'da, %d satırı, %s içerisinde çaÄŸrıldı +Açıklama DiziniDwarf Hatası: Kısaltma göreli konumu (%lu) kısaltma boyutundan (%lu) + daha büyük veya eÅŸit.Dwarf Hatası: Geçersiz kısaltma numarası: %u.Dwarf Hatası: .debug_abbrev bölümü bulunamadı.Dwarf Hatası: .debug_line bölümü bulunamadı.Dwarf Hatası: .debug_str bölümü bulunamadı.Dwarf Hatası: Kısaltma numarası %u bulunamadı.Dwarf Hatası: DW_FORM_strp göreli konumu (%lu) .debug_str boyutundan (%lu) + daha büyük veya eÅŸit.Dwarf Hatası: Geçersiz veya desteklenmeyen FORM deÄŸeri: %u.Dwarf Hatası: Satır göreli konumu (%lu) satır boyutundan (%lu) + daha büyük veya eÅŸit.Dwarf Hatası: adres boyu '%u' bulundu, bu okuyucu '%u'dan daha büyük boyları okuyamıyor.Dwarf Hatası: dwarf sürümü '%u' bulundu, bu okuyucu yalnızca sürüm 2 bilgisini anlayabiliyor.Dwarf Hatası: bozulmuÅŸ satır numarası bölümü (geçersiz dosya numarası).Dwarf Hatası: bozuk satır numarası bölümü.HATA: %s yere bağımlı kod olarak derlendi, fakat hedef %s yerden bağımsızHATA: %s yerden bağımsız kod olarak derlendi, fakat hedef %s yere bağımlıHata: %s APCS-%d için derlenmiÅŸ, fakat %s APCS-%d için derlenmiÅŸHATA: %s, APCS-%d için derlenmiÅŸ fakat hedef %s APCS-%d kullanıyorHata: %s EABI sürüm %d için derlenmiÅŸ, fakat %s %d sürümü için derlenmiÅŸHata: %s kayan sayıları kayan sayı yazmaçlarında geçiriyor, + fakat %s tamsayı yazmaçlarında geçiriyorHata: %s kayan sayıları tamsayı yazmaçlarında geçiriyor, + fakat %s kayan sayı yazmaçlarında geçiriyorHata: %s FPA iÅŸlemi kullanıyor, fakat %s VFP iÅŸlemi kullanıyorHata: %s VFP iÅŸlemi kullanıyor, fakat %s FPA iÅŸlemi kullanıyorHata: %s donanımda kayan sayı kullanıyor, + fakat %s yazılımda kayan sayı kullanıyorHata: %s yazılımda kayan sayı kullanıyor, + fakat %s donanımda kayan sayı kullanıyorGirdi göreli konumu = 0x%.8lx (%ld) +Hata: Parçadaki (%s) ilk bölüm 0x%x'de, parça ise 0x%x'de baÅŸlıyorHata: bellek tükendiÄ°stisna Dizini [.pdata]Ä°hraç Dizini [.edata (veya nerede bulundu ise)]Ä°hraç Bayrakları %lx +RVA Ä°hracıönceki HI16 yerdeÄŸiÅŸimi BULUNAMADI +Dosya biçemi belirsizDosya biçemi tanınmıyorDosya yanlış biçemdeDosya fazla büyükDosya budandıBayrak alanı = 0x%.2x +RVA YönlendiricisiGP tanımlanmamışken GP göreli yer deÄŸiÅŸtirmesi kullanılmış_gp tanımsız iken GP göreli yer deÄŸiÅŸtirmesiGPDISP yerdeÄŸiÅŸimi ldah ve lda iÅŸlemlerini bulamadıAdres Tablosu Ä°thal DiziniÄ°thal Dizini [.idata'nın parçaları]İç uyumsuzluk: kalan %u != maksimum %u. + Lütfen bu hatayı bildirin.Geçersiz bfd hedefiGeçersiz iÅŸlemUzunluk = 0x%.8lx (%ld) +mips16 nesnelerini %s biçemine baÄŸlamak desteklenmiyorAyar Yükleme DiziniMajör/Minör %d/%d +Bozuk arÅŸivBellek tükendiIHCONST yokIHIHALF yokÄ°sim Hafıza Yok !Hata yokBaÅŸka arÅŸivlenmiÅŸ dosya yokSembol yokÇıktıda gösterilemeyen bölümYerdeÄŸiÅŸimleri sıralamak için gerekli bellek yokSayı içinde: +Nesne modülü hatasız DEĞİL ! Onluk Sistem %ld -Çýktý dosyasý için paylaþýmlý kitaplýk `%s' gerekli -Çýktý dosyasý için paylaþýmlý kitaplýk `%s.so.%s' gerekli -PASSMECH tamamlanmamýþBölüm adý = "%s" -Bölüm[%d] sonu = { 0x%.2x, 0x%.2x, 0x%.2x, 0x%.2x } -Bölüm[%d] uzunluðu = 0x%.8lx (%ld) -Bölüm[%d] sektörü = 0x%.8lx (%ld) -Lütfen bu hatayý bildirin. -Arþiv dosyasý deðiþim zaman damgasý okunuyor%%g%1$d yazmacý uyumsuz kullanýlmýþ: %3$s içinde %2$sYazmaç bölümünde içerik yok -AyrýlmýþAyrýlmýþ CTL komutu %dAyrýlmýþ OPR komutu %dAyrýlmýþ STA komutu %dAyrýlmýþ STO komutu %dKaynak Dizini [.rsrc]_SDA_BASE_ tanýmlanmamýþ iken SDA yer deðiþimi%s bölümünde yerdeðiþim olmaksýzýn SEC_RELOCBölümde içerik yokGüvenlik DiziniBoy uyumsuzluðu bölümü %s=%lx, %s=%lxÖzel Dizin_bfd_vms_push'da yýðýt taþmasý (%d)_bfd_vms_pop'da yýðýt alt taþmasýYýðýn girdi maský tamamlanmamýþGörüntüden-yýðýt tamamlanmamýþYýðýt sabiti tamamlanmamýþYerel sembol yýðýtý tamamlanmamýþYýðýn yerel sembol girdi nokta maský tamamlanmamýþ%s sembolü düzeltmeler için tanýmlý deðil -%s sembolü %s ile deðiþtirildi -`%1$s' sembolünün farklý türleri var: %3$s içinde %2$sSembol, olmayan hata ayýklama bölümünü istiyorSistem çaðrý hatasýTIR_S_C_CTL_DFLOC tamamlanmamýþTIR_S_C_CTL_STKDL tamamlanmamýþTIR_S_C_CTL_STLOC tamamlanmamýþTIR_S_C_OPR_ASH tamamlanmamýþTIR_S_C_OPR_DFLIT desteklenmiyorTIR_S_C_OPR_REDEF desteklenmiyorTIR_S_C_OPR_ROT tamamlanmamýþTIR_S_C_OPR_USH tamamlanmamýþTOC taþmasý: 0x%lx > 0x10000; -mminimal-toc ile derlemeyi deneyinTablo Adresleri -Dal Saklama Dizini [.tls]Saat/Tarih damgasý %lx -Desteklenmeyen OSF/1 core dosyasý bölüm türü %d -Desteklenmeyen yerdeðiþim %sTamamlanmamýþ STO komutu %dBilinmeyen temel tür %dTanýnmayan TI COFF hedef kimliði '0x%x'Tanýnmayan yer deðiþtirmeBilinmeyen yer deðiþtirme türü 0x%xDesteklenmeyen .stab yerdeðiþimiDesteklenmeyen STA komutu %d`%s' deðiþkeni küçük, sýfýr ve ufak veri sahalarýndan yalnýz birinde olabilir`%s' deðiþkeni ayný anda hem küçük hem ufak veri sahalarýnda bulunamaz`%s' deðiþkeni ayný anda hem küçük hem sýfýr veri sahalarýnda bulunamaz`%s' deðiþkeni ayný anda hem sýfýr hem ufak veri sahalarýnda bulunamaz`%s' deðiþkeni birden fazla küçük veri sahasýný kapsayamazUyarý, .pdata bölüm boyu (%ld) %d'nin katý deðil -Uyarý: %s girdi dosyasý beraber çalýþmayý desteklemiyor, fakat %s destekliyor.Uyarý: %s girdi dosyasý beraber çalýþmayý destekliyor, fakat %s desteklemiyor.Uyarý: %2$s'deki beraber çalýþmaz kod ona baðlandýðý için %1$s'nin beraber çalýþma bayraðý temizlendiUyarý: Dýþ isteðe uyularak %s'nin beraber çalýþma bayraðý temizlendiUyarý: %s beraber çalýþma bayraðý dýþ istek üzerine temizlendiUyarý: beraber çalýþmaz diye önceden belirtilmiþ olduðundan %s'nin beraber çalýþma bayraðý atanmadýUyarý: %s beraber çalýþma bayraðý atanmadý, çünkü beraber çalýþma olmayacaðý önceden belirtilmiþUyarý: `%s' bölümü çok büyük (negatif) dosya göreli konumu 0x%lx'e yazýlýyor.Uyarý: düzeltme sayý uyumsuzluðu -Uyarý: %s girdi dosyasý beraber çalýþmayý desteklemiyor, fakat %s destekliyor.Uyarý: %s girdi dosyasý beraber çalýþmayý destekliyor, fakat %s desteklemiyor.Uyarý: `%s' sembolünün boyu %lu'dan %lu'ya %s içerisinde deðiþtiUyarý: %4$s içerisinde `%1$s' sembolünün türü %2$d'den %3$d'e deðiþtirildiUyarý: arþiv yazma iþlemi yavaþ: zaman damgasý yeniden yazýlýyor -Güncellenmiþ armap zaman damgasý yazýlýyor[adý kaybolmuþ]_bfd_vms_output_counted fazla bayt ile çaðrýldý_bfd_vms_output_counted sýfýr bayt ile çaðrýldýbfd_make_section (%s) baþarýsýzbfd_set_section_flags (%s, %x) baþarýsýzözel baðlayýcý sembolü __ctbp bulunamadýözel baðlayýcý sembolü __ep bulunamadýözel baðlayýcý sembolü __gp bulunamadýbfd sembolünden elf sembolü:0x%.8lx, isim= %s, sem num = %d, bayrak = 0x%.8lx%s -hata: tanýmlanmamýþ sembol __rtinit%s'e giriþ baþarýsýzyer deðiþtirme %s yoksayýldý -iç hata: ölümcül hataiç hata: tehlikeli yer deðiþimiç hata: kapsam dýþý hatasýiç hata: bilinmeyen hataiç hata: desteklenmeyen yer deðiþim hatasý`%s'ye baðlama tablosu taþmasýatýlmýþ %s bölümünde yerel sembollereksik IHCONST yer deðiþtirmesieksik IHIHALF yer deðiþtirmesi@fptr yerdeðiþiminde sýfýr olmayan eklentiyerel GOT girdileri için yeterli GOT yeri yokeþlenmeyen: veri=%lx eþleþen=%d -eþlenmeyen: çevre deðiþkeni atanmamýþ -özel bayraklar = %lxözel bayraklar = %lx:özel bayraklar = %lx:özel bayraklar = %x:desteklenmeyen bölümde yer deðiþtirmeyer deðiþtirme doðru hizalanmamýþsom_sizeof_headers tamamlanmamýþstatik altyordam (isimsiz)%s için koçan girdisi .plt'yi yükleyemedi, dp görecesi = %ldkoçan bölümü boyu hesaplanan boyla eþleþmiyorCOFF olmayan sembol için belirsiz çaðrý davranýþýbilinmeyen gsd/egsd alt türü %ddesteklenmeyen yerdeðiþimdesteklenmeyen yer deðiþtirme türübirden fazla gp deðeri kullanýlýyorv850 platformuv850e platformuv850ea platformuuyarý: %s: `%s' yerel sembolünün bölümü yokuyarý: tanýmlanmamýþ `%s' sembolünü ihraç denemesi%1$s: silinmiþ bölüme yerdeðiþimuyarý: silinmiþ bölüme yer deðiþim; sýfýrlandýuyarý: `%s' dinamik sembolünün türü ve boyu tanýmlý deðil \ No newline at end of file +Çıktı dosyası için paylaşımlı kitaplık `%s' gerekli +Çıktı dosyası için paylaşımlı kitaplık `%s.so.%s' gerekli +PASSMECH tamamlanmamışPTA uyumsuzluÄŸu: SHcompact adresi (bit 0 == 0)PTB uyumsuzluÄŸu: SHmedia adresi (bit 0 == 1)Bölüm adı = "%s" +Bölüm[%d] sonu = { 0x%.2x, 0x%.2x, 0x%.2x, 0x%.2x } +Bölüm[%d] uzunluÄŸu = 0x%.8lx (%ld) +Bölüm[%d] sektörü = 0x%.8lx (%ld) +Lütfen bu hatayı bildirin. +ArÅŸiv dosyası deÄŸiÅŸim zaman damgası okunuyor%%g%1$d yazmacı uyumsuz kullanılmış: %3$s içinde %2$s, daha önce %5$s içinde %4$s idiYazmaç bölümünde içerik yok +AyrılmışKaynak Dizini [.rsrc]_SDA_BASE_ tanımlanmamış iken SDA yer deÄŸiÅŸimi%s bölümünde yerdeÄŸiÅŸim olmaksızın SEC_RELOCBölümde içerik yokGüvenlik DiziniBoy uyumsuzluÄŸu bölümü %s=%lx, %s=%lxÖzel Dizin_bfd_vms_push'da yığıt taÅŸması (%d)_bfd_vms_pop'da yığıt alt taÅŸması%s sembolü düzeltmeler için tanımlı deÄŸil +%s sembolü %s ile deÄŸiÅŸtirildi +`%1$s' sembolünün farklı türleri var: %3$s içinde %2$s, + daha önce %4$s içinde REGISTER (yazmaç)`%1$s' sembolünün farklı türleri var: %2$s içinde REGISTER (yazmaç), daha önce %4$s içinde %3$sSembol, olmayan hata ayıklama bölümünü istiyorSistem çaÄŸrı hatasıTOC taÅŸması: 0x%lx > 0x10000; -mminimal-toc ile derlemeyi deneyinTablo Adresleri +Dal Saklama Dizini [.tls]Saat/Tarih damgası %lx +Yerel sembolde STO_SH5_ISA32 desteklenmiyorDesteklenmeyen OSF/1 core dosyası bölüm türü %d +Desteklenmeyen yerdeÄŸiÅŸim %sBilinmeyen temel tür %dTanınmayan TI COFF hedef kimliÄŸi '0x%x'Tanınmayan yer deÄŸiÅŸtirmeBilinmeyen yer deÄŸiÅŸtirme türü 0x%xDesteklenmeyen .stab yerdeÄŸiÅŸimi`%s' deÄŸiÅŸkeni küçük, sıfır ve ufak veri sahalarından yalnız birinde olabilir`%s' deÄŸiÅŸkeni aynı anda hem küçük hem ufak veri sahalarında bulunamaz`%s' deÄŸiÅŸkeni aynı anda hem küçük hem sıfır veri sahalarında bulunamaz`%s' deÄŸiÅŸkeni aynı anda hem sıfır hem ufak veri sahalarında bulunamaz`%s' deÄŸiÅŸkeni birden fazla küçük veri sahasını kapsayamazUyarı, .pdata bölüm boyu (%ld) %d'nin katı deÄŸil +Uyarı: %s girdi dosyası beraber çalışmayı desteklemiyor, fakat %s destekliyor.Uyarı: %s girdi dosyası beraber çalışmayı destekliyor, fakat %s desteklemiyor.Uyarı: %2$s'deki beraber çalışmaz kod ona baÄŸlandığı için %1$s'nin beraber çalışma bayrağı temizlendiUyarı: %s beraber çalışma bayrağı dış istek üzerine temizlendiUyarı: %s beraber çalışma bayrağı atanmadı, çünkü beraber çalışma olmayacağı önceden belirtilmiÅŸUyarı: `%s' bölümü çok büyük (negatif) dosya göreli konumu 0x%lx'e yazılıyor.Uyarı: düzeltme sayı uyumsuzluÄŸu +Uyarı: `%s' sembolünün boyu %lu'dan %lu'ya %s içerisinde deÄŸiÅŸtiUyarı: %4$s içerisinde `%1$s' sembolünün türü %2$d'den %3$d'e deÄŸiÅŸtirildiUyarı: arÅŸiv yazma iÅŸlemi yavaÅŸ: zaman damgası yeniden yazılıyor +GüncellenmiÅŸ armap zaman damgası yazılıyor[adı kaybolmuÅŸ]_bfd_vms_output_counted fazla bayt ile çaÄŸrıldı_bfd_vms_output_counted sıfır bayt ile çaÄŸrıldı%s içinde hatalı bölüm indeksibfd_make_section (%s) baÅŸarısızbfd_set_section_flags (%s, %x) baÅŸarısız`%s' dal koçanı derlenemedi`%s' dal koçanı bulunamadıözel baÄŸlayıcı sembolü __ctbp bulunamadıözel baÄŸlayıcı sembolü __ep bulunamadıözel baÄŸlayıcı sembolü __gp bulunamadıhata: tanımlanmamış sembol __rtinit%s'e giriÅŸ baÅŸarısızyer deÄŸiÅŸtirme %s yoksayıldı +iç hata: ölümcül hataiç hata: tehlikeli yer deÄŸiÅŸimiç hata: kapsam dışı hatasıiç hata: bilinmeyen hataiç hata: desteklenmeyen yer deÄŸiÅŸim hatası`%s'ye baÄŸlama tablosu hatasıatılmış %s bölümünde yerel sembollereksik IHCONST yer deÄŸiÅŸtirmesieksik IHIHALF yer deÄŸiÅŸtirmesi@fptr yerdeÄŸiÅŸiminde sıfır olmayan eklentiyerel GOT girdileri için yeterli GOT yeri yokeÅŸlenmeyen: veri=%lx eÅŸleÅŸen=%d +eÅŸlenmeyen: çevre deÄŸiÅŸkeni atanmamış +Nesne kodu %d bulunmadıözel bayraklar = %lxözel bayraklar = %lx:özel bayraklar = %lx:özel bayraklar = %x:özel bayraklar = 0x%lx:desteklenmeyen bölümde yer deÄŸiÅŸtirmeyer deÄŸiÅŸtirme doÄŸru hizalanmamışAyrılmış CTL komutu %dAyrılmış OPR komutu %dAyrılmış STA komutu %dAyrılmış STO komutu %dsom_sizeof_headers tamamlanmamışYığın girdi maskı tamamlanmamışGörüntüden-yığıt tamamlanmamışYığıt sabiti tamamlanmamışYerel sembol yığıtı tamamlanmamışYığın yerel sembol girdi noktası maskı tamamlanmamışstatik altyordam (isimsiz)%s için koçan girdisi .plt'yi yükleyemedi, dp görecesi = %ldkoçanlar hesaplanan boyla eÅŸleÅŸmiyorCOFF olmayan sembol için belirsiz çaÄŸrı davranışıbilinmeyen gsd/egsd alt türü %dDesteklenmeyen STA komutu %sdesteklenmeyen yerdeÄŸiÅŸimdesteklenmeyen yer deÄŸiÅŸtirme türübirden fazla gp deÄŸeri kullanılıyorv850 platformuv850e platformuv850ea platformuuyarı: %s bölümü sıfır boyundauyarı: %s: `%s' yerel sembolünün bölümü yokuyarı: tanımlanmamış `%s' sembolünü ihraç denemesi%1$s: silinmiÅŸ bölüme yerdeÄŸiÅŸimuyarı: silinmiÅŸ bölüme yer deÄŸiÅŸim; sıfırlandıuyarı: `%s' dinamik sembolünün türü ve boyu tanımlı deÄŸil \ No newline at end of file diff -Nurpa binutils-2.13/bfd/po/tr.po binutils-2.13.1/bfd/po/tr.po --- binutils-2.13/bfd/po/tr.po 2002-02-05 05:25:58.000000000 -0500 +++ binutils-2.13.1/bfd/po/tr.po 2002-09-23 18:12:43.000000000 -0400 @@ -4,171 +4,171 @@ # msgid "" msgstr "" -"Project-Id-Version: bfd 2.12-pre020121\n" -"POT-Creation-Date: 2002-01-17 12:55+0000\n" -"PO-Revision-Date: 2002-01-24 13:11EET\n" +"Project-Id-Version: bfd 2.12.91\n" +"POT-Creation-Date: 2002-07-23 15:55-0400\n" +"PO-Revision-Date: 2002-08-10 13:11EET\n" "Last-Translator: Deniz Akkus Kanca \n" "Language-Team: Turkish \n" "MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=ISO-8859-9\n" +"Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" "X-Generator: KBabel 0.9.5\n" -#: aout-adobe.c:196 +#: aout-adobe.c:197 #, c-format msgid "%s: Unknown section type in a.out.adobe file: %x\n" -msgstr "%s: a.out.adobe dosyasýnda bilinmeyen bölüm türü: %x\n" +msgstr "%s: a.out.adobe dosyasında bilinmeyen bölüm türü: %x\n" #: aout-cris.c:208 #, c-format msgid "%s: Invalid relocation type exported: %d" -msgstr "%s: Geçersiz yer deðiþtirme türü ihraç edilmiþ: %d" +msgstr "%s: Geçersiz yer deÄŸiÅŸtirme türü ihraç edilmiÅŸ: %d" #: aout-cris.c:252 #, c-format msgid "%s: Invalid relocation type imported: %d" -msgstr "%s: Geçersiz yer deðiþtirme türü ithal edilmiþ: %d" +msgstr "%s: Geçersiz yer deÄŸiÅŸtirme türü ithal edilmiÅŸ: %d" #: aout-cris.c:263 #, c-format msgid "%s: Bad relocation record imported: %d" -msgstr "%s: Geçersiz yer deðiþtirme kaydý ithal edilmiþ: %d" +msgstr "%s: Geçersiz yer deÄŸiÅŸtirme kaydı ithal edilmiÅŸ: %d" #: aoutx.h:1282 aoutx.h:1699 #, c-format msgid "%s: can not represent section `%s' in a.out object file format" -msgstr "%s: `%s' bölümü a.out nesne dosya biçeminde gösterilemez" +msgstr "%s: `%s' bölümü a.out nesne dosya biçeminde gösterilemez" #: aoutx.h:1669 #, c-format msgid "%s: can not represent section for symbol `%s' in a.out object file format" -msgstr "%s: `%s' sembol bölümü a.out nesne dosyasýnda gösterilemez" +msgstr "%s: `%s' sembol bölümü a.out nesne dosyasında gösterilemez" #: aoutx.h:1671 msgid "*unknown*" msgstr "*bilinmeyen*" -#: aoutx.h:3735 +#: aoutx.h:3732 #, c-format msgid "%s: relocateable link from %s to %s not supported" -msgstr "%s: %s'dan %s'ya yeri deðiþtirilebilen bað desteklenmiyor" +msgstr "%s: %s'dan %s'ya yeri deÄŸiÅŸtirilebilen baÄŸ desteklenmiyor" #: archive.c:1826 msgid "Warning: writing archive was slow: rewriting timestamp\n" -msgstr "Uyarý: arþiv yazma iþlemi yavaþ: zaman damgasý yeniden yazýlýyor\n" +msgstr "Uyarı: arÅŸiv yazma iÅŸlemi yavaÅŸ: zaman damgası yeniden yazılıyor\n" #: archive.c:2093 msgid "Reading archive file mod timestamp" -msgstr "Arþiv dosyasý deðiþim zaman damgasý okunuyor" +msgstr "ArÅŸiv dosyası deÄŸiÅŸim zaman damgası okunuyor" #. FIXME: bfd can't call perror. #: archive.c:2120 msgid "Writing updated armap timestamp" -msgstr "Güncellenmiþ armap zaman damgasý yazýlýyor" +msgstr "GüncellenmiÅŸ armap zaman damgası yazılıyor" -#: bfd.c:281 +#: bfd.c:274 msgid "No error" msgstr "Hata yok" -#: bfd.c:282 +#: bfd.c:275 msgid "System call error" -msgstr "Sistem çaðrý hatasý" +msgstr "Sistem çaÄŸrı hatası" -#: bfd.c:283 +#: bfd.c:276 msgid "Invalid bfd target" -msgstr "Geçersiz bfd hedefi" +msgstr "Geçersiz bfd hedefi" -#: bfd.c:284 +#: bfd.c:277 msgid "File in wrong format" -msgstr "Dosya yanlýþ biçemde" +msgstr "Dosya yanlış biçemde" -#: bfd.c:285 +#: bfd.c:278 msgid "Archive object file in wrong format" -msgstr "Arþiv nesne dosyasý yanlýþ biçemde" +msgstr "ArÅŸiv nesne dosyası yanlış biçemde" -#: bfd.c:286 +#: bfd.c:279 msgid "Invalid operation" -msgstr "Geçersiz iþlem" +msgstr "Geçersiz iÅŸlem" -#: bfd.c:287 +#: bfd.c:280 msgid "Memory exhausted" -msgstr "Bellek tükendi" +msgstr "Bellek tükendi" -#: bfd.c:288 +#: bfd.c:281 msgid "No symbols" msgstr "Sembol yok" -#: bfd.c:289 +#: bfd.c:282 msgid "Archive has no index; run ranlib to add one" -msgstr "Arþivin indeksi yok; ranlib çalýþtýrarak indeks ekleyin" +msgstr "ArÅŸivin indeksi yok; ranlib çalıştırarak indeks ekleyin" -#: bfd.c:290 +#: bfd.c:283 msgid "No more archived files" -msgstr "Baþka arþivlenmiþ dosya yok" +msgstr "BaÅŸka arÅŸivlenmiÅŸ dosya yok" -#: bfd.c:291 +#: bfd.c:284 msgid "Malformed archive" -msgstr "Bozuk arþiv" +msgstr "Bozuk arÅŸiv" -#: bfd.c:292 +#: bfd.c:285 msgid "File format not recognized" -msgstr "Dosya biçemi tanýnmýyor" +msgstr "Dosya biçemi tanınmıyor" -#: bfd.c:293 +#: bfd.c:286 msgid "File format is ambiguous" -msgstr "Dosya biçemi belirsiz" +msgstr "Dosya biçemi belirsiz" -#: bfd.c:294 +#: bfd.c:287 msgid "Section has no contents" -msgstr "Bölümde içerik yok" +msgstr "Bölümde içerik yok" -#: bfd.c:295 +#: bfd.c:288 msgid "Nonrepresentable section on output" -msgstr "Çýktýda gösterilemeyen bölüm" +msgstr "Çıktıda gösterilemeyen bölüm" -#: bfd.c:296 +#: bfd.c:289 msgid "Symbol needs debug section which does not exist" -msgstr "Sembol, olmayan hata ayýklama bölümünü istiyor" +msgstr "Sembol, olmayan hata ayıklama bölümünü istiyor" -#: bfd.c:297 +#: bfd.c:290 msgid "Bad value" -msgstr "Geçersiz deðer" +msgstr "Geçersiz deÄŸer" -#: bfd.c:298 +#: bfd.c:291 msgid "File truncated" -msgstr "Dosya budandý" +msgstr "Dosya budandı" -#: bfd.c:299 +#: bfd.c:292 msgid "File too big" -msgstr "Dosya fazla büyük" +msgstr "Dosya fazla büyük" -#: bfd.c:300 +#: bfd.c:293 msgid "#" -msgstr "#" +msgstr "#" -#: bfd.c:707 +#: bfd.c:700 #, c-format msgid "BFD %s assertion fail %s:%d" -msgstr "BFD %s, olumlama baþarýsýz %s:%d" +msgstr "BFD %s, olumlama baÅŸarısız %s:%d" -#: bfd.c:726 +#: bfd.c:719 #, c-format msgid "BFD %s internal error, aborting at %s line %d in %s\n" -msgstr "BFD %s iç hatasý, %s'da, %d satýrý, %s içerisinde iþlem durduruldu\n" +msgstr "BFD %s iç hatası, %s'da, %d satırı, %s içerisinde iÅŸlem durduruldu\n" -#: bfd.c:730 +#: bfd.c:723 #, c-format -msgid "BFD %sinternal error, aborting at %s line %d\n" -msgstr "BFD %s iç hatasý, %s, %d satýrýnda iþlem durduruldu\n" +msgid "BFD %s internal error, aborting at %s line %d\n" +msgstr "BFD %s iç hatası, %s, %d satırında iÅŸlem durduruldu\n" -#: bfd.c:732 +#: bfd.c:725 msgid "Please report this bug.\n" -msgstr "Lütfen bu hatayý bildirin.\n" +msgstr "Lütfen bu hatayı bildirin.\n" #: binary.c:306 #, c-format msgid "Warning: Writing section `%s' to huge (ie negative) file offset 0x%lx." -msgstr "Uyarý: `%s' bölümü çok büyük (negatif) dosya göreli konumu 0x%lx'e yazýlýyor." +msgstr "Uyarı: `%s' bölümü çok büyük (negatif) dosya göreli konumu 0x%lx'e yazılıyor." #: coff-a29k.c:119 msgid "Missing IHCONST" @@ -178,1337 +178,1584 @@ msgstr "IHCONST yok" msgid "Missing IHIHALF" msgstr "IHIHALF yok" -#: coff-a29k.c:212 +#: coff-a29k.c:212 coff-or32.c:229 msgid "Unrecognized reloc" -msgstr "Tanýnmayan yer deðiþtirme" +msgstr "Tanınmayan yer deÄŸiÅŸtirme" #: coff-a29k.c:408 msgid "missing IHCONST reloc" -msgstr "eksik IHCONST yer deðiþtirmesi" +msgstr "eksik IHCONST yer deÄŸiÅŸtirmesi" #: coff-a29k.c:498 msgid "missing IHIHALF reloc" -msgstr "eksik IHIHALF yer deðiþtirmesi" +msgstr "eksik IHIHALF yer deÄŸiÅŸtirmesi" -#: coff-alpha.c:881 coff-alpha.c:918 +#: coff-alpha.c:881 coff-alpha.c:918 coff-alpha.c:1989 coff-mips.c:1432 msgid "GP relative relocation used when GP not defined" -msgstr "GP tanýmlanmamýþken GP göreli yer deðiþtirmesi kullanýlmýþ" +msgstr "GP tanımlanmamışken GP göreli yer deÄŸiÅŸtirmesi kullanılmış" #: coff-alpha.c:1485 msgid "using multiple gp values" -msgstr "birden fazla gp deðeri kullanýlýyor" +msgstr "birden fazla gp deÄŸeri kullanılıyor" -#: coff-alpha.c:1989 coff-mips.c:1433 -msgid "GP relative relocation when GP not defined" -msgstr "GP tanýmlanmamýþken GP göreli yer deðiþtirmesi" - -#: coff-arm.c:1051 elf32-arm.h:285 +#: coff-arm.c:1066 elf32-arm.h:285 #, c-format msgid "%s: unable to find THUMB glue '%s' for `%s'" -msgstr "%1$s: `%3$s' için THUMB birleþtiricisi '%2$s' bulunamadý " +msgstr "%1$s: `%3$s' için THUMB birleÅŸtiricisi '%2$s' bulunamadı " -#: coff-arm.c:1080 elf32-arm.h:320 +#: coff-arm.c:1096 elf32-arm.h:320 #, c-format msgid "%s: unable to find ARM glue '%s' for `%s'" -msgstr "%1$s: `%3$s' için ARM birleþtiricisi '%2$s' bulunamadý" +msgstr "%1$s: `%3$s' için ARM birleÅŸtiricisi '%2$s' bulunamadı" -#: coff-arm.c:1375 coff-arm.c:1470 elf32-arm.h:886 elf32-arm.h:990 +#: coff-arm.c:1391 coff-arm.c:1486 elf32-arm.h:887 elf32-arm.h:991 #, c-format msgid "%s(%s): warning: interworking not enabled." -msgstr "%s(%s): uyarý: beraber çalýþma kipi etkin deðil." +msgstr "%s(%s): uyarı: beraber çalışma kipi etkin deÄŸil." -#: coff-arm.c:1379 elf32-arm.h:993 +#: coff-arm.c:1395 elf32-arm.h:994 #, c-format msgid " first occurrence: %s: arm call to thumb" -msgstr " ilk ortaya çýkýþ: %s: thumb'a arm'dan çaðrý" +msgstr " ilk ortaya çıkış: %s: thumb'a arm'dan çaÄŸrı" -#: coff-arm.c:1474 elf32-arm.h:889 +#: coff-arm.c:1490 elf32-arm.h:890 #, c-format msgid " first occurrence: %s: thumb call to arm" -msgstr " ilk ortaya çýkýþ: %s: arm'a thumb'dan çaðrý" +msgstr " ilk ortaya çıkış: %s: arm'a thumb'dan çaÄŸrı" -#: coff-arm.c:1477 +#: coff-arm.c:1493 msgid " consider relinking with --support-old-code enabled" -msgstr " --support-old-code seçeneði ile yeniden baðlamayý deneyin" +msgstr " --support-old-code seçeneÄŸi ile yeniden baÄŸlamayı deneyin" -#: coff-arm.c:1767 coff-tic80.c:686 cofflink.c:3017 +#: coff-arm.c:1785 coff-tic80.c:686 cofflink.c:3031 #, c-format msgid "%s: bad reloc address 0x%lx in section `%s'" -msgstr "%1$s: `%3$s' bölümünde geçersiz yer deðiþtirme adresi 0x%2$lx" +msgstr "%1$s: `%3$s' bölümünde geçersiz yer deÄŸiÅŸtirme adresi 0x%2$lx" -#: coff-arm.c:2107 +#: coff-arm.c:2127 #, c-format msgid "%s: illegal symbol index in reloc: %d" -msgstr "%s: yer deðiþtirmede geçersiz sembol indeksi: %d" +msgstr "%s: yer deÄŸiÅŸtirmede geçersiz sembol indeksi: %d" -#: coff-arm.c:2235 +#: coff-arm.c:2255 #, c-format -msgid "%s: ERROR: compiled for APCS-%d whereas target %s uses APCS-%d" -msgstr "%s: HATA: APCS-%d için derlenmiþ fakat hedef %s APCS-%d kullanýyor" +msgid "ERROR: %s is compiled for APCS-%d, whereas %s is compiled for APCS-%d" +msgstr "Hata: %s APCS-%d için derlenmiÅŸ, fakat %s APCS-%d için derlenmiÅŸ" -#: coff-arm.c:2250 +#: coff-arm.c:2270 elf32-arm.h:2297 #, c-format -msgid "%s: ERROR: passes floats in float registers whereas target %s uses integer registers" -msgstr "%s: HATA: kayan sayýlarý kayan yazmaçlarda geçiriyor fakat hedef %s tamsayý yazmaç kullanýyor" +msgid "ERROR: %s passes floats in float registers, whereas %s passes them in integer registers" +msgstr "" +"Hata: %s kayan sayıları kayan sayı yazmaçlarında geçiriyor, \n" +" fakat %s tamsayı yazmaçlarında geçiriyor" -#: coff-arm.c:2253 +#: coff-arm.c:2273 elf32-arm.h:2302 #, c-format -msgid "%s: ERROR: passes floats in integer registers whereas target %s uses float registers" -msgstr "%s: HATA: kayan sayýlarý tamsayý yazmaçlarda geçiriyor fakat hedef %s kayan yazmaç kullanýyor" +msgid "ERROR: %s passes floats in integer registers, whereas %s passes them in float registers" +msgstr "" +"Hata: %s kayan sayıları tamsayı yazmaçlarında geçiriyor, \n" +" fakat %s kayan sayı yazmaçlarında geçiriyor" -#: coff-arm.c:2268 +#: coff-arm.c:2288 #, c-format -msgid "%s: ERROR: compiled as position independent code, whereas target %s is absolute position" -msgstr "%s: HATA: yerden baðýmsýz kod olarak derlendi, fakat hedef %s yere baðýmlý" +msgid "ERROR: %s is compiled as position independent code, whereas target %s is absolute position" +msgstr "HATA: %s yerden bağımsız kod olarak derlendi, fakat hedef %s yere bağımlı" -#: coff-arm.c:2271 +#: coff-arm.c:2291 #, c-format -msgid "%s: ERROR: compiled as absolute position code, whereas target %s is position independent" -msgstr "%s: HATA: yere baðýmlý kod olarak derlendi, fakat hedef %s yerden baðýmsýz" +msgid "ERROR: %s is compiled as absolute position code, whereas target %s is position independent" +msgstr "HATA: %s yere bağımlı kod olarak derlendi, fakat hedef %s yerden bağımsız" -#: coff-arm.c:2300 +#: coff-arm.c:2320 elf32-arm.h:2358 #, c-format -msgid "Warning: input file %s supports interworking, whereas %s does not." -msgstr "Uyarý: %s girdi dosyasý beraber çalýþmayý destekliyor, fakat %s desteklemiyor." +msgid "Warning: %s supports interworking, whereas %s does not" +msgstr "Uyarı: %s girdi dosyası beraber çalışmayı destekliyor, fakat %s desteklemiyor." -#: coff-arm.c:2303 +#: coff-arm.c:2323 elf32-arm.h:2365 #, c-format -msgid "Warning: input file %s does not support interworking, whereas %s does." -msgstr "Uyarý: %s girdi dosyasý beraber çalýþmayý desteklemiyor, fakat %s destekliyor." +msgid "Warning: %s does not support interworking, whereas %s does" +msgstr "Uyarı: %s girdi dosyası beraber çalışmayı desteklemiyor, fakat %s destekliyor." -#: coff-arm.c:2330 +#: coff-arm.c:2350 #, c-format msgid "private flags = %x:" -msgstr "özel bayraklar = %x:" +msgstr "özel bayraklar = %x:" -#: coff-arm.c:2338 elf32-arm.h:2408 +#: coff-arm.c:2358 elf32-arm.h:2418 msgid " [floats passed in float registers]" -msgstr " [kayan sayýlar kayan yazmaçlarda geçirildi]" +msgstr " [kayan sayılar kayan yazmaçlarda geçirildi]" -#: coff-arm.c:2340 +#: coff-arm.c:2360 msgid " [floats passed in integer registers]" -msgstr " [kayan sayýlar tamsayý yazmaçlarda geçirildi]" +msgstr " [kayan sayılar tamsayı yazmaçlarda geçirildi]" -#: coff-arm.c:2343 elf32-arm.h:2411 +#: coff-arm.c:2363 elf32-arm.h:2421 msgid " [position independent]" -msgstr " [yerden baðýmsýz]" +msgstr " [yerden bağımsız]" -#: coff-arm.c:2345 +#: coff-arm.c:2365 msgid " [absolute position]" -msgstr " [yere baðýmlý]" +msgstr " [yere bağımlı]" -#: coff-arm.c:2349 +#: coff-arm.c:2369 msgid " [interworking flag not initialised]" -msgstr " [beraber çalýþma bayraðýna öndeðer atanmamýþ]" +msgstr " [beraber çalışma bayrağına öndeÄŸer atanmamış]" -#: coff-arm.c:2351 +#: coff-arm.c:2371 msgid " [interworking supported]" -msgstr " [beraber çalýþma destekleniyor]" +msgstr " [beraber çalışma destekleniyor]" -#: coff-arm.c:2353 +#: coff-arm.c:2373 msgid " [interworking not supported]" -msgstr " [beraber çalýþma desteklenmiyor]" +msgstr " [beraber çalışma desteklenmiyor]" -#: coff-arm.c:2401 +#: coff-arm.c:2421 elf32-arm.h:2124 #, c-format -msgid "Warning: Not setting interworking flag of %s, since it has already been specified as non-interworking" -msgstr "Uyarý: %s beraber çalýþma bayraðý atanmadý, çünkü beraber çalýþma olmayacaðý önceden belirtilmiþ" +msgid "Warning: Not setting interworking flag of %s since it has already been specified as non-interworking" +msgstr "Uyarı: %s beraber çalışma bayrağı atanmadı, çünkü beraber çalışma olmayacağı önceden belirtilmiÅŸ" -#: coff-arm.c:2405 +#: coff-arm.c:2425 elf32-arm.h:2128 #, c-format msgid "Warning: Clearing the interworking flag of %s due to outside request" -msgstr "Uyarý: %s beraber çalýþma bayraðý dýþ istek üzerine temizlendi" +msgstr "Uyarı: %s beraber çalışma bayrağı dış istek üzerine temizlendi" #: coff-i960.c:136 coff-i960.c:485 msgid "uncertain calling convention for non-COFF symbol" -msgstr "COFF olmayan sembol için belirsiz çaðrý davranýþý" +msgstr "COFF olmayan sembol için belirsiz çaÄŸrı davranışı" -#: coff-m68k.c:481 coff-mips.c:2431 elf32-m68k.c:2212 +#: coff-m68k.c:481 coff-mips.c:2429 elf32-m68k.c:2157 elf32-mips.c:1844 msgid "unsupported reloc type" -msgstr "desteklenmeyen yer deðiþtirme türü" +msgstr "desteklenmeyen yer deÄŸiÅŸtirme türü" -#: coff-mips.c:875 elf32-mips.c:1987 elf64-mips.c:1739 +#: coff-mips.c:874 elf32-mips.c:1062 elf64-mips.c:1609 msgid "GP relative relocation when _gp not defined" -msgstr "_gp tanýmsýz iken GP göreli yer deðiþtirmesi" +msgstr "_gp tanımsız iken GP göreli yer deÄŸiÅŸtirmesi" #. No other sections should appear in -membedded-pic #. code. -#: coff-mips.c:2468 +#: coff-mips.c:2466 msgid "reloc against unsupported section" -msgstr "desteklenmeyen bölümde yer deðiþtirme" +msgstr "desteklenmeyen bölümde yer deÄŸiÅŸtirme" -#: coff-mips.c:2476 +#: coff-mips.c:2474 msgid "reloc not properly aligned" -msgstr "yer deðiþtirme doðru hizalanmamýþ" +msgstr "yer deÄŸiÅŸtirme doÄŸru hizalanmamış" -#: coff-rs6000.c:2710 coff64-rs6000.c:1164 +#: coff-rs6000.c:2766 #, c-format msgid "%s: unsupported relocation type 0x%02x" -msgstr "%s: desteklenmeyen yükleyici yerdeðiþimi 0x%02x" +msgstr "%s: desteklenmeyen yükleyici yerdeÄŸiÅŸimi 0x%02x" -#: coff-rs6000.c:2756 coff64-rs6000.c:1210 +#: coff-rs6000.c:2859 #, c-format msgid "%s: TOC reloc at 0x%x to symbol `%s' with no TOC entry" -msgstr "%s: 0x%x'da TOC girdisi olmayan `%s' sembolüne TOC yerdeðiþimi" +msgstr "%s: 0x%x'da TOC girdisi olmayan `%s' sembolüne TOC yerdeÄŸiÅŸimi" -#: coff-rs6000.c:3006 coff64-rs6000.c:2060 +#: coff-rs6000.c:3590 coff64-rs6000.c:2091 #, c-format msgid "%s: symbol `%s' has unrecognized smclas %d" -msgstr "%s: `%s' sembolünde bilinmeyen %d var" +msgstr "%s: `%s' sembolünde bilinmeyen %d var" #: coff-tic54x.c:279 coff-tic80.c:449 #, c-format msgid "Unrecognized reloc type 0x%x" -msgstr "Bilinmeyen yer deðiþtirme türü 0x%x" +msgstr "Bilinmeyen yer deÄŸiÅŸtirme türü 0x%x" -#: coff-tic54x.c:390 coffcode.h:4847 +#: coff-tic54x.c:390 coffcode.h:4974 #, c-format msgid "%s: warning: illegal symbol index %ld in relocs" -msgstr "%s: uyarý: yer deðiþtirmelerde geçersiz sembol indeksi %ld" +msgstr "%s: uyarı: yer deÄŸiÅŸtirmelerde geçersiz sembol indeksi %ld" #: coff-w65.c:363 #, c-format msgid "ignoring reloc %s\n" -msgstr "yer deðiþtirme %s yoksayýldý\n" +msgstr "yer deÄŸiÅŸtirme %s yoksayıldı\n" -#: coffcode.h:1081 +#: coffcode.h:1086 #, c-format msgid "%s (%s): Section flag %s (0x%x) ignored" -msgstr "%s (%s): Bölüm bayraðý %s (0x%x) yoksayýldý" +msgstr "%s (%s): Bölüm bayrağı %s (0x%x) yoksayıldı" -#: coffcode.h:2125 +#: coffcode.h:2143 #, c-format msgid "Unrecognized TI COFF target id '0x%x'" -msgstr "Tanýnmayan TI COFF hedef kimliði '0x%x'" +msgstr "Tanınmayan TI COFF hedef kimliÄŸi '0x%x'" -#: coffcode.h:4236 +#: coffcode.h:4365 #, c-format msgid "%s: warning: illegal symbol index %ld in line numbers" -msgstr "%s: uyarý: satýr numaralarýnda geçersiz sembol indeksi %ld" +msgstr "%s: uyarı: satır numaralarında geçersiz sembol indeksi %ld" -#: coffcode.h:4250 +#: coffcode.h:4379 #, c-format msgid "%s: warning: duplicate line number information for `%s'" -msgstr "%s: uyarý: `%s' için tekrarlanmýþ satýr numarasý bilgisi" +msgstr "%s: uyarı: `%s' için tekrarlanmış satır numarası bilgisi" -#: coffcode.h:4609 +#: coffcode.h:4736 #, c-format msgid "%s: Unrecognized storage class %d for %s symbol `%s'" -msgstr "%1$s: %3$s sembolü `%4$s' için bilinmeyen saklama sýnýfý %2$d" +msgstr "%1$s: %3$s sembolü `%4$s' için bilinmeyen saklama sınıfı %2$d" -#: coffcode.h:4740 +#: coffcode.h:4867 #, c-format msgid "warning: %s: local symbol `%s' has no section" -msgstr "uyarý: %s: `%s' yerel sembolünün bölümü yok" +msgstr "uyarı: %s: `%s' yerel sembolünün bölümü yok" -#: coffcode.h:4885 +#: coffcode.h:5012 #, c-format msgid "%s: illegal relocation type %d at address 0x%lx" -msgstr "%1$s: 0x%3$lx adresinde geçersiz yer deðiþtirme türü %2$d" +msgstr "%1$s: 0x%3$lx adresinde geçersiz yer deÄŸiÅŸtirme türü %2$d" #: coffgen.c:1661 #, c-format msgid "%s: bad string table size %lu" -msgstr "%s: geçersiz dizge tablo boyu %lu" +msgstr "%s: geçersiz dizge tablo boyu %lu" -#: coffgen.c:2138 -#, c-format -msgid "AUX tagndx %ld ttlsiz 0x%lx lnnos %ld next %ld" -msgstr "AUX tagndx %ld ttlsiz 0x%lx lnnos %ld sonraki %ld" - -#: cofflink.c:536 elflink.h:1967 +#: cofflink.c:534 elflink.h:1912 #, c-format msgid "Warning: type of symbol `%s' changed from %d to %d in %s" -msgstr "Uyarý: %4$s içerisinde `%1$s' sembolünün türü %2$d'den %3$d'e deðiþtirildi" +msgstr "Uyarı: %4$s içerisinde `%1$s' sembolünün türü %2$d'den %3$d'e deÄŸiÅŸtirildi" -#: cofflink.c:2317 +#: cofflink.c:2321 #, c-format msgid "%s: relocs in section `%s', but it has no contents" -msgstr "%s: `%s' bölümünde yer deðiþtirmeler mevcut, fakat içi boþ" +msgstr "%s: `%s' bölümünde yer deÄŸiÅŸtirmeler mevcut, fakat içi boÅŸ" -#: cofflink.c:2653 coffswap.h:889 +#: cofflink.c:2664 coffswap.h:877 #, c-format msgid "%s: %s: reloc overflow: 0x%lx > 0xffff" -msgstr "%s: %s: yer deðiþtirme taþmasý: 0x%lx > 0xffff" +msgstr "%s: %s: yer deÄŸiÅŸtirme taÅŸması: 0x%lx > 0xffff" -#: cofflink.c:2662 coffswap.h:876 +#: cofflink.c:2673 coffswap.h:864 #, c-format msgid "%s: warning: %s: line number overflow: 0x%lx > 0xffff" -msgstr "%s: uyarý: %s: satýr numarasý taþmasý: 0x%lx > 0xffff" +msgstr "%s: uyarı: %s: satır numarası taÅŸması: 0x%lx > 0xffff" -#: dwarf2.c:381 +#: dwarf2.c:382 msgid "Dwarf Error: Can't find .debug_str section." -msgstr "Dwarf Hatasý: .debug_str bölümü bulunamadý." +msgstr "Dwarf Hatası: .debug_str bölümü bulunamadı." -#: dwarf2.c:398 +#: dwarf2.c:399 #, c-format -msgid "Dwarf Error: DW_FORM_strp offset (%u) greater than or equal to .debug_str size (%u)." +msgid "Dwarf Error: DW_FORM_strp offset (%lu) greater than or equal to .debug_str size (%lu)." msgstr "" -"Dwarf Hatasý: DW_FORM_strp göreli konumu (%u) .debug_str boyutundan (%u) \n" -" daha büyük veya eþit." +"Dwarf Hatası: DW_FORM_strp göreli konumu (%lu) .debug_str boyutundan (%lu) \n" +" daha büyük veya eÅŸit." -#: dwarf2.c:542 +#: dwarf2.c:543 msgid "Dwarf Error: Can't find .debug_abbrev section." -msgstr "Dwarf Hatasý: .debug_abbrev bölümü bulunamadý." +msgstr "Dwarf Hatası: .debug_abbrev bölümü bulunamadı." -#: dwarf2.c:559 +#: dwarf2.c:560 #, c-format -msgid "Dwarf Error: Abbrev offset (%u) greater than or equal to abbrev size (%u)." +msgid "Dwarf Error: Abbrev offset (%lu) greater than or equal to .debug_abbrev size (%lu)." msgstr "" -"Dwarf Hatasý: Kýsaltma göreli konumu (%u) kýsaltma boyutundan (%u) \n" -" daha büyük veya eþit." +"Dwarf Hatası: Kısaltma göreli konumu (%lu) kısaltma boyutundan (%lu) \n" +" daha büyük veya eÅŸit." -#: dwarf2.c:756 +#: dwarf2.c:757 #, c-format -msgid "Dwarf Error: Invalid or unhandled FORM value: %d." -msgstr "Dwarf Hatasý: Geçersiz veya desteklenmeyen FORM deðeri: %d." +msgid "Dwarf Error: Invalid or unhandled FORM value: %u." +msgstr "Dwarf Hatası: Geçersiz veya desteklenmeyen FORM deÄŸeri: %u." -#: dwarf2.c:843 +#: dwarf2.c:852 msgid "Dwarf Error: mangled line number section (bad file number)." -msgstr "Dwarf Hatasý: bozulmuþ satýr numarasý bölümü (geçersiz dosya numarasý)." +msgstr "Dwarf Hatası: bozulmuÅŸ satır numarası bölümü (geçersiz dosya numarası)." -#: dwarf2.c:929 +#: dwarf2.c:938 msgid "Dwarf Error: Can't find .debug_line section." -msgstr "Dwarf Hatasý: .debug_line bölümü bulunamadý." +msgstr "Dwarf Hatası: .debug_line bölümü bulunamadı." -#: dwarf2.c:952 +#: dwarf2.c:961 #, c-format -msgid "Dwarf Error: Line offset (%u) greater than or equal to line size (%u)." +msgid "Dwarf Error: Line offset (%lu) greater than or equal to .debug_line size (%lu)." msgstr "" -"Dwarf Hatasý: Satýr göreli konumu (%u) satýr boyutundan (%u)\n" -" daha büyük veya eþit." +"Dwarf Hatası: Satır göreli konumu (%lu) satır boyutundan (%lu)\n" +" daha büyük veya eÅŸit." -#: dwarf2.c:1143 +#: dwarf2.c:1159 msgid "Dwarf Error: mangled line number section." -msgstr "Dwarf Hatasý: bozuk satýr numarasý bölümü." +msgstr "Dwarf Hatası: bozuk satır numarası bölümü." -#: dwarf2.c:1318 dwarf2.c:1532 +#: dwarf2.c:1355 dwarf2.c:1566 #, c-format -msgid "Dwarf Error: Could not find abbrev number %d." -msgstr "Dwarf Hatasý: Kýsaltma numarasý %d bulunamadý." +msgid "Dwarf Error: Could not find abbrev number %u." +msgstr "Dwarf Hatası: Kısaltma numarası %u bulunamadı." -#: dwarf2.c:1493 +#: dwarf2.c:1527 #, c-format -msgid "Dwarf Error: found dwarf version '%hu', this reader only handles version 2 information." -msgstr "Dwarf Hatasý: dwarf sürümü '%hu' bulundu, bu okuyucu yalnýzca sürüm 2 bilgisini anlayabiliyor." +msgid "Dwarf Error: found dwarf version '%u', this reader only handles version 2 information." +msgstr "Dwarf Hatası: dwarf sürümü '%u' bulundu, bu okuyucu yalnızca sürüm 2 bilgisini anlayabiliyor." -#: dwarf2.c:1500 +#: dwarf2.c:1534 #, c-format msgid "Dwarf Error: found address size '%u', this reader can not handle sizes greater than '%u'." -msgstr "Dwarf Hatasý: adres boyu '%u' bulundu, bu okuyucu '%u'dan daha büyük boylarý okuyamýyor." +msgstr "Dwarf Hatası: adres boyu '%u' bulundu, bu okuyucu '%u'dan daha büyük boyları okuyamıyor." -#: dwarf2.c:1523 +#: dwarf2.c:1557 #, c-format -msgid "Dwarf Error: Bad abbrev number: %d." -msgstr "Dwarf Hatasý: Geçersiz kýsaltma numarasý: %d." +msgid "Dwarf Error: Bad abbrev number: %u." +msgstr "Dwarf Hatası: Geçersiz kısaltma numarası: %u." -#: ecoff.c:1328 +#: ecoff.c:1318 #, c-format msgid "Unknown basic type %d" -msgstr "Bilinmeyen temel tür %d" +msgstr "Bilinmeyen temel tür %d" -#: ecoff.c:1597 +#: ecoff.c:1578 #, c-format -msgid "\n End+1 symbol: %ld" -msgstr "\n Son+1 sembolü: %ld" +msgid "" +"\n" +" End+1 symbol: %ld" +msgstr "" +"\n" +" Son+1 sembolü: %ld" -#: ecoff.c:1604 ecoff.c:1607 +#: ecoff.c:1585 ecoff.c:1588 #, c-format -msgid "\n First symbol: %ld" -msgstr "\n Ýlk sembol: %ld" +msgid "" +"\n" +" First symbol: %ld" +msgstr "" +"\n" +" Ä°lk sembol: %ld" -#: ecoff.c:1619 +#: ecoff.c:1600 #, c-format -msgid "\n End+1 symbol: %-7ld Type: %s" -msgstr "\n Son+1 sembolü: %-7ld Tür: %s" +msgid "" +"\n" +" End+1 symbol: %-7ld Type: %s" +msgstr "" +"\n" +" Son+1 sembolü: %-7ld Tür: %s" -#: ecoff.c:1626 +#: ecoff.c:1607 #, c-format -msgid "\n Local symbol: %ld" -msgstr "\n Yerel sembol: %ld" +msgid "" +"\n" +" Local symbol: %ld" +msgstr "" +"\n" +" Yerel sembol: %ld" -#: ecoff.c:1634 +#: ecoff.c:1615 #, c-format -msgid "\n struct; End+1 symbol: %ld" -msgstr "\n yapý; Son+1 sembolü: %ld" +msgid "" +"\n" +" struct; End+1 symbol: %ld" +msgstr "" +"\n" +" yapı; Son+1 sembolü: %ld" -#: ecoff.c:1639 +#: ecoff.c:1620 #, c-format -msgid "\n union; End+1 symbol: %ld" -msgstr "\n birleþim; Son+1 sembolü: %ld" +msgid "" +"\n" +" union; End+1 symbol: %ld" +msgstr "" +"\n" +" birleÅŸim; Son+1 sembolü: %ld" -#: ecoff.c:1644 +#: ecoff.c:1625 #, c-format -msgid "\n enum; End+1 symbol: %ld" -msgstr "\n enum; Son+1 sembolü: %ld" +msgid "" +"\n" +" enum; End+1 symbol: %ld" +msgstr "" +"\n" +" enum; Son+1 sembolü: %ld" -#: ecoff.c:1650 +#: ecoff.c:1631 #, c-format -msgid "\n Type: %s" -msgstr "\n Tür: %s" +msgid "" +"\n" +" Type: %s" +msgstr "" +"\n" +" Tür: %s" -#: elf-hppa.h:1366 elf-hppa.h:1399 elf32-ppc.c:3062 elf32-sh.c:3201 -#: elf64-x86-64.c:1275 +#: elf-hppa.h:1476 elf-hppa.h:1509 elf32-ppc.c:3091 elf32-sh.c:4213 +#: elf64-sh64.c:1659 #, c-format msgid "%s: warning: unresolvable relocation against symbol `%s' from %s section" -msgstr "%1$s: uyarý: %3$s bölümünden `%2$s' sembolüne çözümlenemeyen yer deðiþimi" +msgstr "%1$s: uyarı: %3$s bölümünden `%2$s' sembolüne çözümlenemeyen yer deÄŸiÅŸimi" -#: elf-m10200.c:463 elf-m10300.c:673 elf32-arm.h:2074 elf32-avr.c:835 -#: elf32-cris.c:1392 elf32-d10v.c:482 elf32-fr30.c:653 elf32-h8300.c:547 -#: elf32-i860.c:1048 elf32-m32r.c:1281 elf32-openrisc.c:455 elf32-v850.c:1691 -#: elf64-mmix.c:1164 +#: elf-m10200.c:446 elf-m10300.c:656 elf32-arm.h:2084 elf32-avr.c:833 +#: elf32-cris.c:1403 elf32-d10v.c:481 elf32-fr30.c:635 elf32-frv.c:809 +#: elf32-h8300.c:548 elf32-i860.c:1031 elf32-m32r.c:1278 elf32-openrisc.c:439 +#: elf32-v850.c:1691 elf32-xstormy16.c:933 elf64-mmix.c:1302 msgid "internal error: out of range error" -msgstr "iç hata: kapsam dýþý hatasý" +msgstr "iç hata: kapsam dışı hatası" -#: elf-m10200.c:467 elf-m10300.c:677 elf32-arm.h:2078 elf32-avr.c:839 -#: elf32-cris.c:1396 elf32-d10v.c:486 elf32-fr30.c:657 elf32-h8300.c:551 -#: elf32-i860.c:1052 elf32-m32r.c:1285 elf32-mips.c:7565 elf32-openrisc.c:459 -#: elf32-v850.c:1695 elf64-mips.c:4464 elf64-mmix.c:1168 +#: elf-m10200.c:450 elf-m10300.c:660 elf32-arm.h:2088 elf32-avr.c:837 +#: elf32-cris.c:1407 elf32-d10v.c:485 elf32-fr30.c:639 elf32-frv.c:813 +#: elf32-h8300.c:552 elf32-i860.c:1035 elf32-m32r.c:1282 elf32-openrisc.c:443 +#: elf32-v850.c:1695 elf32-xstormy16.c:937 elf64-mmix.c:1306 elfxx-mips.c:5264 msgid "internal error: unsupported relocation error" -msgstr "iç hata: desteklenmeyen yer deðiþim hatasý" +msgstr "iç hata: desteklenmeyen yer deÄŸiÅŸim hatası" -#: elf-m10200.c:471 elf-m10300.c:681 elf32-arm.h:2082 elf32-d10v.c:490 -#: elf32-h8300.c:555 elf32-m32r.c:1289 +#: elf-m10200.c:454 elf-m10300.c:664 elf32-arm.h:2092 elf32-d10v.c:489 +#: elf32-h8300.c:556 elf32-m32r.c:1286 msgid "internal error: dangerous error" -msgstr "iç hata: ölümcül hata" +msgstr "iç hata: ölümcül hata" -#: elf-m10200.c:475 elf-m10300.c:685 elf32-arm.h:2086 elf32-avr.c:847 -#: elf32-cris.c:1404 elf32-d10v.c:494 elf32-fr30.c:665 elf32-h8300.c:559 -#: elf32-i860.c:1060 elf32-m32r.c:1293 elf32-openrisc.c:467 elf32-v850.c:1715 -#: elf64-mmix.c:1176 +#: elf-m10200.c:458 elf-m10300.c:668 elf32-arm.h:2096 elf32-avr.c:845 +#: elf32-cris.c:1415 elf32-d10v.c:493 elf32-fr30.c:647 elf32-frv.c:821 +#: elf32-h8300.c:560 elf32-i860.c:1043 elf32-m32r.c:1290 elf32-openrisc.c:451 +#: elf32-v850.c:1715 elf32-xstormy16.c:945 elf64-mmix.c:1314 msgid "internal error: unknown error" -msgstr "iç hata: bilinmeyen hata" +msgstr "iç hata: bilinmeyen hata" -#: elf.c:345 +#: elf.c:343 #, c-format msgid "%s: invalid string offset %u >= %lu for section `%s'" -msgstr "%1$s: `%4$s' bölümünde geçersiz dizge göreli konumu %2$u >= %3$lu" +msgstr "%1$s: `%4$s' bölümünde geçersiz dizge göreli konumu %2$u >= %3$lu" -#: elf.c:450 +#: elf.c:589 #, c-format msgid "%s: invalid SHT_GROUP entry" -msgstr "%s: geçersiz SHT_GROUP girdisi" +msgstr "%s: geçersiz SHT_GROUP girdisi" -#: elf.c:531 +#: elf.c:660 #, c-format msgid "%s: no group info for section %s" -msgstr "%s: %s bölümünde grup bilgisi yok" +msgstr "%s: %s bölümünde grup bilgisi yok" -#: elf.c:842 -msgid "\nProgram Header:\n" -msgstr "\nYazýlým Baþlýðý:\n" +#: elf.c:1023 +msgid "" +"\n" +"Program Header:\n" +msgstr "" +"\n" +"Yazılım BaÅŸlığı:\n" -#: elf.c:891 -msgid "\nDynamic Section:\n" -msgstr "\nDinamik Bölüm:\n" +#: elf.c:1073 +msgid "" +"\n" +"Dynamic Section:\n" +msgstr "" +"\n" +"Dinamik Bölüm:\n" -#: elf.c:1020 -msgid "\nVersion definitions:\n" -msgstr "\nSürüm tanýmlarý:\n" +#: elf.c:1202 +msgid "" +"\n" +"Version definitions:\n" +msgstr "" +"\n" +"Sürüm tanımları:\n" -#: elf.c:1043 -msgid "\nVersion References:\n" -msgstr "\nSürüm Referanslarý:\n" +#: elf.c:1225 +msgid "" +"\n" +"Version References:\n" +msgstr "" +"\n" +"Sürüm Referansları:\n" -#: elf.c:1048 +#: elf.c:1230 #, c-format msgid " required from %s:\n" msgstr " %s'den isteniyor:\n" -#: elf.c:1675 +#: elf.c:1902 #, c-format msgid "%s: invalid link %lu for reloc section %s (index %u)" -msgstr "%1$s: yerdeðiþim bölümü %3$s (indeks %4$u) için geçersiz bað %2$lu" +msgstr "%1$s: yerdeÄŸiÅŸim bölümü %3$s (indeks %4$u) için geçersiz baÄŸ %2$lu" -#: elf.c:3289 +#: elf.c:3603 #, c-format msgid "%s: Not enough room for program headers (allocated %u, need %u)" -msgstr "%s: Yazýlým baþlýklarý için yeterli yer yok (%u ayrýldý, %u gerekli)" +msgstr "%s: Yazılım baÅŸlıkları için yeterli yer yok (%u ayrıldı, %u gerekli)" -#: elf.c:3393 +#: elf.c:3708 #, c-format msgid "%s: Not enough room for program headers, try linking with -N" -msgstr "%s: yazýlým baþlýklarý için gerekli yer yok, -N ile baðlamayý deneyin" +msgstr "%s: yazılım baÅŸlıkları için gerekli yer yok, -N ile baÄŸlamayı deneyin" -#: elf.c:3518 +#: elf.c:3833 #, c-format msgid "Error: First section in segment (%s) starts at 0x%x whereas the segment starts at 0x%x" -msgstr "Hata: Parçadaki (%s) ilk bölüm 0x%x'de, parça ise 0x%x'de baþlýyor" +msgstr "Hata: Parçadaki (%s) ilk bölüm 0x%x'de, parça ise 0x%x'de baÅŸlıyor" -#: elf.c:3804 +#: elf.c:4148 #, c-format msgid "%s: warning: allocated section `%s' not in segment" -msgstr "%s: uyarý: ayrýlmýþ `%s' bölümü parça içinde deðil" +msgstr "%s: uyarı: ayrılmış `%s' bölümü parça içinde deÄŸil" -#: elf.c:4138 +#: elf.c:4472 #, c-format msgid "%s: symbol `%s' required but not present" -msgstr "%s: `%s' sembolü gerekli fakat mevcut deðil" - -#: elf.c:4147 -#, c-format -msgid "elf_symbol_from_bfd_symbol 0x%.8lx, name = %s, sym num = %d, flags = 0x%.8lx%s\n" -msgstr "bfd sembolünden elf sembolü:0x%.8lx, isim= %s, sem num = %d, bayrak = 0x%.8lx%s\n" +msgstr "%s: `%s' sembolü gerekli fakat mevcut deÄŸil" -#: elf.c:4391 +#: elf.c:4749 #, c-format -msgid "%s: warning: Empty loadable segment detected\n" -msgstr "%s: uyarý: Boþ yüklenebilir parça bulundu\n" +msgid "%s: warning: Empty loadable segment detected, is this intentional ?\n" +msgstr "%s: uyarı: BoÅŸ yüklenebilir parça bulundu, bu isteyerek mi yapılıyor?\n" -#: elf.c:5804 +#: elf.c:6193 #, c-format msgid "%s: unsupported relocation type %s" -msgstr "%s: desteklenmeyen yerdeðiþim türü %s" +msgstr "%s: desteklenmeyen yerdeÄŸiÅŸim türü %s" -#: elf32-arm.h:1224 +#: elf32-arm.h:1221 #, c-format msgid "%s: Warning: Arm BLX instruction targets Arm function '%s'." -msgstr "%s: Uyarý: Arm BLX iþlemi Arm iþlevi '%s' hedefliyor." +msgstr "%s: Uyarı: Arm BLX iÅŸlemi Arm iÅŸlevi '%s' hedefliyor." -#: elf32-arm.h:1420 +#: elf32-arm.h:1417 #, c-format msgid "%s: Warning: Thumb BLX instruction targets thumb function '%s'." -msgstr "%s: Uyarý: Thumb BLX iþlemi thumb iþlevi '%s'ý hedefliyor." +msgstr "%s: Uyarı: Thumb BLX iÅŸlemi thumb iÅŸlevi '%s'ı hedefliyor." -#: elf32-arm.h:1904 elf32-i386.c:1776 elf32-sh.c:3133 +#: elf32-arm.h:1914 elf32-sh.c:4125 #, c-format msgid "%s(%s+0x%lx): %s relocation against SEC_MERGE section" -msgstr "%s(%s+0x%lx): SEC_MERGE bölümüne %s yerdeðiþimi" +msgstr "%s(%s+0x%lx): SEC_MERGE bölümüne %s yerdeÄŸiÅŸimi" -#: elf32-arm.h:1998 +#: elf32-arm.h:2008 #, c-format msgid "%s: warning: unresolvable relocation %d against symbol `%s' from %s section" -msgstr "%1$s: uyarý: %4$s bölümünden `%3$s' sembolüne çözümlenemeyen %2$d yer deðiþimi" +msgstr "%1$s: uyarı: %4$s bölümünden `%3$s' sembolüne çözümlenemeyen %2$d yer deÄŸiÅŸimi" -#: elf32-arm.h:2114 +#: elf32-arm.h:2176 #, c-format -msgid "Warning: Not setting interwork flag of %s since it has already been specified as non-interworking" -msgstr "Uyarý: beraber çalýþmaz diye önceden belirtilmiþ olduðundan %s'nin beraber çalýþma bayraðý atanmadý" +msgid "Warning: Clearing the interworking flag of %s because non-interworking code in %s has been linked with it" +msgstr "Uyarı: %2$s'deki beraber çalışmaz kod ona baÄŸlandığı için %1$s'nin beraber çalışma bayrağı temizlendi" -#: elf32-arm.h:2118 +#: elf32-arm.h:2271 #, c-format -msgid "Warning: Clearing the interwork flag of %s due to outside request" -msgstr "Uyarý: Dýþ isteðe uyularak %s'nin beraber çalýþma bayraðý temizlendi" +msgid "ERROR: %s is compiled for EABI version %d, whereas %s is compiled for version %d" +msgstr "Hata: %s EABI sürüm %d için derlenmiÅŸ, fakat %s %d sürümü için derlenmiÅŸ" -#: elf32-arm.h:2166 +#: elf32-arm.h:2285 #, c-format -msgid "Warning: Clearing the interwork flag in %s because non-interworking code in %s has been linked with it" -msgstr "Uyarý: %2$s'deki beraber çalýþmaz kod ona baðlandýðý için %1$s'nin beraber çalýþma bayraðý temizlendi" +msgid "ERROR: %s is compiled for APCS-%d, whereas target %s uses APCS-%d" +msgstr "HATA: %s, APCS-%d için derlenmiÅŸ fakat hedef %s APCS-%d kullanıyor" -#: elf32-arm.h:2261 +#: elf32-arm.h:2313 #, c-format -msgid "Error: %s compiled for EABI version %d, whereas %s is compiled for version %d" -msgstr "Hata: %s EABI sürüm %d için derlenmiþ, fakat %s %d sürümü için derlenmiþ" +msgid "ERROR: %s uses VFP instructions, whereas %s uses FPA instructions" +msgstr "Hata: %s VFP iÅŸlemi kullanıyor, fakat %s FPA iÅŸlemi kullanıyor" -#: elf32-arm.h:2275 +#: elf32-arm.h:2318 #, c-format -msgid "Error: %s compiled for APCS-%d, whereas %s is compiled for APCS-%d" -msgstr "Hata: %s APCS-%d için derlenmiþ, fakat %s APCS-%d için derlenmiþ" +msgid "ERROR: %s uses FPA instructions, whereas %s uses VFP instructions" +msgstr "Hata: %s FPA iÅŸlemi kullanıyor, fakat %s VFP iÅŸlemi kullanıyor" -#: elf32-arm.h:2287 +#: elf32-arm.h:2338 #, c-format -msgid "Error: %s passes floats in FP registers, whereas %s passes them in integer registers" +msgid "ERROR: %s uses software FP, whereas %s uses hardware FP" msgstr "" -"Hata: %s kayan sayýlarý kayan sayý yazmaçlarýnda geçiriyor, \n" -" fakat %s tamsayý yazmaçlarýnda geçiriyor" +"Hata: %s yazılımda kayan sayı kullanıyor,\n" +" fakat %s donanımda kayan sayı kullanıyor" -#: elf32-arm.h:2292 +#: elf32-arm.h:2343 #, c-format -msgid "Error: %s passes floats in integer registers, whereas %s passes them in FP registers" +msgid "ERROR: %s uses hardware FP, whereas %s uses software FP" msgstr "" -"Hata: %s kayan sayýlarý tamsayý yazmaçlarýnda geçiriyor, \n" -" fakat %s kayan sayý yazmaçlarýnda geçiriyor" - -#: elf32-arm.h:2303 -#, c-format -msgid "Error: %s uses VFP instructions, whereas %s FPA instructions" -msgstr "Hata: %s VFP iþlemi kullanýyor, fakat %s FPA iþlemi kullanýyor" - -#: elf32-arm.h:2308 -#, c-format -msgid "Error: %s uses FPA instructions, whereas %s VFP instructions" -msgstr "Hata: %s FPA iþlemi kullanýyor, fakat %s VFP iþlemi kullanýyor" - -#: elf32-arm.h:2328 -#, c-format -msgid "Error: %s uses software FP, whereas %s uses hardware FP" -msgstr "" -"Hata: %s yazýlýmda kayan sayý kullanýyor,\n" -" fakat %s donanýmda kayan sayý kullanýyor" - -#: elf32-arm.h:2333 -#, c-format -msgid "Error: %s uses hardware FP, whereas %s uses software FP" -msgstr "" -"Hata: %s donanýmda kayan sayý kullanýyor,\n" -" fakat %s yazýlýmda kayan sayý kullanýyor" - -#: elf32-arm.h:2348 -#, c-format -msgid "Warning: %s supports interworking, whereas %s does not" -msgstr "Uyarý: %s girdi dosyasý beraber çalýþmayý destekliyor, fakat %s desteklemiyor." - -#: elf32-arm.h:2355 -#, c-format -msgid "Warning: %s does not support interworking, whereas %s does" -msgstr "Uyarý: %s girdi dosyasý beraber çalýþmayý desteklemiyor, fakat %s destekliyor." +"Hata: %s donanımda kayan sayı kullanıyor,\n" +" fakat %s yazılımda kayan sayı kullanıyor" #. Ignore init flag - it may not be set, despite the flags field #. containing valid data. -#: elf32-arm.h:2386 elf32-cris.c:2970 elf32-m68k.c:410 elf32-mips.c:3232 +#: elf32-arm.h:2396 elf32-cris.c:2988 elf32-m68k.c:410 elf32-vax.c:543 +#: elfxx-mips.c:7756 #, c-format msgid "private flags = %lx:" -msgstr "özel bayraklar = %lx:" +msgstr "özel bayraklar = %lx:" -#: elf32-arm.h:2395 +#: elf32-arm.h:2405 msgid " [interworking enabled]" -msgstr " [beraber çalýþma etkinleþtirilmiþ]" - -#: elf32-arm.h:2398 -msgid " [APCS-26]" -msgstr " [APCS-26]" +msgstr " [beraber çalışma etkinleÅŸtirilmiÅŸ]" -#: elf32-arm.h:2400 -msgid " [APCS-32]" -msgstr " [APCS-32]" - -#: elf32-arm.h:2403 +#: elf32-arm.h:2413 msgid " [VFP float format]" -msgstr " [VFP kayan nokta biçemi]" +msgstr " [VFP kayan nokta biçemi]" -#: elf32-arm.h:2405 +#: elf32-arm.h:2415 msgid " [FPA float format]" -msgstr " [FPA kayan nokta biçemi]" +msgstr " [FPA kayan nokta biçemi]" -#: elf32-arm.h:2414 +#: elf32-arm.h:2424 msgid " [new ABI]" msgstr " [yeni ABI]" -#: elf32-arm.h:2417 +#: elf32-arm.h:2427 msgid " [old ABI]" msgstr " [eski ABI]" -#: elf32-arm.h:2420 +#: elf32-arm.h:2430 msgid " [software FP]" -msgstr " [yazýlým FP]" +msgstr " [yazılım FP]" -#: elf32-arm.h:2428 +#: elf32-arm.h:2438 msgid " [Version1 EABI]" -msgstr " [Sürüm1 EABI]" +msgstr " [Sürüm1 EABI]" -#: elf32-arm.h:2431 elf32-arm.h:2442 +#: elf32-arm.h:2441 elf32-arm.h:2452 msgid " [sorted symbol table]" -msgstr " [sýralanmýþ sembol tablosu]" +msgstr " [sıralanmış sembol tablosu]" -#: elf32-arm.h:2433 elf32-arm.h:2444 +#: elf32-arm.h:2443 elf32-arm.h:2454 msgid " [unsorted symbol table]" -msgstr " [sýralanmamýþ sembol tablosu]" +msgstr " [sıralanmamış sembol tablosu]" -#: elf32-arm.h:2439 +#: elf32-arm.h:2449 msgid " [Version2 EABI]" -msgstr " [Sürüm2 EABI]" +msgstr " [Sürüm2 EABI]" -#: elf32-arm.h:2447 +#: elf32-arm.h:2457 msgid " [dynamic symbols use segment index]" -msgstr " [dinamik semboller bölüm indeksini kullanýyor]" +msgstr " [dinamik semboller bölüm indeksini kullanıyor]" -#: elf32-arm.h:2450 +#: elf32-arm.h:2460 msgid " [mapping symbols precede others]" -msgstr " [eþleþme sembolleri diðerlerinden önceliklidir]" +msgstr " [eÅŸleÅŸme sembolleri diÄŸerlerinden önceliklidir]" -#: elf32-arm.h:2457 +#: elf32-arm.h:2467 msgid " " -msgstr " " +msgstr " " -#: elf32-arm.h:2464 +#: elf32-arm.h:2474 msgid " [relocatable executable]" -msgstr " [yer deðiþtirebilir uygulama]" +msgstr " [yer deÄŸiÅŸtirebilir uygulama]" -#: elf32-arm.h:2467 +#: elf32-arm.h:2477 msgid " [has entry point]" -msgstr " [girdi noktasý var]" +msgstr " [girdi noktası var]" -#: elf32-arm.h:2472 +#: elf32-arm.h:2482 msgid "" -msgstr "" +msgstr "" -#: elf32-avr.c:843 elf32-cris.c:1400 elf32-fr30.c:661 elf32-i860.c:1056 -#: elf32-openrisc.c:463 elf32-v850.c:1699 elf64-mmix.c:1172 +#: elf32-avr.c:841 elf32-cris.c:1411 elf32-fr30.c:643 elf32-frv.c:817 +#: elf32-i860.c:1039 elf32-openrisc.c:447 elf32-v850.c:1699 +#: elf32-xstormy16.c:941 elf64-mmix.c:1310 msgid "internal error: dangerous relocation" -msgstr "iç hata: tehlikeli yer deðiþim" +msgstr "iç hata: tehlikeli yer deÄŸiÅŸim" #: elf32-cris.c:949 #, c-format msgid "%s: unresolvable relocation %s against symbol `%s' from %s section" -msgstr "%1$s: uyarý: %4$s bölümünden `%3$s' sembolüne çözümlenemeyen %2$s yer deðiþimi" +msgstr "%1$s: uyarı: %4$s bölümünden `%3$s' sembolüne çözümlenemeyen %2$s yer deÄŸiÅŸimi" #: elf32-cris.c:1012 #, c-format msgid "%s: No PLT nor GOT for relocation %s against symbol `%s' from %s section" -msgstr "%1$s: %4$s bölümünden `%3$s' sembolüne %2$s yer deðiþimi için PLT veya GOT yok" +msgstr "%1$s: %4$s bölümünden `%3$s' sembolüne %2$s yer deÄŸiÅŸimi için PLT veya GOT yok" -#: elf32-cris.c:1015 elf32-cris.c:1142 +#: elf32-cris.c:1015 elf32-cris.c:1141 msgid "[whose name is lost]" -msgstr "[adý kaybolmuþ]" +msgstr "[adı kaybolmuÅŸ]" -#: elf32-cris.c:1131 +#: elf32-cris.c:1130 #, c-format msgid "%s: relocation %s with non-zero addend %d against local symbol from %s section" msgstr "" -"%1$s: %4$s bölümünden yerel sembol sýfýr olmayan %3$d eklemesi ile\n" -" %2$s yerdeðiþimi" +"%1$s: %4$s bölümünden yerel sembol sıfır olmayan %3$d eklemesi ile\n" +" %2$s yerdeÄŸiÅŸimi" -#: elf32-cris.c:1138 +#: elf32-cris.c:1137 #, c-format msgid "%s: relocation %s with non-zero addend %d against symbol `%s' from %s section" -msgstr "%1$s: %5$s bölümünden `%4$s' sembolüne sýfýr olmayan %3$d eklemesi ile %2$s yerdeðiþimi" +msgstr "%1$s: %5$s bölümünden `%4$s' sembolüne sıfır olmayan %3$d eklemesi ile %2$s yerdeÄŸiÅŸimi" -#: elf32-cris.c:1156 +#: elf32-cris.c:1155 #, c-format msgid "%s: relocation %s is not allowed for global symbol: `%s' from %s section" -msgstr "%1$s: %4$s bölümünden %3$s evrensel sembolü için %2$s yerdeðiþimi yapýlamaz" +msgstr "%1$s: %4$s bölümünden %3$s evrensel sembolü için %2$s yerdeÄŸiÅŸimi yapılamaz" -#: elf32-cris.c:1275 +#: elf32-cris.c:1170 +#, c-format +msgid "%s: relocation %s in section %s with no GOT created" +msgstr "%1$s: `%3$s' bölümünde %2$s yer deÄŸiÅŸtirmesi mevcut, fakat GOT oluÅŸturulmamış" + +#: elf32-cris.c:1288 #, c-format msgid "%s: Internal inconsistency; no relocation section %s" -msgstr "%s: Ýç tutarsýzlýk; %s yerdeðiþim bölümü yok" +msgstr "%s: İç tutarsızlık; %s yerdeÄŸiÅŸim bölümü yok" -#: elf32-cris.c:2508 +#: elf32-cris.c:2514 #, c-format msgid "" "%s, section %s:\n" " relocation %s should not be used in a shared object; recompile with -fPIC" msgstr "" -"%s, %s bölümü:\n" -" %s yer deðiþimi paylaþýmlý nesne oluþtururken kullanýlamaz;\n" +"%s, %s bölümü:\n" +" %s yer deÄŸiÅŸimi paylaşımlı nesne oluÅŸtururken kullanılamaz;\n" " -fPIC ile yeniden derleyin" -#: elf32-cris.c:2973 +#: elf32-cris.c:2991 msgid " [symbols have a _ prefix]" -msgstr " [semboller _ önekine sahip]" +msgstr " [semboller _ önekine sahip]" -#: elf32-cris.c:3012 +#: elf32-cris.c:3030 #, c-format msgid "%s: uses _-prefixed symbols, but writing file with non-prefixed symbols" -msgstr "%s: _-önekli sembolleri kullanýyor, fakat dosyaya öneksiz sembolleri yazýyor" +msgstr "%s: _-önekli sembolleri kullanıyor, fakat dosyaya öneksiz sembolleri yazıyor" -#: elf32-cris.c:3013 +#: elf32-cris.c:3031 #, c-format msgid "%s: uses non-prefixed symbols, but writing file with _-prefixed symbols" -msgstr "%s: öneksiz sembolleri kullanýyor, fakat dosyaya _-önekli sembolleri yazýyor" +msgstr "%s: öneksiz sembolleri kullanıyor, fakat dosyaya _-önekli sembolleri yazıyor" + +#: elf32-frv.c:1217 +#, c-format +msgid "%s: compiled with %s and linked with modules that use non-pic relocations" +msgstr "%s: %s ile derlendi ve normal derlenmiÅŸ modüllerle baÄŸlandı" + +#: elf32-frv.c:1267 +#, c-format +msgid "%s: compiled with %s and linked with modules compiled with %s" +msgstr "%s: %s ile derlendi ve %s ile derlenmiÅŸ modüllerle baÄŸlandı" + +#: elf32-frv.c:1279 +#, c-format +msgid "%s: uses different unknown e_flags (0x%lx) fields than previous modules (0x%lx)" +msgstr "%s: önceki modüllerden farklı bilinmeyen e_flags (0x%lx) alanları kullanılıyor (0x%lx)" + +#: elf32-frv.c:1315 +#, c-format +msgid "private flags = 0x%lx:" +msgstr "özel bayraklar = 0x%lx:" #: elf32-gen.c:82 elf64-gen.c:82 #, c-format msgid "%s: Relocations in generic ELF (EM: %d)" -msgstr "%s: Normal ELF'de yerdeðiþimler (EM: %d)" +msgstr "%s: Normal ELF'de yerdeÄŸiÅŸimler (EM: %d)" -#: elf32-hppa.c:646 +#: elf32-hppa.c:671 elf64-ppc.c:2323 #, c-format msgid "%s: cannot create stub entry %s" -msgstr "%s: koçan giriþi %s oluþturulamadý" +msgstr "%s: koçan giriÅŸi %s oluÅŸturulamadı" -#: elf32-hppa.c:937 elf32-hppa.c:3540 +#: elf32-hppa.c:956 elf32-hppa.c:3555 #, c-format msgid "%s(%s+0x%lx): cannot reach %s, recompile with -ffunction-sections" -msgstr "%s(%s+0x%lx): %s'e ulaþýlamadý, -ffunction-sections ile derleyin" +msgstr "%s(%s+0x%lx): %s'e ulaşılamadı, -ffunction-sections ile derleyin" -#: elf32-hppa.c:1312 +#: elf32-hppa.c:1338 elf64-x86-64.c:673 #, c-format msgid "%s: relocation %s can not be used when making a shared object; recompile with -fPIC" -msgstr "%s: %s yer deðiþimi paylaþýmlý nesne oluþturulurken kullanýlamaz; -fPIC ile yeniden derleyin" +msgstr "%s: %s yer deÄŸiÅŸimi paylaşımlı nesne oluÅŸturulurken kullanılamaz; -fPIC ile yeniden derleyin" -#: elf32-hppa.c:1332 +#: elf32-hppa.c:1358 #, c-format msgid "%s: relocation %s should not be used when making a shared object; recompile with -fPIC" -msgstr "%s: %s yer deðiþimi paylaþýmlý nesne oluþtururken kullanýlamaz; -fPIC ile yeniden derleyin" +msgstr "%s: %s yer deÄŸiÅŸimi paylaşımlı nesne oluÅŸtururken kullanılamaz; -fPIC ile yeniden derleyin" -#: elf32-hppa.c:1525 +#: elf32-hppa.c:1551 #, c-format msgid "Could not find relocation section for %s" -msgstr "%s için yer deðiþtirme bölümü bulunamadý" +msgstr "%s için yer deÄŸiÅŸtirme bölümü bulunamadı" -#: elf32-hppa.c:2862 +#: elf32-hppa.c:2855 #, c-format msgid "%s: duplicate export stub %s" -msgstr "%s: birden fazla ihraç koçaný %s" +msgstr "%s: birden fazla ihraç koçanı %s" -#: elf32-hppa.c:3424 +#: elf32-hppa.c:3433 #, c-format msgid "%s(%s+0x%lx): fixing %s" -msgstr "%s(%s+0x%lx): %s düzeltiliyor" +msgstr "%s(%s+0x%lx): %s düzeltiliyor" -#: elf32-hppa.c:4064 +#: elf32-hppa.c:4080 #, c-format msgid "%s(%s+0x%lx): cannot handle %s for %s" -msgstr "%1$s(%2$s+0x%3$lx): %5$s için %4$s iþlenemedi" +msgstr "%1$s(%2$s+0x%3$lx): %5$s için %4$s iÅŸlenemedi" -#: elf32-hppa.c:4403 +#: elf32-hppa.c:4393 msgid ".got section not immediately after .plt section" -msgstr ".got bölümü .plt bölümünün hemen arkasýnda deðil" +msgstr ".got bölümü .plt bölümünün hemen arkasında deÄŸil" -#: elf32-i386.c:298 +#: elf32-i386.c:379 #, c-format msgid "%s: invalid relocation type %d" -msgstr "%s: geçersiz yer deðiþim türü %d" +msgstr "%s: geçersiz yer deÄŸiÅŸim türü %d" -#: elf32-i386.c:718 elf32-s390.c:636 elf64-s390.c:595 +#: elf32-i386.c:876 elf32-s390.c:649 elf64-s390.c:595 elf64-x86-64.c:591 #, c-format msgid "%s: bad symbol index: %d" -msgstr "%s: geçersiz sembol indeksi: %d" +msgstr "%s: geçersiz sembol indeksi: %d" + +#: elf32-i386.c:948 +#, c-format +msgid "%s: `%s' accessed both as normal and thread local symbol" +msgstr "%s: `%s'a hem normal, hem de dal yerel sembolü olarak eriÅŸildi" -#: elf32-i386.c:863 elf32-s390.c:790 elf64-ppc.c:2085 elf64-s390.c:759 +#: elf32-i386.c:1072 elf32-s390.c:808 elf64-ppc.c:2827 elf64-s390.c:759 +#: elf64-x86-64.c:761 #, c-format msgid "%s: bad relocation section name `%s'" -msgstr "%s: geçersiz yerdeðiþim bölümü adý `%s'" +msgstr "%s: geçersiz yerdeÄŸiÅŸim bölümü adı `%s'" + +#: elf32-i386.c:1159 elf64-alpha.c:4768 +#, c-format +msgid "%s: TLS local exec code cannot be linked into shared objects" +msgstr "%s: TLS yerel çalıştırma kodu paylaşımlı nesnelere baÄŸlanamaz" -#: elf32-i386.c:2067 elf32-s390.c:1949 elf64-ppc.c:3908 elf64-s390.c:1953 +#: elf32-i386.c:2747 elf32-s390.c:1981 elf32-sparc.c:1571 elf64-ppc.c:5918 +#: elf64-s390.c:1945 elf64-sparc.c:2578 elf64-x86-64.c:1948 #, c-format msgid "%s(%s+0x%lx): unresolvable relocation against symbol `%s'" -msgstr "%s(%s+0x%lx): `%s' sembolüne çözümlenemeyen yer deðiþimi" +msgstr "%s(%s+0x%lx): `%s' sembolüne çözümlenemeyen yer deÄŸiÅŸimi" -#: elf32-i386.c:2105 elf32-s390.c:1987 elf64-s390.c:1991 +#: elf32-i386.c:2784 elf32-s390.c:2019 elf64-ppc.c:5977 elf64-s390.c:1983 +#: elf64-x86-64.c:1986 #, c-format msgid "%s(%s+0x%lx): reloc against `%s': error %d" -msgstr "%s(%s+0x%lx): %s'e yer deðiþimi: %d hatasý" +msgstr "%s(%s+0x%lx): %s'e yer deÄŸiÅŸimi: %d hatası" #: elf32-m32r.c:924 msgid "SDA relocation when _SDA_BASE_ not defined" -msgstr "_SDA_BASE_ tanýmlanmamýþ iken SDA yer deðiþimi" +msgstr "_SDA_BASE_ tanımlanmamış iken SDA yer deÄŸiÅŸimi" -#: elf32-ia64.c:3538 elf32-m32r.c:1008 elf32-ppc.c:2930 elf64-ia64.c:3538 +#: elf32-ia64.c:3687 elf32-m32r.c:1013 elf32-ppc.c:2987 elf64-alpha.c:4185 +#: elf64-alpha.c:4313 elf64-ia64.c:3687 #, c-format msgid "%s: unknown relocation type %d" -msgstr "%s: bilinmeyen yer deðiþim türü %d" +msgstr "%s: bilinmeyen yer deÄŸiÅŸim türü %d" -#: elf32-m32r.c:1224 +#: elf32-m32r.c:1221 #, c-format msgid "%s: The target (%s) of an %s relocation is in the wrong section (%s)" -msgstr "%1$s: Bir %3$s yer deðiþiminin hedefi (%2$s) yanlýþ bölümde (%4$s)" +msgstr "%1$s: Bir %3$s yer deÄŸiÅŸiminin hedefi (%2$s) yanlış bölümde (%4$s)" -#: elf32-m32r.c:2001 +#: elf32-m32r.c:1947 #, c-format msgid "%s: Instruction set mismatch with previous modules" -msgstr "%s: Önceki modüllerle iþlem uyuþmazlýðý" +msgstr "%s: Önceki modüllerle iÅŸlem uyuÅŸmazlığı" -#: elf32-m32r.c:2024 +#: elf32-m32r.c:1970 #, c-format msgid "private flags = %lx" -msgstr "özel bayraklar = %lx" +msgstr "özel bayraklar = %lx" -#: elf32-m32r.c:2029 +#: elf32-m32r.c:1975 msgid ": m32r instructions" -msgstr ": m32r iþlemleri" +msgstr ": m32r iÅŸlemleri" -#: elf32-m32r.c:2030 +#: elf32-m32r.c:1976 msgid ": m32rx instructions" -msgstr ": m32rx iþlemleri" +msgstr ": m32rx iÅŸlemleri" #: elf32-m68k.c:413 msgid " [cpu32]" msgstr " [cpu32]" -#: elf32-mcore.c:353 elf32-mcore.c:479 +#: elf32-m68k.c:416 +msgid " [m68000]" +msgstr " [m68000]" + +#: elf32-mcore.c:354 elf32-mcore.c:457 #, c-format msgid "%s: Relocation %s (%d) is not currently supported.\n" -msgstr "%s: %s (%d) yer deðiþimi henüz desteklenmiyor.\n" +msgstr "%s: %s (%d) yer deÄŸiÅŸimi henüz desteklenmiyor.\n" -#: elf32-mcore.c:438 +#: elf32-mcore.c:442 #, c-format msgid "%s: Unknown relocation type %d\n" -msgstr "%s: Bilinmeyen yer deðiþim türü %d\n" +msgstr "%s: Bilinmeyen yer deÄŸiÅŸim türü %d\n" -#: elf32-mips.c:2146 elf64-mips.c:1972 +#: elf32-mips.c:1152 elf64-mips.c:1783 msgid "32bits gp relative relocation occurs for an external symbol" -msgstr "32 bitlik gp göreceli yer deðiþim bir dýþ sembol için yapýlýyor" +msgstr "32 bitlik gp göreceli yer deÄŸiÅŸim bir dış sembol için yapılıyor" -#: elf32-mips.c:2295 +#: elf32-mips.c:1301 #, c-format msgid "Linking mips16 objects into %s format is not supported" -msgstr "mips16 nesnelerini %s biçemine baðlamak desteklenmiyor" +msgstr "mips16 nesnelerini %s biçemine baÄŸlamak desteklenmiyor" -#: elf32-mips.c:3119 +#: elf32-ppc.c:1460 #, c-format -msgid "%s: linking PIC files with non-PIC files" -msgstr "%s: PIC dosyalarý PIC olmayan dosyalarla baðlanýyor" +msgid "%s: compiled with -mrelocatable and linked with modules compiled normally" +msgstr "%s: -mrelocatable ile derlendi ve normal derlenmiÅŸ modüllerle baÄŸlandı" -#: elf32-mips.c:3129 +#: elf32-ppc.c:1468 #, c-format -msgid "%s: linking abicalls files with non-abicalls files" -msgstr "%s: abicalls dosyalarý abicalls olmayan dosyalarla baðlanýyor" +msgid "%s: compiled normally and linked with modules compiled with -mrelocatable" +msgstr "%s: normal derlendi ve -mrelocatable ile derlenmiÅŸ modüllere baÄŸlandı" -#: elf32-mips.c:3158 +#: elf32-ppc.c:1494 elf64-sparc.c:2989 elfxx-mips.c:7713 #, c-format -msgid "%s: ISA mismatch (-mips%d) with previous modules (-mips%d)" -msgstr "%1$s: Önceki modüllerle (-mips%3$d) ile ISA uyumsuzluðu (-mips%2$d)" +msgid "%s: uses different e_flags (0x%lx) fields than previous modules (0x%lx)" +msgstr "%1$s: önceki modüllerden (0x%3$lx) farklı e_flags (0x%2$lx) alanları kullanılıyor" -#: elf32-mips.c:3167 +#: elf32-ppc.c:1592 #, c-format -msgid "%s: ISA mismatch (%d) with previous modules (%d)" -msgstr "%1$s: Önceki modüllerle (%3$d) ile ISA uyumsuzluðu (%2$d)" +msgid "%s: Unknown special linker type %d" +msgstr "%s: Bilinmeyen özel baÄŸlayıcı türü %d" -#: elf32-mips.c:3190 +#: elf32-ppc.c:2273 elf32-ppc.c:2307 elf32-ppc.c:2342 #, c-format -msgid "%s: ABI mismatch: linking %s module with previous %s modules" -msgstr "%s: ABI uyumsuzluðu: %s modülü önceki %s modülle baðlanýyor" +msgid "%s: relocation %s cannot be used when making a shared object" +msgstr "%s: %s yerdeÄŸiÅŸimi paylaşımlı nesne oluÅŸturulurken kullanılamaz" -#: elf32-mips.c:3204 elf32-ppc.c:1470 elf64-ppc.c:1538 elf64-sparc.c:3033 +#: elf32-ppc.c:3126 elf64-ppc.c:5473 #, c-format -msgid "%s: uses different e_flags (0x%lx) fields than previous modules (0x%lx)" -msgstr "%1$s: önceki modüllerden (0x%3$lx) farklý e_flags (0x%2$lx) alanlarý kullanýlýyor" - -#: elf32-mips.c:3235 -msgid " [abi=O32]" -msgstr " [abi=O32]" - -#: elf32-mips.c:3237 -msgid " [abi=O64]" -msgstr " [abi=O64]" - -#: elf32-mips.c:3239 -msgid " [abi=EABI32]" -msgstr " [abi=EABI32]" - -#: elf32-mips.c:3241 -msgid " [abi=EABI64]" -msgstr " [abi=EABI64]" - -#: elf32-mips.c:3243 -msgid " [abi unknown]" -msgstr " [abi bilinmiyor]" - -#: elf32-mips.c:3245 -msgid " [abi=N32]" -msgstr " [abi=N32]" - -#: elf32-mips.c:3247 -msgid " [abi=64]" -msgstr " [abi=64]" - -#: elf32-mips.c:3249 -msgid " [no abi set]" -msgstr " [abi atanmamýþ]" - -#: elf32-mips.c:3252 -msgid " [mips1]" -msgstr " [mips1]" - -#: elf32-mips.c:3254 -msgid " [mips2]" -msgstr " [mips2]" - -#: elf32-mips.c:3256 -msgid " [mips3]" -msgstr " [mips3]" - -#: elf32-mips.c:3258 -msgid " [mips4]" -msgstr " [mips4]" - -#: elf32-mips.c:3260 -msgid " [mips5]" -msgstr " [mips5]" - -#: elf32-mips.c:3262 -msgid " [mips32]" -msgstr " [mips32]" - -#: elf32-mips.c:3264 -msgid " [mips64]" -msgstr " [mips64]" - -#: elf32-mips.c:3266 -msgid " [unknown ISA]" -msgstr " [bilinmeyen ISA]" - -#: elf32-mips.c:3269 -msgid " [32bitmode]" -msgstr " [32bitkipi]" - -#: elf32-mips.c:3271 -msgid " [not 32bitmode]" -msgstr " [32bitkipi deðil]" - -#: elf32-mips.c:4947 -msgid "static procedure (no name)" -msgstr "statik altyordam (isimsiz)" +msgid "%s: unknown relocation type %d for symbol %s" +msgstr "%1$s: %3$s sembolü için bilinmeyen %2$d türünde yerdeÄŸiÅŸimi" -#: elf32-mips.c:5565 elf64-mips.c:6694 +#: elf32-ppc.c:3482 elf32-ppc.c:3503 elf32-ppc.c:3553 #, c-format -msgid "%s: illegal section name `%s'" -msgstr "%s: geçersiz bölüm adý `%s'" - -#: elf32-mips.c:6132 elf64-mips.c:3150 -msgid "not enough GOT space for local GOT entries" -msgstr "yerel GOT girdileri için yeterli GOT yeri yok" +msgid "%s: The target (%s) of a %s relocation is in the wrong output section (%s)" +msgstr "%1$s: %3$s yerdeÄŸiÅŸiminin hedefi (%2$s) yanlış çıktı bölümünde (%4$s)" -#: elf32-mips.c:7238 elf64-mips.c:4203 +#: elf32-ppc.c:3619 #, c-format -msgid "%s: %s+0x%lx: jump to stub routine which is not jal" -msgstr "%s: %s+0x%lx: jal olmayan koçan yordamýna sýçrama" +msgid "%s: Relocation %s is not yet supported for symbol %s." +msgstr "%s: %s yerdeÄŸiÅŸimi %s sembolü için henüz desteklenmiyor." -#: elf32-mips.c:8237 elf64-mips.c:5891 +#: elf32-sh.c:1964 #, c-format -msgid "%s: Malformed reloc detected for section %s" -msgstr "%s: %s bölümü için geçersiz yer deðiþim bulundu" +msgid "%s: 0x%lx: warning: bad R_SH_USES offset" +msgstr "%s: 0x%lx: uyarı: hatalı R_SH_USES göreli konumu" -#: elf32-mips.c:8315 elf64-mips.c:5969 +#: elf32-sh.c:1976 #, c-format -msgid "%s: CALL16 reloc at 0x%lx not against global symbol" -msgstr "%s: 0x%lx'deki CALL16 yerdeðiþimi evrensel sembole göre deðil" +msgid "%s: 0x%lx: warning: R_SH_USES points to unrecognized insn 0x%x" +msgstr "%s: 0x%lx: uyarı: R_SH_USES bilinmeyen insn 0x%x'ı imliyor" -#: elf32-ppc.c:1436 elf64-ppc.c:1503 +#: elf32-sh.c:1993 #, c-format -msgid "%s: compiled with -mrelocatable and linked with modules compiled normally" -msgstr "%s: -mrelocatable ile derlendi ve normal derlenmiþ modüllerle baðlandý" +msgid "%s: 0x%lx: warning: bad R_SH_USES load offset" +msgstr "%s: 0x%lx: uyarı: hatalı R_SH_USES yükleme göreli konumu" -#: elf32-ppc.c:1444 elf64-ppc.c:1511 +#: elf32-sh.c:2008 #, c-format -msgid "%s: compiled normally and linked with modules compiled with -mrelocatable" -msgstr "%s: normal derlendi ve -mrelocatable ile derlenmiþ modüllere baðlandý" +msgid "%s: 0x%lx: warning: could not find expected reloc" +msgstr "%s: 0x%lx: uyarı: beklenen yerdeÄŸiÅŸim bulunamadı" -#: elf32-ppc.c:1568 +#: elf32-sh.c:2036 #, c-format -msgid "%s: Unknown special linker type %d" -msgstr "%s: Bilinmeyen özel baðlayýcý türü %d" +msgid "%s: 0x%lx: warning: symbol in unexpected section" +msgstr "%s: 0x%lx: uyarı: beklenmeyen bölümde sembol" -#: elf32-ppc.c:2218 elf32-ppc.c:2252 elf32-ppc.c:2287 +#: elf32-sh.c:2153 #, c-format -msgid "%s: relocation %s cannot be used when making a shared object" -msgstr "%s: %s yerdeðiþimi paylaþýmlý nesne oluþturulurken kullanýlamaz" +msgid "%s: 0x%lx: warning: could not find expected COUNT reloc" +msgstr "%s: 0x%lx: uyarı: beklenen COUNT yerdeÄŸiÅŸimi bulunamadı" -#: elf32-ppc.c:3097 elf64-ppc.c:3500 +#: elf32-sh.c:2162 #, c-format -msgid "%s: unknown relocation type %d for symbol %s" -msgstr "%1$s: %3$s sembolü için bilinmeyen %2$d türünde yerdeðiþimi" +msgid "%s: 0x%lx: warning: bad count" +msgstr "%s: 0x%lx: uyarı: hatalı sayım" -#: elf32-ppc.c:3452 elf32-ppc.c:3473 elf32-ppc.c:3523 +#: elf32-sh.c:2550 elf32-sh.c:2926 #, c-format -msgid "%s: The target (%s) of a %s relocation is in the wrong output section (%s)" -msgstr "%1$s: %3$s yerdeðiþiminin hedefi (%2$s) yanlýþ çýktý bölümünde (%4$s)" +msgid "%s: 0x%lx: fatal: reloc overflow while relaxing" +msgstr "%s: 0x%lx: ölümcül: gevÅŸetilirken yerdeÄŸiÅŸim taÅŸması" -#: elf32-ppc.c:3589 -#, c-format -msgid "%s: Relocation %s is not yet supported for symbol %s." -msgstr "%s: %s yerdeðiþimi %s sembolü için henüz desteklenmiyor." +#: elf32-sh.c:4073 elf64-sh64.c:1576 +msgid "Unexpected STO_SH5_ISA32 on local symbol is not handled" +msgstr "Yerel sembolde STO_SH5_ISA32 desteklenmiyor" -#: elf32-sh.c:1101 +#: elf32-sh.c:4284 #, c-format -msgid "%s: 0x%lx: warning: bad R_SH_USES offset" -msgstr "%s: 0x%lx: uyarý: hatalý R_SH_USES göreli konumu" +msgid "%s: 0x%lx: fatal: unaligned branch target for relax-support relocation" +msgstr "%s: 0x%lx: ölümcül: gevÅŸetme destek yerdeÄŸiÅŸimi için hizalanmamış dal" -#: elf32-sh.c:1113 +#: elf32-sh64.c:203 elf64-sh64.c:2364 #, c-format -msgid "%s: 0x%lx: warning: R_SH_USES points to unrecognized insn 0x%x" -msgstr "%s: 0x%lx: uyarý: R_SH_USES bilinmeyen insn 0x%x'ý imliyor" +msgid "%s: compiled as 32-bit object and %s is 64-bit" +msgstr "%s: 32 bitlik sistem için derlenmiÅŸ ve %s 64 bit" -#: elf32-sh.c:1130 +#: elf32-sh64.c:206 elf64-sh64.c:2367 #, c-format -msgid "%s: 0x%lx: warning: bad R_SH_USES load offset" -msgstr "%s: 0x%lx: uyarý: hatalý R_SH_USES yükleme göreli konumu" +msgid "%s: compiled as 64-bit object and %s is 32-bit" +msgstr "%s: 64 bitlik sistem için derlenmiÅŸ ve %s 32 bit" -#: elf32-sh.c:1145 +#: elf32-sh64.c:208 elf64-sh64.c:2369 #, c-format -msgid "%s: 0x%lx: warning: could not find expected reloc" -msgstr "%s: 0x%lx: uyarý: beklenen yerdeðiþim bulunamadý" +msgid "%s: object size does not match that of target %s" +msgstr "%s: nesne boyu hedef %s'nin boyuyla eÅŸleÅŸmiyor" -#: elf32-sh.c:1202 +#: elf32-sh64.c:440 elf64-sh64.c:2941 #, c-format -msgid "%s: 0x%lx: warning: symbol in unexpected section" -msgstr "%s: 0x%lx: uyarý: beklenmeyen bölümde sembol" +msgid "%s: encountered datalabel symbol in input" +msgstr "%s: girdide veri etiketi sembolüne rastlandı" -#: elf32-sh.c:1323 +#: elf32-sh64.c:523 +msgid "PTB mismatch: a SHmedia address (bit 0 == 1)" +msgstr "PTB uyumsuzluÄŸu: SHmedia adresi (bit 0 == 1)" + +#: elf32-sh64.c:526 +msgid "PTA mismatch: a SHcompact address (bit 0 == 0)" +msgstr "PTA uyumsuzluÄŸu: SHcompact adresi (bit 0 == 0)" + +#: elf32-sh64.c:544 #, c-format -msgid "%s: 0x%lx: warning: could not find expected COUNT reloc" -msgstr "%s: 0x%lx: uyarý: beklenen COUNT yerdeðiþimi bulunamadý" +msgid "%s: GAS error: unexpected PTB insn with R_SH_PT_16" +msgstr "%s: GAS hatası: R_SH_PT_16 içeren PTB yönergesi beklenmiyordu" -#: elf32-sh.c:1332 +#: elf32-sh64.c:593 elf64-sh64.c:1703 #, c-format -msgid "%s: 0x%lx: warning: bad count" -msgstr "%s: 0x%lx: uyarý: hatalý sayým" +msgid "%s: error: unaligned relocation type %d at %08x reloc %08x\n" +msgstr "%1$s: %3$08x ve %4$08x yerdeÄŸiÅŸtirmesinde hizalanmamış yer deÄŸiÅŸtirme türü %2$d\n" -#: elf32-sh.c:1741 elf32-sh.c:2132 +#: elf32-sh64.c:677 #, c-format -msgid "%s: 0x%lx: fatal: reloc overflow while relaxing" -msgstr "%s: 0x%lx: ölümcül: gevþetilirken yerdeðiþim taþmasý" +msgid "%s: could not write out added .cranges entries" +msgstr "%s: eklenen .cranges girdileri yazılamadı" -#: elf32-sh.c:3267 +#: elf32-sh64.c:739 #, c-format -msgid "%s: 0x%lx: fatal: unaligned branch target for relax-support relocation" -msgstr "%s: 0x%lx: ölümcül: gevþetme destek yerdeðiþimi için hizalanmamýþ dal" +msgid "%s: could not write out sorted .cranges entries" +msgstr "%s: sıralanmış .cranges girdileri yazılamadı" -#: elf32-sparc.c:1554 elf64-sparc.c:2286 +#: elf32-sparc.c:1535 elf64-sparc.c:2224 #, c-format msgid "%s: probably compiled without -fPIC?" -msgstr "%s: acaba -fPIC olmaksýzýn mý derlenmiþ?" +msgstr "%s: acaba -fPIC olmaksızın mı derlenmiÅŸ?" -#: elf32-sparc.c:2007 +#: elf32-sparc.c:2002 #, c-format msgid "%s: compiled for a 64 bit system and target is 32 bit" -msgstr "%s: 64 bitlik sistem için derlenmiþ ve hedef 32 bit" +msgstr "%s: 64 bitlik sistem için derlenmiÅŸ ve hedef 32 bit" -#: elf32-sparc.c:2021 +#: elf32-sparc.c:2016 #, c-format msgid "%s: linking little endian files with big endian files" -msgstr "%s: küçük sonlu dosyalar büyük sonlu dosyalarla baðlanýyor" +msgstr "%s: küçük sonlu dosyalar büyük sonlu dosyalarla baÄŸlanıyor" #: elf32-v850.c:682 #, c-format msgid "Variable `%s' cannot occupy in multiple small data regions" -msgstr "`%s' deðiþkeni birden fazla küçük veri sahasýný kapsayamaz" +msgstr "`%s' deÄŸiÅŸkeni birden fazla küçük veri sahasını kapsayamaz" #: elf32-v850.c:685 #, c-format msgid "Variable `%s' can only be in one of the small, zero, and tiny data regions" -msgstr "`%s' deðiþkeni küçük, sýfýr ve ufak veri sahalarýndan yalnýz birinde olabilir" +msgstr "`%s' deÄŸiÅŸkeni küçük, sıfır ve ufak veri sahalarından yalnız birinde olabilir" #: elf32-v850.c:688 #, c-format msgid "Variable `%s' cannot be in both small and zero data regions simultaneously" -msgstr "`%s' deðiþkeni ayný anda hem küçük hem sýfýr veri sahalarýnda bulunamaz" +msgstr "`%s' deÄŸiÅŸkeni aynı anda hem küçük hem sıfır veri sahalarında bulunamaz" #: elf32-v850.c:691 #, c-format msgid "Variable `%s' cannot be in both small and tiny data regions simultaneously" -msgstr "`%s' deðiþkeni ayný anda hem küçük hem ufak veri sahalarýnda bulunamaz" +msgstr "`%s' deÄŸiÅŸkeni aynı anda hem küçük hem ufak veri sahalarında bulunamaz" #: elf32-v850.c:694 #, c-format msgid "Variable `%s' cannot be in both zero and tiny data regions simultaneously" -msgstr "`%s' deðiþkeni ayný anda hem sýfýr hem ufak veri sahalarýnda bulunamaz" +msgstr "`%s' deÄŸiÅŸkeni aynı anda hem sıfır hem ufak veri sahalarında bulunamaz" #: elf32-v850.c:1072 msgid "FAILED to find previous HI16 reloc\n" -msgstr "önceki HI16 yerdeðiþimi BULUNAMADI\n" +msgstr "önceki HI16 yerdeÄŸiÅŸimi BULUNAMADI\n" #: elf32-v850.c:1703 msgid "could not locate special linker symbol __gp" -msgstr "özel baðlayýcý sembolü __gp bulunamadý" +msgstr "özel baÄŸlayıcı sembolü __gp bulunamadı" #: elf32-v850.c:1707 msgid "could not locate special linker symbol __ep" -msgstr "özel baðlayýcý sembolü __ep bulunamadý" +msgstr "özel baÄŸlayıcı sembolü __ep bulunamadı" #: elf32-v850.c:1711 msgid "could not locate special linker symbol __ctbp" -msgstr "özel baðlayýcý sembolü __ctbp bulunamadý" +msgstr "özel baÄŸlayıcı sembolü __ctbp bulunamadı" -#: elf32-v850.c:1877 +#: elf32-v850.c:1875 #, c-format msgid "%s: Architecture mismatch with previous modules" -msgstr "%s: Önceki modüllerle platform uyumsuzluðu" +msgstr "%s: Önceki modüllerle platform uyumsuzluÄŸu" -#: elf32-v850.c:1897 +#: elf32-v850.c:1895 #, c-format msgid "private flags = %lx: " -msgstr "özel bayraklar = %lx:" +msgstr "özel bayraklar = %lx:" -#: elf32-v850.c:1902 +#: elf32-v850.c:1900 msgid "v850 architecture" msgstr "v850 platformu" -#: elf32-v850.c:1903 +#: elf32-v850.c:1901 msgid "v850e architecture" msgstr "v850e platformu" -#: elf32-v850.c:1904 +#: elf32-v850.c:1902 msgid "v850ea architecture" msgstr "v850ea platformu" -#: elf64-alpha.c:858 +#: elf32-vax.c:546 +msgid " [nonpic]" +msgstr " [nonpic]" + +#: elf32-vax.c:549 +msgid " [d-float]" +msgstr " [d-float]" + +#: elf32-vax.c:552 +msgid " [g-float]" +msgstr " [g-float]" + +#: elf32-vax.c:674 +#, c-format +msgid "%s: warning: GOT addend of %ld to `%s' does not match previous GOT addend of %ld" +msgstr "%1$s: uyarı: `%3$s'ye GOT %2$ld eklentisi bir önceki %4$ld GOT eklentisiyle eÅŸleÅŸmiyor" + +#: elf32-vax.c:1679 +#, c-format +msgid "%s: warning: PLT addend of %d to `%s' from %s section ignored" +msgstr "%1$s: uyarı: %4$s bölümünden `%3$s' sembolüne PLT eklentisi %2$d yok sayıldı" + +#: elf32-vax.c:1814 +#, c-format +msgid "%s: warning: %s relocation against symbol `%s' from %s section" +msgstr "%1$s: uyarı: %4$s bölümünden `%3$s' sembolüne %2$s yer deÄŸiÅŸimi" + +#: elf32-vax.c:1820 +#, c-format +msgid "%s: warning: %s relocation to 0x%x from %s section" +msgstr "%1$s: uyarı: %4$s bölümünden 0x%3$x'e %2$s yer deÄŸiÅŸimi" + +#: elf32-ia64.c:2280 elf32-xstormy16.c:414 elf64-ia64.c:2280 +msgid "non-zero addend in @fptr reloc" +msgstr "@fptr yerdeÄŸiÅŸiminde sıfır olmayan eklenti" + +#: elf64-alpha.c:1097 msgid "GPDISP relocation did not find ldah and lda instructions" -msgstr "GPDISP yerdeðiþimi ldah ve lda iþlemlerini bulamadý" +msgstr "GPDISP yerdeÄŸiÅŸimi ldah ve lda iÅŸlemlerini bulamadı" -#: elf64-alpha.c:2934 +#: elf64-alpha.c:3675 #, c-format msgid "%s: .got subsegment exceeds 64K (size %d)" -msgstr "%s: .got alt parçasý 64K'yý aþýyor (boy %d)" +msgstr "%s: .got alt parçası 64K'yı aşıyor (boy %d)" -#: elf64-alpha.c:3518 elf64-alpha.c:3530 +#: elf64-alpha.c:4498 elf64-alpha.c:4510 #, c-format msgid "%s: gp-relative relocation against dynamic symbol %s" -msgstr "%s: %s dinamik sembolüne gp göreceli yer deðiþimi" +msgstr "%s: %s dinamik sembolüne gp göreceli yer deÄŸiÅŸimi" + +#: elf64-alpha.c:4536 elf64-alpha.c:4676 +#, c-format +msgid "%s: pc-relative relocation against dynamic symbol %s" +msgstr "%s: %s dinamik sembolüne pc göreceli yer deÄŸiÅŸimi" -#: elf64-hppa.c:2070 +#: elf64-alpha.c:4564 +#, c-format +msgid "%s: change in gp: BRSGP %s" +msgstr "%s: gp içinde deÄŸiÅŸiklik: BRSGP %s" + +#: elf64-alpha.c:4589 +msgid "" +msgstr "" + +#: elf64-alpha.c:4594 +#, c-format +msgid "%s: !samegp reloc against symbol without .prologue: %s" +msgstr "%s: .prologue olmaksızın sembole !samegp yerdeÄŸiÅŸimi: %s" + +#: elf64-alpha.c:4639 +#, c-format +msgid "%s: unhandled dynamic relocation against %s" +msgstr "%s: %s'e desteklenmeyen dinamik yerdeÄŸiÅŸim" + +#: elf64-alpha.c:4752 +#, c-format +msgid "%s: dtp-relative relocation against dynamic symbol %s" +msgstr "%s: %s dinamik sembolüne dtp göreceli yer deÄŸiÅŸimi" + +#: elf64-alpha.c:4775 +#, c-format +msgid "%s: tp-relative relocation against dynamic symbol %s" +msgstr "%s: %s dinamik sembolüne tp göreceli yer deÄŸiÅŸimi" + +#: elf64-hppa.c:2080 #, c-format msgid "stub entry for %s cannot load .plt, dp offset = %ld" -msgstr "%s için koçan girdisi .plt'yi yükleyemedi, dp görecesi = %ld" +msgstr "%s için koçan girdisi .plt'yi yükleyemedi, dp görecesi = %ld" -#: elf64-mmix.c:1268 +#: elf64-mmix.c:1002 #, c-format -msgid "%s: register relocation against non-register symbol: %s in %s" -msgstr "%1$s: yazmaç olmayan sembole yazmaç yerdeðiþimi: %3$s içinde %2$s" +msgid "" +"%s: Internal inconsistency error for value for\n" +" linker-allocated global register: linked: 0x%lx%08lx != relaxed: 0x%lx%08lx\n" +msgstr "" +"%s: baÄŸlayıcı tarafından ayrılmış global yazmaç deÄŸeri için iç tutarsızlık hatası:\n" +" 0x%lx%08lx != gevÅŸetilmiÅŸ: 0x%lx%08lx\n" -#: elf64-mmix.c:1270 -msgid "(unknown)" -msgstr "(bilinmeyen)" +#: elf64-mmix.c:1386 +#, c-format +msgid "%s: base-plus-offset relocation against register symbol: (unknown) in %s" +msgstr "%s: yazmaç sembolüne temel artı görece yerdeÄŸiÅŸimi: %s içinde (bilinmeyen)" -#: elf64-mmix.c:1305 +#: elf64-mmix.c:1391 +#, c-format +msgid "%s: base-plus-offset relocation against register symbol: %s in %s" +msgstr "%1$s: yazmaç sembolüne temel artı görece yerdeÄŸiÅŸimi: %3$s içinde %2$s" + +#: elf64-mmix.c:1435 +#, c-format +msgid "%s: register relocation against non-register symbol: (unknown) in %s" +msgstr "%s: yazmaç olmayan sembole yazmaç yerdeÄŸiÅŸimi: %s içinde (bilinmeyen)" + +#: elf64-mmix.c:1440 +#, c-format +msgid "%s: register relocation against non-register symbol: %s in %s" +msgstr "%1$s: yazmaç olmayan sembole yazmaç yerdeÄŸiÅŸimi: %3$s içinde %2$s" + +#: elf64-mmix.c:1477 #, c-format msgid "%s: directive LOCAL valid only with a register or absolute value" -msgstr "%s: YEREL (LOCAL) yönergesi yalnýz bir yazmaç veya kesin deðerle geçerlidir" +msgstr "%s: YEREL (LOCAL) yönergesi yalnız bir yazmaç veya kesin deÄŸerle geçerlidir" -#: elf64-mmix.c:1333 +#: elf64-mmix.c:1505 #, c-format msgid "%s: LOCAL directive: Register $%ld is not a local register. First global register is $%ld." msgstr "" -"%s: YEREL (LOCAL) yönergesi: $%ld yazmacý yerel yazmaç deðil.\n" -" Ýlk evrensel yazmaç: $%ld." +"%s: YEREL (LOCAL) yönergesi: $%ld yazmacı yerel yazmaç deÄŸil.\n" +" Ä°lk evrensel yazmaç: $%ld." -#: elf64-mmix.c:1609 +#: elf64-mmix.c:1965 #, c-format msgid "%s: Error: multiple definition of `%s'; start of %s is set in a earlier linked file\n" msgstr "" -"%s: Hata: `%s' birden fazla defa tanýmlanmýþ; %s'nin baþlangýcý daha önce\n" -" baðlanan bir dosyada.\n" +"%s: Hata: `%s' birden fazla defa tanımlanmış; %s'nin baÅŸlangıcı daha önce\n" +" baÄŸlanan bir dosyada.\n" -#: elf64-mmix.c:1668 +#: elf64-mmix.c:2024 msgid "Register section has contents\n" -msgstr "Yazmaç bölümünde içerik yok\n" +msgstr "Yazmaç bölümünde içerik yok\n" -#: elf64-ppc.c:1466 libbfd.c:1436 +#: elf64-mmix.c:2186 +#, c-format +msgid "" +"Internal inconsistency: remaining %u != max %u.\n" +" Please report this bug." +msgstr "" +"İç uyumsuzluk: kalan %u != maksimum %u. \n" +" Lütfen bu hatayı bildirin." + +#: elf64-ppc.c:1669 libbfd.c:1435 #, c-format msgid "%s: compiled for a big endian system and target is little endian" -msgstr "%s: büyük sonlu sistem için derlenmiþ ve hedef küçük sonlu" +msgstr "%s: büyük sonlu sistem için derlenmiÅŸ ve hedef küçük sonlu" -#: elf64-ppc.c:1468 libbfd.c:1438 +#: elf64-ppc.c:1671 libbfd.c:1437 #, c-format msgid "%s: compiled for a little endian system and target is big endian" -msgstr "%s: küçük sonlu sistem için derlenmiþ ve hedef büyük sonlu" +msgstr "%s: küçük sonlu sistem için derlenmiÅŸ ve hedef büyük sonlu" + +#: elf64-ppc.c:3610 +#, c-format +msgid "%s: unexpected reloc type %u in .opd section" +msgstr "%s: opd bölümünde beklenmeyen yerdeÄŸiÅŸim türü %u" + +#: elf64-ppc.c:3630 +#, c-format +msgid "%s: .opd is not a regular array of opd entries" +msgstr "%s: opd, opd girdilerinin düzenli dizisi deÄŸil" + +#: elf64-ppc.c:3672 +#, c-format +msgid "%s: undefined sym `%s' in .opd section" +msgstr "%s: opd bölümünde tanımlanmamış `%s' sembolü" + +#: elf64-ppc.c:4397 +#, c-format +msgid "can't find branch stub `%s'" +msgstr "`%s' dal koçanı bulunamadı" + +#: elf64-ppc.c:4436 elf64-ppc.c:4501 +#, c-format +msgid "linkage table error against `%s'" +msgstr "`%s'ye baÄŸlama tablosu hatası" -#: elf64-ppc.c:3166 +#: elf64-ppc.c:4573 #, c-format -msgid "linkage table overflow against `%s'" -msgstr "`%s'ye baðlama tablosu taþmasý" +msgid "can't build branch stub `%s'" +msgstr "`%s' dal koçanı derlenemedi" -#: elf64-ppc.c:3244 -msgid "stub section size doesn't match calculated size" -msgstr "koçan bölümü boyu hesaplanan boyla eþleþmiyor" +#: elf64-ppc.c:5179 +msgid "stubs don't match calculated size" +msgstr "koçanlar hesaplanan boyla eÅŸleÅŸmiyor" -#: elf64-ppc.c:3845 +#: elf64-ppc.c:5828 #, c-format msgid "%s: Relocation %s is not supported for symbol %s." -msgstr "%s: %s yerdeðiþimi %s sembolü için henüz desteklenmiyor." +msgstr "%s: %s yerdeÄŸiÅŸimi %s sembolü için henüz desteklenmiyor." -#: elf64-ppc.c:3889 +#: elf64-ppc.c:5872 #, c-format msgid "%s: error: relocation %s not a multiple of 4" -msgstr "%s: hata: %s yerdeðiþimi 4'ün katý deðil" +msgstr "%s: hata: %s yerdeÄŸiÅŸimi 4'ün katı deÄŸil" -#: elf64-sparc.c:1277 +#: elf64-sparc.c:1280 #, c-format msgid "%s: check_relocs: unhandled reloc type %d" -msgstr "%s: check_relocs: desteklenmeyen yerdeðiþim türü %d" +msgstr "%s: check_relocs: desteklenmeyen yerdeÄŸiÅŸim türü %d" -#: elf64-sparc.c:1314 +#: elf64-sparc.c:1317 #, c-format msgid "%s: Only registers %%g[2367] can be declared using STT_REGISTER" -msgstr "%s: Yalnýz %%g[2367] yazmaçlarý STT_REGISTER ile bildirilebilir" +msgstr "%s: Yalnız %%g[2367] yazmaçları STT_REGISTER ile bildirilebilir" -#: elf64-sparc.c:1334 +#: elf64-sparc.c:1337 #, c-format -msgid "Register %%g%d used incompatibly: %s in %s" -msgstr "%%g%1$d yazmacý uyumsuz kullanýlmýþ: %3$s içinde %2$s" +msgid "Register %%g%d used incompatibly: %s in %s, previously %s in %s" +msgstr "%%g%1$d yazmacı uyumsuz kullanılmış: %3$s içinde %2$s, daha önce %5$s içinde %4$s idi" -#: elf64-sparc.c:1338 elf64-sparc.c:1362 elf64-sparc.c:1411 +#: elf64-sparc.c:1360 #, c-format -msgid " previously %s in %s" -msgstr " daha önce %2$s içinde %1$s" +msgid "Symbol `%s' has differing types: REGISTER in %s, previously %s in %s" +msgstr "`%1$s' sembolünün farklı türleri var: %2$s içinde REGISTER (yazmaç), daha önce %4$s içinde %3$s" -#: elf64-sparc.c:1359 elf64-sparc.c:1408 +#: elf64-sparc.c:1406 #, c-format -msgid "Symbol `%s' has differing types: %s in %s" -msgstr "`%1$s' sembolünün farklý türleri var: %3$s içinde %2$s" +msgid "Symbol `%s' has differing types: %s in %s, previously REGISTER in %s" +msgstr "" +"`%1$s' sembolünün farklı türleri var: %3$s içinde %2$s, \n" +" daha önce %4$s içinde REGISTER (yazmaç)" -#: elf64-sparc.c:3014 +#: elf64-sparc.c:2970 #, c-format msgid "%s: linking UltraSPARC specific with HAL specific code" -msgstr "%s: UltraSPARC'a özel kod HAL'e özel kod ile baðlanýyor" +msgstr "%s: UltraSPARC'a özel kod HAL'e özel kod ile baÄŸlanıyor" -#: elfcode.h:1218 +#: elfcode.h:1198 #, c-format msgid "%s: version count (%ld) does not match symbol count (%ld)" -msgstr "%s: sürüm sayýsý (%ld) sembol sayýsý (%ld) ile eþleþmiyor" +msgstr "%s: sürüm sayısı (%ld) sembol sayısı (%ld) ile eÅŸleÅŸmiyor" -#: elflink.c:434 +#: elflink.c:440 #, c-format msgid "%s: Section %s is too large to add hole of %ld bytes" -msgstr "%s: %s bölümü içine %ld baytlýk bir delik koymak için fazla büyük" +msgstr "%s: %s bölümü içine %ld baytlık bir delik koymak için fazla büyük" -#: elflink.h:1113 +#: elflink.h:1090 #, c-format msgid "%s: warning: unexpected redefinition of `%s'" -msgstr "%s: uyarý: `%s' için beklenmeyen yeniden tanýmlama" +msgstr "%s: uyarı: `%s' için beklenmeyen yeniden tanımlama" -#: elflink.h:1784 +#: elflink.h:1727 #, c-format msgid "%s: %s: invalid version %u (max %d)" -msgstr "%s: %s: geçersiz sürüm %u (maksimum %d)" +msgstr "%s: %s: geçersiz sürüm %u (maksimum %d)" -#: elflink.h:1825 +#: elflink.h:1768 #, c-format msgid "%s: %s: invalid needed version %d" -msgstr "%s: %s: geçersiz gerekli sürüm %d" +msgstr "%s: %s: geçersiz gerekli sürüm %d" -#: elflink.h:1945 +#: elflink.h:1890 #, c-format msgid "Warning: size of symbol `%s' changed from %lu to %lu in %s" -msgstr "Uyarý: `%s' sembolünün boyu %lu'dan %lu'ya %s içerisinde deðiþti" +msgstr "Uyarı: `%s' sembolünün boyu %lu'dan %lu'ya %s içerisinde deÄŸiÅŸti" + +#: elflink.h:3174 +#, c-format +msgid "%s: .preinit_array section is not allowed in DSO" +msgstr "%s: DSO içinde preinit_array'e izin verilmiyor" -#: elflink.h:4020 +#: elflink.h:4030 #, c-format msgid "warning: type and size of dynamic symbol `%s' are not defined" -msgstr "uyarý: `%s' dinamik sembolünün türü ve boyu tanýmlý deðil" +msgstr "uyarı: `%s' dinamik sembolünün türü ve boyu tanımlı deÄŸil" -#: elflink.h:4329 +#: elflink.h:4345 #, c-format msgid "%s: undefined versioned symbol name %s" -msgstr "%s: sürümlü sembol ismi %s tanýmlý deðil" +msgstr "%s: sürümlü sembol ismi %s tanımlı deÄŸil" -#: elflink.h:4559 elflink.h:4567 elflink.h:6218 elflink.h:7295 +#: elflink.h:4611 elflink.h:4619 elflink.h:6508 elflink.h:7600 msgid "Error: out of memory" -msgstr "Hata: bellek tükendi" +msgstr "Hata: bellek tükendi" -#: elflink.h:4729 +#: elflink.h:4781 msgid "Not enough memory to sort relocations" -msgstr "Yerdeðiþimleri sýralamak için gerekli bellek yok" +msgstr "YerdeÄŸiÅŸimleri sıralamak için gerekli bellek yok" -#: elflink.h:5995 +#: elflink.h:5682 elflink.h:5725 +#, c-format +msgid "%s: could not find output section %s" +msgstr "%s: çıktı bölümü %s bulunamadı" + +#: elflink.h:5688 +#, c-format +msgid "warning: %s section has zero size" +msgstr "uyarı: %s bölümü sıfır boyunda" + +#: elflink.h:6275 #, c-format msgid "%s: could not find output section %s for input section %s" -msgstr "%1$s: girdi bölümü %3$s için çýktý bölümü %2$s bulunamadý" +msgstr "%1$s: girdi bölümü %3$s için çıktı bölümü %2$s bulunamadı" -#: elflink.h:6568 +#: elflink.h:6486 +#, c-format +msgid "%s: relocation size mismatch in %s section %s" +msgstr "%1$s: %3$s bölümünde %2$s içinde yerdeÄŸiÅŸim boy uyuÅŸmazlığı" + +#: elflink.h:6849 msgid "warning: relocation against removed section; zeroing" -msgstr "uyarý: silinmiþ bölüme yer deðiþim; sýfýrlandý" +msgstr "uyarı: silinmiÅŸ bölüme yer deÄŸiÅŸim; sıfırlandı" -#: elflink.h:6598 +#: elflink.h:6879 msgid "warning: relocation against removed section" -msgstr "%1$s: silinmiþ bölüme yerdeðiþim" +msgstr "%1$s: silinmiÅŸ bölüme yerdeÄŸiÅŸim" -#: elflink.h:6611 +#: elflink.h:6892 #, c-format msgid "local symbols in discarded section %s" -msgstr "atýlmýþ %s bölümünde yerel semboller" +msgstr "atılmış %s bölümünde yerel semboller" + +#: elfxx-mips.c:734 +msgid "static procedure (no name)" +msgstr "statik altyordam (isimsiz)" + +#: elfxx-mips.c:1601 +msgid "not enough GOT space for local GOT entries" +msgstr "yerel GOT girdileri için yeterli GOT yeri yok" + +#: elfxx-mips.c:2750 +#, c-format +msgid "%s: %s+0x%lx: jump to stub routine which is not jal" +msgstr "%s: %s+0x%lx: jal olmayan koçan yordamına sıçrama" + +#: elfxx-mips.c:4270 +#, c-format +msgid "%s: Malformed reloc detected for section %s" +msgstr "%s: %s bölümü için geçersiz yer deÄŸiÅŸim bulundu" + +#: elfxx-mips.c:4348 +#, c-format +msgid "%s: CALL16 reloc at 0x%lx not against global symbol" +msgstr "%s: 0x%lx'deki CALL16 yerdeÄŸiÅŸimi evrensel sembole göre deÄŸil" -#: i386linux.c:455 m68klinux.c:459 sparclinux.c:456 +#: elfxx-mips.c:7301 +#, c-format +msgid "%s: illegal section name `%s'" +msgstr "%s: geçersiz bölüm adı `%s'" + +#: elfxx-mips.c:7615 +#, c-format +msgid "%s: linking PIC files with non-PIC files" +msgstr "%s: PIC dosyaları PIC olmayan dosyalarla baÄŸlanıyor" + +#: elfxx-mips.c:7625 +#, c-format +msgid "%s: linking abicalls files with non-abicalls files" +msgstr "%s: abicalls dosyaları abicalls olmayan dosyalarla baÄŸlanıyor" + +#: elfxx-mips.c:7654 +#, c-format +msgid "%s: ISA mismatch (-mips%d) with previous modules (-mips%d)" +msgstr "%1$s: Önceki modüllerle (-mips%3$d) ile ISA uyumsuzluÄŸu (-mips%2$d)" + +#: elfxx-mips.c:7676 +#, c-format +msgid "%s: ISA mismatch (%d) with previous modules (%d)" +msgstr "%1$s: Önceki modüllerle (%3$d) ile ISA uyumsuzluÄŸu (%2$d)" + +#: elfxx-mips.c:7699 +#, c-format +msgid "%s: ABI mismatch: linking %s module with previous %s modules" +msgstr "%s: ABI uyumsuzluÄŸu: %s modülü önceki %s modülle baÄŸlanıyor" + +#: elfxx-mips.c:7759 +msgid " [abi=O32]" +msgstr " [abi=O32]" + +#: elfxx-mips.c:7761 +msgid " [abi=O64]" +msgstr " [abi=O64]" + +#: elfxx-mips.c:7763 +msgid " [abi=EABI32]" +msgstr " [abi=EABI32]" + +#: elfxx-mips.c:7765 +msgid " [abi=EABI64]" +msgstr " [abi=EABI64]" + +#: elfxx-mips.c:7767 +msgid " [abi unknown]" +msgstr " [abi bilinmiyor]" + +#: elfxx-mips.c:7769 +msgid " [abi=N32]" +msgstr " [abi=N32]" + +#: elfxx-mips.c:7771 +msgid " [abi=64]" +msgstr " [abi=64]" + +#: elfxx-mips.c:7773 +msgid " [no abi set]" +msgstr " [abi atanmamış]" + +#: elfxx-mips.c:7776 +msgid " [mips1]" +msgstr " [mips1]" + +#: elfxx-mips.c:7778 +msgid " [mips2]" +msgstr " [mips2]" + +#: elfxx-mips.c:7780 +msgid " [mips3]" +msgstr " [mips3]" + +#: elfxx-mips.c:7782 +msgid " [mips4]" +msgstr " [mips4]" + +#: elfxx-mips.c:7784 +msgid " [mips5]" +msgstr " [mips5]" + +#: elfxx-mips.c:7786 +msgid " [mips32]" +msgstr " [mips32]" + +#: elfxx-mips.c:7788 +msgid " [mips64]" +msgstr " [mips64]" + +#: elfxx-mips.c:7790 +msgid " [unknown ISA]" +msgstr " [bilinmeyen ISA]" + +#: elfxx-mips.c:7793 +msgid " [mdmx]" +msgstr " [mdmx]" + +#: elfxx-mips.c:7796 +msgid " [mips16]" +msgstr " [mips16]" + +#: elfxx-mips.c:7799 +msgid " [32bitmode]" +msgstr " [32bitkipi]" + +#: elfxx-mips.c:7801 +msgid " [not 32bitmode]" +msgstr " [32bitkipi deÄŸil]" + +#: i386linux.c:458 m68klinux.c:462 sparclinux.c:459 #, c-format msgid "Output file requires shared library `%s'\n" -msgstr "Çýktý dosyasý için paylaþýmlý kitaplýk `%s' gerekli\n" +msgstr "Çıktı dosyası için paylaşımlı kitaplık `%s' gerekli\n" -#: i386linux.c:463 m68klinux.c:467 sparclinux.c:464 +#: i386linux.c:466 m68klinux.c:470 sparclinux.c:467 #, c-format msgid "Output file requires shared library `%s.so.%s'\n" -msgstr "Çýktý dosyasý için paylaþýmlý kitaplýk `%s.so.%s' gerekli\n" +msgstr "Çıktı dosyası için paylaşımlı kitaplık `%s.so.%s' gerekli\n" -#: i386linux.c:653 i386linux.c:703 m68klinux.c:660 m68klinux.c:708 -#: sparclinux.c:655 sparclinux.c:705 +#: i386linux.c:655 i386linux.c:705 m68klinux.c:662 m68klinux.c:710 +#: sparclinux.c:657 sparclinux.c:707 #, c-format msgid "Symbol %s not defined for fixups\n" -msgstr "%s sembolü düzeltmeler için tanýmlý deðil\n" +msgstr "%s sembolü düzeltmeler için tanımlı deÄŸil\n" -#: i386linux.c:727 m68klinux.c:732 sparclinux.c:729 +#: i386linux.c:729 m68klinux.c:734 sparclinux.c:731 msgid "Warning: fixup count mismatch\n" -msgstr "Uyarý: düzeltme sayý uyumsuzluðu\n" +msgstr "Uyarı: düzeltme sayı uyumsuzluÄŸu\n" #: ieee.c:235 #, c-format @@ -1518,261 +1765,261 @@ msgstr "%s: dizge fazla uzun (%d karakte #: ieee.c:365 #, c-format msgid "%s: unrecognized symbol `%s' flags 0x%x" -msgstr "%s: bilinmeyen `%s' sembol bayraklarý 0x%x" +msgstr "%s: bilinmeyen `%s' sembol bayrakları 0x%x" #: ieee.c:877 #, c-format -msgid "%s: unimplemented ATI record %u for symbol %u" -msgstr "%1$s: %3$u için desteklenmeyen ATI kaydý %2$u" +msgid "%s: unimplemented ATI record %u for symbol %u" +msgstr "%1$s: %3$u sembolü için desteklenmeyen ATI kaydı %2$u" #: ieee.c:902 #, c-format msgid "%s: unexpected ATN type %d in external part" -msgstr "%s: dýþ parçada beklenmeyen ATN türü %d" +msgstr "%s: dış parçada beklenmeyen ATN türü %d" #: ieee.c:924 #, c-format msgid "%s: unexpected type after ATN" -msgstr "%s: ATN'den sonra beklenmeyen tür" +msgstr "%s: ATN'den sonra beklenmeyen tür" #: ihex.c:258 #, c-format msgid "%s:%d: unexpected character `%s' in Intel Hex file\n" -msgstr "%s:%d: Intel Onaltýlýk dosyasýnda beklenmeyen `%s' karakteri\n" +msgstr "%s:%d: Intel Onaltılık dosyasında beklenmeyen `%s' karakteri\n" -#: ihex.c:368 +#: ihex.c:366 #, c-format msgid "%s:%u: bad checksum in Intel Hex file (expected %u, found %u)" msgstr "" -"%s:%u: Intel Onaltýlýk dosyasýnda hatalý saðlama toplamý\n" +"%s:%u: Intel Onaltılık dosyasında hatalı saÄŸlama toplamı\n" " (%u beklendi, %u bulundu)" -#: ihex.c:422 +#: ihex.c:420 #, c-format msgid "%s:%u: bad extended address record length in Intel Hex file" -msgstr "%s:%u: Intel Onaltýlýk dosyasýnda hatalý uzun adres kaydý uzunluðu" +msgstr "%s:%u: Intel Onaltılık dosyasında hatalı uzun adres kaydı uzunluÄŸu" -#: ihex.c:439 +#: ihex.c:437 #, c-format msgid "%s:%u: bad extended start address length in Intel Hex file" -msgstr "%s:%u: Intel Onaltýlýk dosyasýnda hatalý uzun baþlangýç adresi uzunluðu" +msgstr "%s:%u: Intel Onaltılık dosyasında hatalı uzun baÅŸlangıç adresi uzunluÄŸu" -#: ihex.c:456 +#: ihex.c:454 #, c-format msgid "%s:%u: bad extended linear address record length in Intel Hex file" -msgstr "%s:%u: Intel Onaltýlýk dosyasýnda hatalý uzun lineer adres kaydý uzunluðu" +msgstr "%s:%u: Intel Onaltılık dosyasında hatalı uzun lineer adres kaydı uzunluÄŸu" -#: ihex.c:473 +#: ihex.c:471 #, c-format msgid "%s:%u: bad extended linear start address length in Intel Hex file" -msgstr "%s:%u: Intel Onaltýlýk dosyasýnda hatalý uzun lineer baþlangýç adres uzunluðu" +msgstr "%s:%u: Intel Onaltılık dosyasında hatalı uzun lineer baÅŸlangıç adres uzunluÄŸu" -#: ihex.c:490 +#: ihex.c:488 #, c-format msgid "%s:%u: unrecognized ihex type %u in Intel Hex file\n" -msgstr "%s:%u: Intel Onaltýlýk dosyasýnda bilinmeyen onaltýlýk türü %u\n" +msgstr "%s:%u: Intel Onaltılık dosyasında bilinmeyen onaltılık türü %u\n" -#: ihex.c:610 +#: ihex.c:607 #, c-format msgid "%s: internal error in ihex_read_section" -msgstr "%s: ihex_read_section'da iç hata" +msgstr "%s: ihex_read_section'da iç hata" -#: ihex.c:645 +#: ihex.c:642 #, c-format msgid "%s: bad section length in ihex_read_section" -msgstr "%s: ihex_read_section'da hatalý bölüm uzunluðu" +msgstr "%s: ihex_read_section'da hatalı bölüm uzunluÄŸu" -#: ihex.c:863 +#: ihex.c:860 #, c-format -msgid "%s: address 0x%s out of range for Intex Hex file" -msgstr "%s: Intex Onaltýlýk dosyasý için 0x%s adresi kapsamdýþý" +msgid "%s: address 0x%s out of range for Intel Hex file" +msgstr "%s: Intex Onaltılık dosyası için 0x%s adresi kapsamdışı" #: libbfd.c:492 #, c-format msgid "not mapping: data=%lx mapped=%d\n" -msgstr "eþlenmeyen: veri=%lx eþleþen=%d\n" +msgstr "eÅŸlenmeyen: veri=%lx eÅŸleÅŸen=%d\n" #: libbfd.c:495 msgid "not mapping: env var not set\n" -msgstr "eþlenmeyen: çevre deðiþkeni atanmamýþ\n" +msgstr "eÅŸlenmeyen: çevre deÄŸiÅŸkeni atanmamış\n" -#: libbfd.c:1463 +#: libbfd.c:1466 #, c-format -msgid "Deprecated %s called" -msgstr "Geçerliliði kalkmýþ %s çaðrýldý" +msgid "Deprecated %s called at %s line %d in %s\n" +msgstr "GeçersizleÅŸmiÅŸ %s, %s'da, %d satırı, %s içerisinde çaÄŸrıldı\n" -#: libbfd.c:1465 +#: libbfd.c:1469 #, c-format -msgid " at %s line %d in %s\n" -msgstr "%s, %d satýrý, %s içerisinde\n" +msgid "Deprecated %s called\n" +msgstr "GeçerliliÄŸi kalkmış %s çaÄŸrıldı\n" -#: linker.c:1849 +#: linker.c:1873 #, c-format msgid "%s: indirect symbol `%s' to `%s' is a loop" -msgstr "%1$s: `%3$s'den endirekt sembol `%2$s'e çevrim" +msgstr "%1$s: `%3$s'den endirekt sembol `%2$s'e çevrim" -#: linker.c:2745 +#: linker.c:2776 #, c-format msgid "Attempt to do relocateable link with %s input and %s output" -msgstr "%s girdi ve %s çýktýsý ile yerdeðiþimli bað deneniyor" +msgstr "%s girdi ve %s çıktısı ile yerdeÄŸiÅŸimli baÄŸ deneniyor" -#: merge.c:897 +#: merge.c:892 #, c-format msgid "%s: access beyond end of merged section (%ld + %ld)" -msgstr "%s: karýþtýrýlmýþ bölümün sonundan ileride eriþim (%ld + %ld)" +msgstr "%s: karıştırılmış bölümün sonundan ileride eriÅŸim (%ld + %ld)" #: mmo.c:460 #, c-format msgid "%s: No core to allocate section name %s\n" -msgstr "%s: %s bölüm adýný ayýracak `core' yok\n" +msgstr "%s: %s bölüm adını ayıracak `core' yok\n" -#: mmo.c:537 +#: mmo.c:536 #, c-format msgid "%s: No core to allocate a symbol %d bytes long\n" -msgstr "%s: %d bayt uzunluðunda bir sembole yer ayýrmak için `core' yok\n" +msgstr "%s: %d bayt uzunluÄŸunda bir sembole yer ayırmak için `core' yok\n" -#: mmo.c:1190 +#: mmo.c:1245 #, c-format msgid "%s: invalid mmo file: initialization value for $255 is not `Main'\n" -msgstr "%s: geçersiz mmo dosyasý: $255 için baþlangýç deðeri `Main' deðil\n" +msgstr "%s: geçersiz mmo dosyası: $255 için baÅŸlangıç deÄŸeri `Main' deÄŸil\n" -#: mmo.c:1336 +#: mmo.c:1391 #, c-format msgid "%s: unsupported wide character sequence 0x%02X 0x%02X after symbol name starting with `%s'\n" msgstr "" -"%1$s: `%4$s' ile baþlayan sembol adýndan sonra desteklenmeyen\n" -" geniþ karakter dizisi 0x%2$02X 0x%3$02X\n" +"%1$s: `%4$s' ile baÅŸlayan sembol adından sonra desteklenmeyen\n" +" geniÅŸ karakter dizisi 0x%2$02X 0x%3$02X\n" -#: mmo.c:1571 +#: mmo.c:1633 #, c-format msgid "%s: invalid mmo file: unsupported lopcode `%d'\n" -msgstr "%s: geçersiz mmo dosyasý: desteklenmeyen lopkod `%d'\n" +msgstr "%s: geçersiz mmo dosyası: desteklenmeyen lopkod `%d'\n" -#: mmo.c:1581 +#: mmo.c:1643 #, c-format msgid "%s: invalid mmo file: expected YZ = 1 got YZ = %d for lop_quote\n" -msgstr "%s: geçersiz mmo dosyasý: YZ = 1 beklendi, lop_quote için YZ = %d bulundu\n" +msgstr "%s: geçersiz mmo dosyası: YZ = 1 beklendi, lop_quote için YZ = %d bulundu\n" -#: mmo.c:1617 +#: mmo.c:1679 #, c-format msgid "%s: invalid mmo file: expected z = 1 or z = 2, got z = %d for lop_loc\n" msgstr "" -"%s: geçersiz mmo dosyasý: z = 1 veya z = 2 beklendi, \n" -" lop_loc için z = %d bulundu\n" +"%s: geçersiz mmo dosyası: z = 1 veya z = 2 beklendi, \n" +" lop_loc için z = %d bulundu\n" -#: mmo.c:1663 +#: mmo.c:1725 #, c-format msgid "%s: invalid mmo file: expected z = 1 or z = 2, got z = %d for lop_fixo\n" -msgstr "%s: geçersiz mmo dosyasý: z = 1 veya z = 2 beklendi; lop_fixo için z = %d bulundu\n" +msgstr "%s: geçersiz mmo dosyası: z = 1 veya z = 2 beklendi; lop_fixo için z = %d bulundu\n" -#: mmo.c:1702 +#: mmo.c:1764 #, c-format msgid "%s: invalid mmo file: expected y = 0, got y = %d for lop_fixrx\n" -msgstr "%s: geçersiz mmo dosyasý: y = 0 beklendi; lop_fixrx için y = %d bulundu\n" +msgstr "%s: geçersiz mmo dosyası: y = 0 beklendi; lop_fixrx için y = %d bulundu\n" -#: mmo.c:1711 +#: mmo.c:1773 #, c-format msgid "%s: invalid mmo file: expected z = 16 or z = 24, got z = %d for lop_fixrx\n" msgstr "" -"%s: geçersiz mmo dosyasý: z = 16 veya z = 24 beklendi;\n" -" lop_fixrx için z = %d bulundu\n" +"%s: geçersiz mmo dosyası: z = 16 veya z = 24 beklendi;\n" +" lop_fixrx için z = %d bulundu\n" -#: mmo.c:1734 +#: mmo.c:1796 #, c-format msgid "%s: invalid mmo file: leading byte of operand word must be 0 or 1, got %d for lop_fixrx\n" msgstr "" -"%s: geçersiz mmo dosyasý: iþlenen word'un ilk baytý 0 veya 1 olmalý; \n" -" lop_fixrx için %d bulundu\n" +"%s: geçersiz mmo dosyası: iÅŸlenen word'un ilk baytı 0 veya 1 olmalı; \n" +" lop_fixrx için %d bulundu\n" -#: mmo.c:1757 +#: mmo.c:1819 #, c-format msgid "%s: cannot allocate file name for file number %d, %d bytes\n" -msgstr "%s: %d sayýlý dosya için dosya adý ayrýlamadý, %d bayt\n" +msgstr "%s: %d sayılı dosya için dosya adı ayrılamadı, %d bayt\n" -#: mmo.c:1777 +#: mmo.c:1839 #, c-format msgid "%s: invalid mmo file: file number %d `%s', was already entered as `%s'\n" -msgstr "%s: geçersiz mmo dosyasý: %d sayýlý dosya, `%s', zaten `%s' olarak girilmiþ\n" +msgstr "%s: geçersiz mmo dosyası: %d sayılı dosya, `%s', zaten `%s' olarak girilmiÅŸ\n" -#: mmo.c:1790 +#: mmo.c:1852 #, c-format msgid "%s: invalid mmo file: file name for number %d was not specified before use\n" msgstr "" -"%s: geçersiz mmo dosyasý: %d sayýsý için dosya adý kullanýmdan\n" -" önce belirtilmemiþ\n" +"%s: geçersiz mmo dosyası: %d sayısı için dosya adı kullanımdan\n" +" önce belirtilmemiÅŸ\n" -#: mmo.c:1896 +#: mmo.c:1958 #, c-format msgid "%s: invalid mmo file: fields y and z of lop_stab non-zero, y: %d, z: %d\n" msgstr "" -"%s: geçersiz mmo dosyasý: lop_stab'in y ve z alanlarý sýfýr deðil;\n" +"%s: geçersiz mmo dosyası: lop_stab'in y ve z alanları sıfır deÄŸil;\n" " y: %d, z: %d\n" -#: mmo.c:1932 +#: mmo.c:1994 #, c-format msgid "%s: invalid mmo file: lop_end not last item in file\n" -msgstr "%s: geçersiz mmo dosyasý: lop_end dosyadaki son girdi deðil\n" +msgstr "%s: geçersiz mmo dosyası: lop_end dosyadaki son girdi deÄŸil\n" -#: mmo.c:1945 +#: mmo.c:2007 #, c-format msgid "%s: invalid mmo file: YZ of lop_end (%ld) not equal to the number of tetras to the preceding lop_stab (%ld)\n" msgstr "" -"%s: geçersiz mmo dosyasý: lop_end'in YZ'si (%ld); bir önceki \n" -" lop_stab'in (%ld) dörtlü sayýsýna eþit deðil\n" +"%s: geçersiz mmo dosyası: lop_end'in YZ'si (%ld); bir önceki \n" +" lop_stab'in (%ld) dörtlü sayısına eÅŸit deÄŸil\n" -#: mmo.c:2610 +#: mmo.c:2670 #, c-format msgid "%s: invalid symbol table: duplicate symbol `%s'\n" -msgstr "%s: geçersiz sembol tablosu: tekrarlanmýþ sembol `%s'\n" +msgstr "%s: geçersiz sembol tablosu: tekrarlanmış sembol `%s'\n" -#: mmo.c:2898 +#: mmo.c:2921 #, c-format msgid "%s: Bad symbol definition: `Main' set to %s rather than the start address %s\n" msgstr "" -"%1$s: Hatalý sembol tanýmý: `Main' baþlangýç adresi %3$s yerine \n" -" %2$s olarak tanýmlanmýþ\n" +"%1$s: Hatalı sembol tanımı: `Main' baÅŸlangıç adresi %3$s yerine \n" +" %2$s olarak tanımlanmış\n" -#: mmo.c:2932 +#: mmo.c:3011 #, c-format msgid "%s: warning: symbol table too large for mmo, larger than 65535 32-bit words: %d. Only `Main' will be emitted.\n" msgstr "" -"%s: uyarý: sembol tablosu mmo için fazla büyük, 65535 32-bit word'den\n" -" fazla: %d. Yalnýz `Main' üretilecek. \n" +"%s: uyarı: sembol tablosu mmo için fazla büyük, 65535 32-bit word'den\n" +" fazla: %d. Yalnız `Main' üretilecek. \n" -#: mmo.c:2977 +#: mmo.c:3056 #, c-format msgid "%s: internal error, symbol table changed size from %d to %d words\n" -msgstr "%s: iç hata, sembol tablosu büyüklüðü %d'den %d word'e deðiþti\n" +msgstr "%s: iç hata, sembol tablosu büyüklüğü %d'den %d word'e deÄŸiÅŸti\n" -#: mmo.c:3032 +#: mmo.c:3111 #, c-format msgid "%s: internal error, internal register section %s had contents\n" -msgstr "%s: iç hata, %s iç yazmaç bölümü içerik taþýyor\n" +msgstr "%s: iç hata, %s iç yazmaç bölümü içerik taşıyor\n" -#: mmo.c:3084 +#: mmo.c:3163 #, c-format msgid "%s: no initialized registers; section length 0\n" -msgstr "%s: ilklenen yazmaç yok; bölüm uzunluðu 0\n" +msgstr "%s: ilklenen yazmaç yok; bölüm uzunluÄŸu 0\n" -#: mmo.c:3090 +#: mmo.c:3169 #, c-format msgid "%s: too many initialized registers; section length %ld\n" -msgstr "%s: çok fazla ilklenmiþ yazmaç; bölüm uzunluðu %ld\n" +msgstr "%s: çok fazla ilklenmiÅŸ yazmaç; bölüm uzunluÄŸu %ld\n" -#: mmo.c:3095 +#: mmo.c:3174 #, c-format msgid "%s: invalid start address for initialized registers of length %ld: 0x%lx%08lx\n" -msgstr "%s: %ld uzunluðunda ilklenmiþ yazmaçlar için hatalý baþlangýç adresi: 0x%lx%08lx\n" +msgstr "%s: %ld uzunluÄŸunda ilklenmiÅŸ yazmaçlar için hatalı baÅŸlangıç adresi: 0x%lx%08lx\n" -#: oasys.c:1036 +#: oasys.c:1029 #, c-format msgid "%s: can not represent section `%s' in oasys" -msgstr "%s: oasys'de `%s' bölümü gösterilemiyor" +msgstr "%s: oasys'de `%s' bölümü gösterilemiyor" #: osf-core.c:132 #, c-format msgid "Unhandled OSF/1 core file section type %d\n" -msgstr "Desteklenmeyen OSF/1 core dosyasý bölüm türü %d\n" +msgstr "Desteklenmeyen OSF/1 core dosyası bölüm türü %d\n" #: pe-mips.c:658 #, c-format @@ -1787,62 +2034,66 @@ msgstr "%s: `ld -r' PE MIPS nesneleri il #: pe-mips.c:794 #, c-format msgid "%s: unimplemented %s\n" -msgstr "%s: tamamlanmamýþ %s\n" +msgstr "%s: tamamlanmamış %s\n" #: pe-mips.c:820 #, c-format msgid "%s: jump too far away\n" -msgstr "%s: sýçrama fazla uzak\n" +msgstr "%s: sıçrama fazla uzak\n" #: pe-mips.c:847 #, c-format msgid "%s: bad pair/reflo after refhi\n" -msgstr "%s: refhi'den sonra hatalý çift/reflo\n" +msgstr "%s: refhi'den sonra hatalı çift/reflo\n" #. XXX code yet to be written. #: peicode.h:785 #, c-format msgid "%s: Unhandled import type; %x" -msgstr "%s: Desteklenmeyen ithal türü; %x" +msgstr "%s: Desteklenmeyen ithal türü; %x" #: peicode.h:790 #, c-format msgid "%s: Unrecognised import type; %x" -msgstr "%s: Tanýnmayan ithal türü; %x" +msgstr "%s: Tanınmayan ithal türü; %x" #: peicode.h:804 #, c-format msgid "%s: Unrecognised import name type; %x" -msgstr "%s: Tanýnmayan ithal isim türü; %x" +msgstr "%s: Tanınmayan ithal isim türü; %x" #: peicode.h:1162 #, c-format msgid "%s: Unrecognised machine type (0x%x) in Import Library Format archive" -msgstr "%s: Ýthal Kitaplýk Biçem (ILF) arþivinde tanýnmayan makina türü (0x%x) " +msgstr "%s: Ä°thal Kitaplık Biçem (ILF) arÅŸivinde tanınmayan makina türü (0x%x) " #: peicode.h:1174 #, c-format msgid "%s: Recognised but unhandled machine type (0x%x) in Import Library Format archive" -msgstr "%s: Ýthal Kitaplýk Biçem (ILF) arþivinde bilinen fakat desteklenmeyen makina türü (0x%x)" +msgstr "%s: Ä°thal Kitaplık Biçem (ILF) arÅŸivinde bilinen fakat desteklenmeyen makina türü (0x%x)" #: peicode.h:1191 #, c-format msgid "%s: size field is zero in Import Library Format header" -msgstr "%s: Ýthal Kitaplýk Biçem (ILF) baþlýðýnda boy alaný sýfýr" +msgstr "%s: Ä°thal Kitaplık Biçem (ILF) baÅŸlığında boy alanı sıfır" #: peicode.h:1219 #, c-format msgid "%s: string not null terminated in ILF object file." -msgstr "%s: ILF nesne dosyasýnda dizge boþ deðerle sonlanmamýþ." +msgstr "%s: ILF nesne dosyasında dizge boÅŸ deÄŸerle sonlanmamış." #: ppcboot.c:416 -msgid "\nppcboot header:\n" -msgstr "\nppcboot baþlýðý:\n" +msgid "" +"\n" +"ppcboot header:\n" +msgstr "" +"\n" +"ppcboot baÅŸlığı:\n" #: ppcboot.c:417 #, c-format msgid "Entry offset = 0x%.8lx (%ld)\n" -msgstr "Girdi göreli konumu = 0x%.8lx (%ld)\n" +msgstr "Girdi göreli konumu = 0x%.8lx (%ld)\n" #: ppcboot.c:418 #, c-format @@ -1852,702 +2103,807 @@ msgstr "Uzunluk = 0x%.8lx (% #: ppcboot.c:421 #, c-format msgid "Flag field = 0x%.2x\n" -msgstr "Bayrak alaný = 0x%.2x\n" +msgstr "Bayrak alanı = 0x%.2x\n" #: ppcboot.c:427 #, c-format msgid "Partition name = \"%s\"\n" -msgstr "Bölüm adý = \"%s\"\n" +msgstr "Bölüm adı = \"%s\"\n" #: ppcboot.c:446 #, c-format -msgid "\nPartition[%d] start = { 0x%.2x, 0x%.2x, 0x%.2x, 0x%.2x }\n" -msgstr "\nBölüm[%d] baþlangýcý = { 0x%.2x, 0x%.2x, 0x%.2x, 0x%.2x }\n" +msgid "" +"\n" +"Partition[%d] start = { 0x%.2x, 0x%.2x, 0x%.2x, 0x%.2x }\n" +msgstr "" +"\n" +"Bölüm[%d] baÅŸlangıcı = { 0x%.2x, 0x%.2x, 0x%.2x, 0x%.2x }\n" #: ppcboot.c:452 #, c-format msgid "Partition[%d] end = { 0x%.2x, 0x%.2x, 0x%.2x, 0x%.2x }\n" -msgstr "Bölüm[%d] sonu = { 0x%.2x, 0x%.2x, 0x%.2x, 0x%.2x }\n" +msgstr "Bölüm[%d] sonu = { 0x%.2x, 0x%.2x, 0x%.2x, 0x%.2x }\n" #: ppcboot.c:458 #, c-format msgid "Partition[%d] sector = 0x%.8lx (%ld)\n" -msgstr "Bölüm[%d] sektörü = 0x%.8lx (%ld)\n" +msgstr "Bölüm[%d] sektörü = 0x%.8lx (%ld)\n" #: ppcboot.c:459 #, c-format msgid "Partition[%d] length = 0x%.8lx (%ld)\n" -msgstr "Bölüm[%d] uzunluðu = 0x%.8lx (%ld)\n" +msgstr "Bölüm[%d] uzunluÄŸu = 0x%.8lx (%ld)\n" -#: som.c:5402 +#: som.c:5398 msgid "som_sizeof_headers unimplemented" -msgstr "som_sizeof_headers tamamlanmamýþ" +msgstr "som_sizeof_headers tamamlanmamış" #: srec.c:301 #, c-format msgid "%s:%d: Unexpected character `%s' in S-record file\n" -msgstr "%s:%d: S-kayýt dosyasýnda beklenmeyen `%s' karakteri\n" +msgstr "%s:%d: S-kayıt dosyasında beklenmeyen `%s' karakteri\n" + +#: stabs.c:319 +#, c-format +msgid "%s(%s+0x%lx): Stabs entry has invalid string index." +msgstr "%s(%s+0x%lx): Stabs girdisinde geçersiz dizge indeksi." -#: syms.c:996 +#: syms.c:1044 msgid "Unsupported .stab relocation" -msgstr "Desteklenmeyen .stab yerdeðiþimi" +msgstr "Desteklenmeyen .stab yerdeÄŸiÅŸimi" #: vms-gsd.c:356 #, c-format msgid "bfd_make_section (%s) failed" -msgstr "bfd_make_section (%s) baþarýsýz" +msgstr "bfd_make_section (%s) baÅŸarısız" #: vms-gsd.c:371 #, c-format msgid "bfd_set_section_flags (%s, %x) failed" -msgstr "bfd_set_section_flags (%s, %x) baþarýsýz" +msgstr "bfd_set_section_flags (%s, %x) baÅŸarısız" #: vms-gsd.c:407 #, c-format msgid "Size mismatch section %s=%lx, %s=%lx" -msgstr "Boy uyumsuzluðu bölümü %s=%lx, %s=%lx" +msgstr "Boy uyumsuzluÄŸu bölümü %s=%lx, %s=%lx" -#: vms-gsd.c:704 +#: vms-gsd.c:702 #, c-format msgid "unknown gsd/egsd subtype %d" -msgstr "bilinmeyen gsd/egsd alt türü %d" +msgstr "bilinmeyen gsd/egsd alt türü %d" #: vms-hdr.c:406 msgid "Object module NOT error-free !\n" -msgstr "Nesne modülü hatasýz DEÐÝL !\n" +msgstr "Nesne modülü hatasız DEĞİL !\n" #: vms-misc.c:543 #, c-format msgid "Stack overflow (%d) in _bfd_vms_push" -msgstr "_bfd_vms_push'da yýðýt taþmasý (%d)" +msgstr "_bfd_vms_push'da yığıt taÅŸması (%d)" #: vms-misc.c:561 msgid "Stack underflow in _bfd_vms_pop" -msgstr "_bfd_vms_pop'da yýðýt alt taþmasý" +msgstr "_bfd_vms_pop'da yığıt alt taÅŸması" #: vms-misc.c:919 msgid "_bfd_vms_output_counted called with zero bytes" -msgstr "_bfd_vms_output_counted sýfýr bayt ile çaðrýldý" +msgstr "_bfd_vms_output_counted sıfır bayt ile çaÄŸrıldı" #: vms-misc.c:924 msgid "_bfd_vms_output_counted called with too many bytes" -msgstr "_bfd_vms_output_counted fazla bayt ile çaðrýldý" +msgstr "_bfd_vms_output_counted fazla bayt ile çaÄŸrıldı" #: vms-misc.c:1055 #, c-format msgid "Symbol %s replaced by %s\n" -msgstr "%s sembolü %s ile deðiþtirildi\n" +msgstr "%s sembolü %s ile deÄŸiÅŸtirildi\n" #: vms-misc.c:1117 #, c-format msgid "failed to enter %s" -msgstr "%s'e giriþ baþarýsýz" +msgstr "%s'e giriÅŸ baÅŸarısız" -#: vms-tir.c:78 +#: vms-tir.c:81 msgid "No Mem !" -msgstr "Hafýza Yok !" - -#: vms-tir.c:313 -msgid "Bad section index in ETIR_S_C_STA_PQ" -msgstr "ETIR_S_C_STA_PQ'de hatalý bölüm indeksi" +msgstr "Hafıza Yok !" -#: vms-tir.c:328 +#: vms-tir.c:362 #, c-format -msgid "Unsupported STA cmd %d" -msgstr "Desteklenmeyen STA komutu %d" +msgid "bad section index in %s" +msgstr "%s içinde hatalı bölüm indeksi" -#: vms-tir.c:333 vms-tir.c:1301 +#: vms-tir.c:375 #, c-format -msgid "Reserved STA cmd %d" -msgstr "Ayrýlmýþ STA komutu %d" +msgid "unsupported STA cmd %s" +msgstr "Desteklenmeyen STA komutu %s" -#: vms-tir.c:443 +#: vms-tir.c:380 vms-tir.c:1240 #, c-format -msgid "ETIR_S_C_STO_GBL: no symbol \"%s\"" -msgstr "ETIR_S_C_STO_GBL: sembol yok \"%s\"" +msgid "reserved STA cmd %d" +msgstr "Ayrılmış STA komutu %d" -#: vms-tir.c:465 +#: vms-tir.c:491 vms-tir.c:514 #, c-format -msgid "ETIR_S_C_STO_CA: no symbol \"%s\"" -msgstr "ETIR_S_C_STO_CA: sembol yok \"%s\"" - -#: vms-tir.c:478 -msgid "ETIR_S_C_STO_RB/AB: Not supported" -msgstr "ETIR_S_C_STO_RB/AB: Desteklenmiyor" - -#: vms-tir.c:538 -msgid "ETIR_S_C_STO_LP_PSB: Not supported" -msgstr "ETIR_S_C_STO_LP_PSB: Desteklenmiyor" - -#: vms-tir.c:544 -msgid "ETIR_S_C_STO_HINT_GBL: not implemented" -msgstr "ETIR_S_C_STO_HINT_GBL: tamamlanmamýþ" - -#: vms-tir.c:550 -msgid "ETIR_S_C_STO_HINT_PS: not implemented" -msgstr "ETIR_S_C_STO_HINT_PS: tamamlanmamýþ" +msgid "%s: no symbol \"%s\"" +msgstr "%s: \"%s\" sembolü yok" -#: vms-tir.c:554 vms-tir.c:1473 +#. unsigned shift +#. rotate +#. Redefine symbol to current location. +#. Define a literal. +#: vms-tir.c:581 vms-tir.c:693 vms-tir.c:803 vms-tir.c:821 vms-tir.c:829 +#: vms-tir.c:838 vms-tir.c:1563 #, c-format -msgid "Reserved STO cmd %d" -msgstr "Ayrýlmýþ STO komutu %d" +msgid "%s: not supported" +msgstr "%s: desteklenmiyor" -#: vms-tir.c:667 -msgid "ETIR_S_C_OPR_INSV: Not supported" -msgstr "ETIR_S_C_OPR_INSV: Desteklenmiyor" - -#: vms-tir.c:685 -msgid "ETIR_S_C_OPR_USH: Not supported" -msgstr "ETIR_S_C_OPR_USH: Desteklenmiyor" - -#: vms-tir.c:691 -msgid "ETIR_S_C_OPR_ROT: Not supported" -msgstr "ETIR_S_C_OPR_ROT: Desteklenmiyor" - -#: vms-tir.c:710 -msgid "ETIR_S_C_OPR_REDEF: Not supported" -msgstr "ETIR_S_C_OPR_REDEF: Desteklenmiyor" - -#: vms-tir.c:716 -msgid "ETIR_S_C_OPR_DFLIT: Not supported" -msgstr "ETIR_S_C_OPR_DFLIT: Desteklenmiyor" - -#: vms-tir.c:720 vms-tir.c:1668 +#: vms-tir.c:586 vms-tir.c:1418 #, c-format -msgid "Reserved OPR cmd %d" -msgstr "Ayrýlmýþ OPR komutu %d" +msgid "%s: not implemented" +msgstr "%s: tamamlanmamış" -#: vms-tir.c:788 vms-tir.c:1737 +#: vms-tir.c:590 vms-tir.c:1422 #, c-format -msgid "Reserved CTL cmd %d" -msgstr "Ayrýlmýþ CTL komutu %d" - -#: vms-tir.c:816 -msgid "ETIR_S_C_STC_LP: not supported" -msgstr "ETIR_S_C_STC_LP: desteklenmiyor" +msgid "reserved STO cmd %d" +msgstr "Ayrılmış STO komutu %d" -#: vms-tir.c:834 -msgid "ETIR_S_C_STC_GBL: not supported" -msgstr "ETIR_S_C_STC_GBL: desteklenmiyor" - -#: vms-tir.c:842 -msgid "ETIR_S_C_STC_GCA: not supported" -msgstr "ETIR_S_C_STC_GCA: desteklenmiyor" +#: vms-tir.c:708 vms-tir.c:1568 +#, c-format +msgid "reserved OPR cmd %d" +msgstr "Ayrılmış OPR komutu %d" -#: vms-tir.c:851 -msgid "ETIR_S_C_STC_PS: not supported" -msgstr "ETIR_S_C_STC_PS: desteklenmiyor" +#: vms-tir.c:776 vms-tir.c:1632 +#, c-format +msgid "reserved CTL cmd %d" +msgstr "Ayrılmış CTL komutu %d" -#. -#. * stack byte from image -#. * arg: - -#. * -#. -#: vms-tir.c:1199 -msgid "Stack-from-image not implemented" -msgstr "Görüntüden-yýðýt tamamlanmamýþ" +#. stack byte from image +#. arg: none. +#: vms-tir.c:1148 +msgid "stack-from-image not implemented" +msgstr "Görüntüden-yığıt tamamlanmamış" -#: vms-tir.c:1219 -msgid "Stack-entry-mask not fully implemented" -msgstr "Yýðýn girdi maský tamamlanmamýþ" +#: vms-tir.c:1166 +msgid "stack-entry-mask not fully implemented" +msgstr "Yığın girdi maskı tamamlanmamış" +#. compare procedure argument +#. arg: cs symbol name +#. by argument index +#. da argument descriptor #. -#. * compare procedure argument -#. * arg: cs symbol name -#. * by argument index -#. * da argument descriptor -#. * -#. * compare argument descriptor with symbol argument (ARG$V_PASSMECH) -#. * and stack TRUE (args match) or FALSE (args dont match) value -#. -#: vms-tir.c:1235 +#. compare argument descriptor with symbol argument (ARG$V_PASSMECH) +#. and stack TRUE (args match) or FALSE (args dont match) value. +#: vms-tir.c:1180 msgid "PASSMECH not fully implemented" -msgstr "PASSMECH tamamlanmamýþ" +msgstr "PASSMECH tamamlanmamış" -#: vms-tir.c:1256 -msgid "Stack-local-symbol not fully implemented" -msgstr "Yerel sembol yýðýtý tamamlanmamýþ" +#: vms-tir.c:1199 +msgid "stack-local-symbol not fully implemented" +msgstr "Yerel sembol yığıtı tamamlanmamış" -#: vms-tir.c:1271 -msgid "Stack-literal not fully implemented" -msgstr "Yýðýt sabiti tamamlanmamýþ" +#: vms-tir.c:1212 +msgid "stack-literal not fully implemented" +msgstr "Yığıt sabiti tamamlanmamış" -#: vms-tir.c:1294 -msgid "Stack-local-symbol-entry-point-mask not fully implemented" -msgstr "Yýðýn yerel sembol girdi nokta maský tamamlanmamýþ" +#: vms-tir.c:1233 +msgid "stack-local-symbol-entry-point-mask not fully implemented" +msgstr "Yığın yerel sembol girdi noktası maskı tamamlanmamış" -#: vms-tir.c:1469 +#: vms-tir.c:1510 vms-tir.c:1522 vms-tir.c:1534 vms-tir.c:1546 vms-tir.c:1611 +#: vms-tir.c:1619 vms-tir.c:1627 #, c-format -msgid "Unimplemented STO cmd %d" -msgstr "Tamamlanmamýþ STO komutu %d" - -#: vms-tir.c:1608 -msgid "TIR_S_C_OPR_ASH incomplete" -msgstr "TIR_S_C_OPR_ASH tamamlanmamýþ" +msgid "%s: not fully implemented" +msgstr "%s: tamamlanmamış" -#: vms-tir.c:1622 -msgid "TIR_S_C_OPR_USH incomplete" -msgstr "TIR_S_C_OPR_USH tamamlanmamýþ" - -#: vms-tir.c:1636 -msgid "TIR_S_C_OPR_ROT incomplete" -msgstr "TIR_S_C_OPR_ROT tamamlanmamýþ" - -#. -#. * redefine symbol to current location -#. -#: vms-tir.c:1657 -msgid "TIR_S_C_OPR_REDEF not supported" -msgstr "TIR_S_C_OPR_REDEF desteklenmiyor" - -#. -#. * define a literal -#. -#: vms-tir.c:1664 -msgid "TIR_S_C_OPR_DFLIT not supported" -msgstr "TIR_S_C_OPR_DFLIT desteklenmiyor" - -#: vms-tir.c:1718 -msgid "TIR_S_C_CTL_DFLOC not fully implemented" -msgstr "TIR_S_C_CTL_DFLOC tamamlanmamýþ" - -#: vms-tir.c:1726 -msgid "TIR_S_C_CTL_STLOC not fully implemented" -msgstr "TIR_S_C_CTL_STLOC tamamlanmamýþ" - -#: vms-tir.c:1734 -msgid "TIR_S_C_CTL_STKDL not fully implemented" -msgstr "TIR_S_C_CTL_STKDL tamamlanmamýþ" - -#: vms-tir.c:1791 +#: vms-tir.c:1684 #, c-format -msgid "Obj code %d not found" -msgstr "Nesne kodu %d bulunmadý" +msgid "obj code %d not found" +msgstr "Nesne kodu %d bulunmadı" -#: vms-tir.c:2137 +#: vms-tir.c:2019 #, c-format msgid "SEC_RELOC with no relocs in section %s" -msgstr "%s bölümünde yerdeðiþim olmaksýzýn SEC_RELOC" +msgstr "%s bölümünde yerdeÄŸiÅŸim olmaksızın SEC_RELOC" -#: vms-tir.c:2424 +#: vms-tir.c:2307 #, c-format msgid "Unhandled relocation %s" -msgstr "Desteklenmeyen yerdeðiþim %s" +msgstr "Desteklenmeyen yerdeÄŸiÅŸim %s" -#: xcofflink.c:1241 +#: xcofflink.c:1243 #, c-format msgid "%s: `%s' has line numbers but no enclosing section" -msgstr "%s: `%s' satýr numaralarýna sahip fakat onu içeren bölümü yok" +msgstr "%s: `%s' satır numaralarına sahip fakat onu içeren bölümü yok" -#: xcofflink.c:1294 +#: xcofflink.c:1296 #, c-format msgid "%s: class %d symbol `%s' has no aux entries" -msgstr "%s: sýnýf %d sembol `%s'un alternatif girdileri yok" +msgstr "%s: sınıf %d sembol `%s'un alternatif girdileri yok" -#: xcofflink.c:1317 +#: xcofflink.c:1319 #, c-format msgid "%s: symbol `%s' has unrecognized csect type %d" -msgstr "%s: `%s' sembolünde bilinmeyen csect türü %d var" +msgstr "%s: `%s' sembolünde bilinmeyen csect türü %d var" -#: xcofflink.c:1329 +#: xcofflink.c:1331 #, c-format msgid "%s: bad XTY_ER symbol `%s': class %d scnum %d scnlen %d" -msgstr "%s: hatalý XTY_ER sembolü `%s': sýnýf %d scnum %d scnlen %d" +msgstr "%s: hatalı XTY_ER sembolü `%s': sınıf %d scnum %d scnlen %d" -#: xcofflink.c:1365 +#: xcofflink.c:1367 #, c-format msgid "%s: XMC_TC0 symbol `%s' is class %d scnlen %d" -msgstr "%s: XMC_TC0 sembolü `%s': sýnýf %d scnlen %d" +msgstr "%s: XMC_TC0 sembolü `%s': sınıf %d scnlen %d" -#: xcofflink.c:1517 +#: xcofflink.c:1519 #, c-format msgid "%s: csect `%s' not in enclosing section" -msgstr "%s: csect `%s' onu içeren bölümde deðil" +msgstr "%s: csect `%s' onu içeren bölümde deÄŸil" -#: xcofflink.c:1624 +#: xcofflink.c:1626 #, c-format msgid "%s: misplaced XTY_LD `%s'" -msgstr "%s: XTY_LD `%s'yanlýþ yerde" +msgstr "%s: XTY_LD `%s'yanlış yerde" -#: xcofflink.c:1948 +#: xcofflink.c:1957 #, c-format msgid "%s: reloc %s:%d not in csect" -msgstr "%s: yerdeðiþim %s:%d csect içinde deðil" +msgstr "%s: yerdeÄŸiÅŸim %s:%d csect içinde deÄŸil" -#: xcofflink.c:2083 +#: xcofflink.c:2092 #, c-format msgid "%s: XCOFF shared object when not producing XCOFF output" -msgstr "%s: XCOFF çýktýsý oluþturulmazken XCOFF paylaþýmlý nesnesi" +msgstr "%s: XCOFF çıktısı oluÅŸturulmazken XCOFF paylaşımlı nesnesi" -#: xcofflink.c:2104 +#: xcofflink.c:2113 #, c-format msgid "%s: dynamic object with no .loader section" -msgstr "%s: .loader bölümü olmayan dinamik nesne" +msgstr "%s: .loader bölümü olmayan dinamik nesne" -#: xcofflink.c:2749 +#: xcofflink.c:2758 #, c-format msgid "%s: no such symbol" -msgstr "%s: böyle bir sembol yok" +msgstr "%s: böyle bir sembol yok" -#: xcofflink.c:2890 +#: xcofflink.c:2891 msgid "error: undefined symbol __rtinit" -msgstr "hata: tanýmlanmamýþ sembol __rtinit" +msgstr "hata: tanımlanmamış sembol __rtinit" -#: xcofflink.c:3458 +#: xcofflink.c:3453 #, c-format msgid "warning: attempt to export undefined symbol `%s'" -msgstr "uyarý: tanýmlanmamýþ `%s' sembolünü ihraç denemesi" +msgstr "uyarı: tanımlanmamış `%s' sembolünü ihraç denemesi" -#: xcofflink.c:4452 +#: xcofflink.c:4447 #, c-format msgid "TOC overflow: 0x%lx > 0x10000; try -mminimal-toc when compiling" -msgstr "TOC taþmasý: 0x%lx > 0x10000; -mminimal-toc ile derlemeyi deneyin" +msgstr "TOC taÅŸması: 0x%lx > 0x10000; -mminimal-toc ile derlemeyi deneyin" -#: xcofflink.c:5292 xcofflink.c:5754 xcofflink.c:5816 xcofflink.c:6117 +#: xcofflink.c:5287 xcofflink.c:5756 xcofflink.c:5818 xcofflink.c:6119 #, c-format msgid "%s: loader reloc in unrecognized section `%s'" -msgstr "%s: bilinmeyen `%s' bölümünde yükleyici yerdeðiþimi" +msgstr "%s: bilinmeyen `%s' bölümünde yükleyici yerdeÄŸiÅŸimi" -#: xcofflink.c:5314 xcofflink.c:6128 +#: xcofflink.c:5309 xcofflink.c:6130 #, c-format msgid "%s: `%s' in loader reloc but not loader sym" -msgstr "%s: `%s' yükleyici yerdeðiþiminde fakat yükleyici sembolü deðil" +msgstr "%s: `%s' yükleyici yerdeÄŸiÅŸiminde fakat yükleyici sembolü deÄŸil" -#: xcofflink.c:5329 +#: xcofflink.c:5324 #, c-format msgid "%s: loader reloc in read-only section %s" -msgstr "%s: %s salt-okunur bölümünde yükleyici yerdeðiþimi" +msgstr "%s: %s salt-okunur bölümünde yükleyici yerdeÄŸiÅŸimi" -#: elf32-ia64.c:2190 elf64-ia64.c:2190 +#: elf32-ia64.c:2222 elf64-ia64.c:2222 msgid "@pltoff reloc against local symbol" msgstr "yerel sembole @pltoff yerdegisimi" -#: elf32-ia64.c:2248 elf64-ia64.c:2248 -msgid "non-zero addend in @fptr reloc" -msgstr "@fptr yerdeðiþiminde sýfýr olmayan eklenti" - -#: elf32-ia64.c:3414 elf64-ia64.c:3414 +#: elf32-ia64.c:3562 elf64-ia64.c:3562 #, c-format msgid "%s: short data segment overflowed (0x%lx >= 0x400000)" -msgstr "%s: kýsa veri bölümünde taþma (0x%lx >= 0x400000)" +msgstr "%s: kısa veri bölümünde taÅŸma (0x%lx >= 0x400000)" -#: elf32-ia64.c:3425 elf64-ia64.c:3425 +#: elf32-ia64.c:3573 elf64-ia64.c:3573 #, c-format msgid "%s: __gp does not cover short data segment" -msgstr "%s: __gp kýsa veri bölümünü kapsamýyor" +msgstr "%s: __gp kısa veri bölümünü kapsamıyor" -#: elf32-ia64.c:3729 elf64-ia64.c:3729 +#: elf32-ia64.c:3858 elf64-ia64.c:3858 #, c-format msgid "%s: linking non-pic code in a shared library" -msgstr "%s: pic olmayan kod paylaþmalý kitaplýkta baðlanýyor" +msgstr "%s: pic olmayan kod paylaÅŸmalı kitaplıkta baÄŸlanıyor" -#: elf32-ia64.c:3762 elf64-ia64.c:3762 +#: elf32-ia64.c:3891 elf64-ia64.c:3891 #, c-format msgid "%s: @gprel relocation against dynamic symbol %s" -msgstr "%s: %s dinamik sembolüne @gprel yerdeðiþimi" +msgstr "%s: %s dinamik sembolüne @gprel yerdeÄŸiÅŸimi" -#: elf32-ia64.c:3901 elf64-ia64.c:3901 +#: elf32-ia64.c:4030 elf64-ia64.c:4030 #, c-format msgid "%s: dynamic relocation against speculation fixup" -msgstr "%s: kuþkulu düzeltmeye dinamik yerdeðiþim" +msgstr "%s: kuÅŸkulu düzeltmeye dinamik yerdeÄŸiÅŸim" -#: elf32-ia64.c:3909 elf64-ia64.c:3909 +#: elf32-ia64.c:4038 elf64-ia64.c:4038 #, c-format msgid "%s: speculation fixup against undefined weak symbol" -msgstr "%s: tanýmlanmamýþ gevþek sembole tartýþmalý düzeltme" +msgstr "%s: tanımlanmamış gevÅŸek sembole tartışmalı düzeltme" -#: elf32-ia64.c:4093 elf64-ia64.c:4093 +#: elf32-ia64.c:4271 elf64-ia64.c:4271 msgid "unsupported reloc" -msgstr "desteklenmeyen yerdeðiþim" +msgstr "desteklenmeyen yerdeÄŸiÅŸim" -#: elf32-ia64.c:4373 elf64-ia64.c:4373 +#: elf32-ia64.c:4551 elf64-ia64.c:4551 #, c-format msgid "%s: linking trap-on-NULL-dereference with non-trapping files" -msgstr "%s: NULL-halinde-tuzakla karþý-baþvurusu tuzaklamayan dosyalarla baðlandý" +msgstr "%s: NULL-halinde-tuzakla karşı-baÅŸvurusu tuzaklamayan dosyalarla baÄŸlandı" -#: elf32-ia64.c:4382 elf64-ia64.c:4382 +#: elf32-ia64.c:4560 elf64-ia64.c:4560 #, c-format msgid "%s: linking big-endian files with little-endian files" -msgstr "%s: büyük sonlu dosyalar küçük sonlu dosyalarla baðlanýyor" +msgstr "%s: büyük sonlu dosyalar küçük sonlu dosyalarla baÄŸlanıyor" -#: elf32-ia64.c:4391 elf64-ia64.c:4391 +#: elf32-ia64.c:4569 elf64-ia64.c:4569 #, c-format msgid "%s: linking 64-bit files with 32-bit files" -msgstr "%s: 64 bitlik dosyalar 32 bitlik dosyalarla baðlanýyor" +msgstr "%s: 64 bitlik dosyalar 32 bitlik dosyalarla baÄŸlanıyor" -#: elf32-ia64.c:4400 elf64-ia64.c:4400 +#: elf32-ia64.c:4578 elf64-ia64.c:4578 #, c-format msgid "%s: linking constant-gp files with non-constant-gp files" -msgstr "%s: constant-gp dosyalarý constant-gp olmayan dosyalarla baðlanýyor" +msgstr "%s: constant-gp dosyaları constant-gp olmayan dosyalarla baÄŸlanıyor" -#: elf32-ia64.c:4410 elf64-ia64.c:4410 +#: elf32-ia64.c:4588 elf64-ia64.c:4588 #, c-format msgid "%s: linking auto-pic files with non-auto-pic files" -msgstr "%s: auto-pic dosyalarý auto-pic olmayan dosyalarla baðlanýyor" +msgstr "%s: auto-pic dosyaları auto-pic olmayan dosyalarla baÄŸlanıyor" -#: peigen.c:964 pepigen.c:964 +#: peigen.c:962 pepigen.c:962 #, c-format msgid "%s: line number overflow: 0x%lx > 0xffff" -msgstr "%s: satýr numarasý taþmasý: 0x%lx > 0xffff" +msgstr "%s: satır numarası taÅŸması: 0x%lx > 0xffff" -#: peigen.c:981 pepigen.c:981 +#: peigen.c:979 pepigen.c:979 #, c-format msgid "%s: reloc overflow 1: 0x%lx > 0xffff" -msgstr "%s: yerdeðiþim taþmasý 1: 0x%lx > 0xffff" +msgstr "%s: yerdeÄŸiÅŸim taÅŸması 1: 0x%lx > 0xffff" -#: peigen.c:995 pepigen.c:995 +#: peigen.c:993 pepigen.c:993 msgid "Export Directory [.edata (or where ever we found it)]" -msgstr "Ýhraç Dizini [.edata (veya nerede bulundu ise)]" +msgstr "Ä°hraç Dizini [.edata (veya nerede bulundu ise)]" -#: peigen.c:996 pepigen.c:996 +#: peigen.c:994 pepigen.c:994 msgid "Import Directory [parts of .idata]" -msgstr "Ýthal Dizini [.idata'nýn parçalarý]" +msgstr "Ä°thal Dizini [.idata'nın parçaları]" -#: peigen.c:997 pepigen.c:997 +#: peigen.c:995 pepigen.c:995 msgid "Resource Directory [.rsrc]" msgstr "Kaynak Dizini [.rsrc]" -#: peigen.c:998 pepigen.c:998 +#: peigen.c:996 pepigen.c:996 msgid "Exception Directory [.pdata]" -msgstr "Ýstisna Dizini [.pdata]" +msgstr "Ä°stisna Dizini [.pdata]" -#: peigen.c:999 pepigen.c:999 +#: peigen.c:997 pepigen.c:997 msgid "Security Directory" -msgstr "Güvenlik Dizini" +msgstr "Güvenlik Dizini" -#: peigen.c:1000 pepigen.c:1000 +#: peigen.c:998 pepigen.c:998 msgid "Base Relocation Directory [.reloc]" -msgstr "Temel Yerdeðiþim Dizini [.reloc]" +msgstr "Temel YerdeÄŸiÅŸim Dizini [.reloc]" -#: peigen.c:1001 pepigen.c:1001 +#: peigen.c:999 pepigen.c:999 msgid "Debug Directory" -msgstr "Hata Ayýklama Dizini" +msgstr "Hata Ayıklama Dizini" -#: peigen.c:1002 pepigen.c:1002 +#: peigen.c:1000 pepigen.c:1000 msgid "Description Directory" -msgstr "Açýklama Dizini" +msgstr "Açıklama Dizini" -#: peigen.c:1003 pepigen.c:1003 +#: peigen.c:1001 pepigen.c:1001 msgid "Special Directory" -msgstr "Özel Dizin" +msgstr "Özel Dizin" -#: peigen.c:1004 pepigen.c:1004 +#: peigen.c:1002 pepigen.c:1002 msgid "Thread Storage Directory [.tls]" msgstr "Dal Saklama Dizini [.tls]" -#: peigen.c:1005 pepigen.c:1005 +#: peigen.c:1003 pepigen.c:1003 msgid "Load Configuration Directory" -msgstr "Ayar Yükleme Dizini" +msgstr "Ayar Yükleme Dizini" -#: peigen.c:1006 pepigen.c:1006 +#: peigen.c:1004 pepigen.c:1004 msgid "Bound Import Directory" -msgstr "Sýnýr Ýthal Dizini" +msgstr "Sınır Ä°thal Dizini" -#: peigen.c:1007 pepigen.c:1007 +#: peigen.c:1005 pepigen.c:1005 msgid "Import Address Table Directory" -msgstr "Adres Tablosu Ýthal Dizini" +msgstr "Adres Tablosu Ä°thal Dizini" -#: peigen.c:1008 pepigen.c:1008 +#: peigen.c:1006 pepigen.c:1006 msgid "Delay Import Directory" -msgstr "Gecikmeli Ýthal Dizini" +msgstr "Gecikmeli Ä°thal Dizini" -#: peigen.c:1009 peigen.c:1010 pepigen.c:1009 pepigen.c:1010 +#: peigen.c:1007 peigen.c:1008 pepigen.c:1007 pepigen.c:1008 msgid "Reserved" -msgstr "Ayrýlmýþ" +msgstr "Ayrılmış" -#: peigen.c:1073 pepigen.c:1073 -msgid "\nThere is an import table, but the section containing it could not be found\n" -msgstr "\nBir ithal tablosu var, fakat onu içeren bölüm bulunamadý\n" +#: peigen.c:1071 pepigen.c:1071 +msgid "" +"\n" +"There is an import table, but the section containing it could not be found\n" +msgstr "" +"\n" +"Bir ithal tablosu var, fakat onu içeren bölüm bulunamadı\n" -#: peigen.c:1078 pepigen.c:1078 +#: peigen.c:1076 pepigen.c:1076 #, c-format -msgid "\nThere is an import table in %s at 0x%lx\n" -msgstr "\n%s içerisinde 0x%lx'de bir ithal tablosu var\n" +msgid "" +"\n" +"There is an import table in %s at 0x%lx\n" +msgstr "" +"\n" +"%s içerisinde 0x%lx'de bir ithal tablosu var\n" -#: peigen.c:1115 pepigen.c:1115 +#: peigen.c:1113 pepigen.c:1113 #, c-format -msgid "\nFunction descriptor located at the start address: %04lx\n" -msgstr "\nBaþlangýç adresinde iþlev betimleyicisi bulundu: %04lx\n" +msgid "" +"\n" +"Function descriptor located at the start address: %04lx\n" +msgstr "" +"\n" +"BaÅŸlangıç adresinde iÅŸlev betimleyicisi bulundu: %04lx\n" -#: peigen.c:1118 pepigen.c:1118 +#: peigen.c:1116 pepigen.c:1116 #, c-format msgid "\tcode-base %08lx toc (loadable/actual) %08lx/%08lx\n" -msgstr "\tkod temeli %08lx toc (yüklenebilir/gerçek) %08lx/%08lx\n" +msgstr "\tkod temeli %08lx toc (yüklenebilir/gerçek) %08lx/%08lx\n" -#: peigen.c:1124 pepigen.c:1124 -msgid "\nNo reldata section! Function descriptor not decoded.\n" -msgstr "\nReldata bölümü yok! Ýþlev betimleyicisi çözümlenemedi.\n" +#: peigen.c:1122 pepigen.c:1122 +msgid "" +"\n" +"No reldata section! Function descriptor not decoded.\n" +msgstr "" +"\n" +"Reldata bölümü yok! Ä°ÅŸlev betimleyicisi çözümlenemedi.\n" -#: peigen.c:1129 pepigen.c:1129 +#: peigen.c:1127 pepigen.c:1127 #, c-format -msgid "\nThe Import Tables (interpreted %s section contents)\n" -msgstr "\nÝthal Tablolarý (%s bölüm içeriði çözümlendi)\n" - -#: peigen.c:1132 pepigen.c:1132 -msgid " vma: Hint Time Forward DLL First\n" -msgstr " vma: Ýpucu Zaman Ýleri DLL Ýlk\n" +msgid "" +"\n" +"The Import Tables (interpreted %s section contents)\n" +msgstr "" +"\n" +"Ä°thal Tabloları (%s bölüm içeriÄŸi çözümlendi)\n" -#: peigen.c:1134 pepigen.c:1134 -msgid " Table Stamp Chain Name Thunk\n" -msgstr " Tablo Damga Zincir Ýsim Parça\n" +#: peigen.c:1130 pepigen.c:1130 +msgid "" +" vma: Hint Time Forward DLL First\n" +" Table Stamp Chain Name Thunk\n" +msgstr "" +" vma: Ä°pucu Zaman Ä°leri DLL Ä°lk\n" +" Tablo Damga Zincir Ä°sim Parça\n" -#: peigen.c:1182 pepigen.c:1182 +#: peigen.c:1181 pepigen.c:1181 #, c-format -msgid "\n\tDLL Name: %s\n" -msgstr "\n\tDLL Adý: %s\n" - -#: peigen.c:1186 peigen.c:1249 pepigen.c:1186 pepigen.c:1249 -msgid "\tvma: Hint/Ord Member-Name\n" -msgstr "\tvma: Ýpucu/Sýra Üye-Adý\n" - -#: peigen.c:1248 pepigen.c:1248 -msgid "\tThe Import Address Table (difference found)\n" -msgstr "\tÝthal Adres Tablosu (fark bulundu)\n" +msgid "" +"\n" +"\tDLL Name: %s\n" +msgstr "" +"\n" +"\tDLL Adı: %s\n" -#: peigen.c:1255 pepigen.c:1255 -msgid "\t>>> Ran out of IAT members!\n" -msgstr "\t>>> IAT üyeleri bitti!\n" +#: peigen.c:1192 pepigen.c:1192 +msgid "\tvma: Hint/Ord Member-Name Bound-To\n" +msgstr "\tvma: Ä°pucu/Sıra Ãœye-Adı Sınır\n" -#: peigen.c:1273 pepigen.c:1273 -msgid "\tThe Import Address Table is identical\n" -msgstr "\tÝthal Adres Tablosu ayný\n" +#: peigen.c:1217 pepigen.c:1217 +msgid "" +"\n" +"There is a first thunk, but the section containing it could not be found\n" +msgstr "" +"\n" +"Bir ilk parça var, fakat onu içeren bölüm bulunamadı\n" -#: peigen.c:1345 pepigen.c:1345 -msgid "\nThere is an export table, but the section containing it could not be found\n" -msgstr "\nBir ihraç tablosu var, fakat onu içeren bölüm bulunamadý\n" +#: peigen.c:1357 pepigen.c:1357 +msgid "" +"\n" +"There is an export table, but the section containing it could not be found\n" +msgstr "" +"\n" +"Bir ihraç tablosu var, fakat onu içeren bölüm bulunamadı\n" -#: peigen.c:1350 pepigen.c:1350 +#: peigen.c:1362 pepigen.c:1362 #, c-format -msgid "\nThere is an export table in %s at 0x%lx\n" -msgstr "\n%s içinde 0x%lx'de bir ihraç tablosu var\n" +msgid "" +"\n" +"There is an export table in %s at 0x%lx\n" +msgstr "" +"\n" +"%s içinde 0x%lx'de bir ihraç tablosu var\n" -#: peigen.c:1381 pepigen.c:1381 +#: peigen.c:1393 pepigen.c:1393 #, c-format -msgid "\nThe Export Tables (interpreted %s section contents)\n\n" -msgstr "\nÝhraç Tablolarý (%s bölüm içeriði çözümlendi)\n\n" +msgid "" +"\n" +"The Export Tables (interpreted %s section contents)\n" +"\n" +msgstr "" +"\n" +"Ä°hraç Tabloları (%s bölüm içeriÄŸi çözümlendi)\n" +"\n" -#: peigen.c:1385 pepigen.c:1385 +#: peigen.c:1397 pepigen.c:1397 #, c-format msgid "Export Flags \t\t\t%lx\n" -msgstr "Ýhraç Bayraklarý \t\t\t%lx\n" +msgstr "Ä°hraç Bayrakları \t\t\t%lx\n" -#: peigen.c:1388 pepigen.c:1388 +#: peigen.c:1400 pepigen.c:1400 #, c-format msgid "Time/Date stamp \t\t%lx\n" -msgstr "Saat/Tarih damgasý \t\t%lx\n" +msgstr "Saat/Tarih damgası \t\t%lx\n" -#: peigen.c:1391 pepigen.c:1391 +#: peigen.c:1403 pepigen.c:1403 #, c-format msgid "Major/Minor \t\t\t%d/%d\n" -msgstr "Majör/Minör \t\t\t%d/%d\n" +msgstr "Majör/Minör \t\t\t%d/%d\n" -#: peigen.c:1394 pepigen.c:1394 +#: peigen.c:1406 pepigen.c:1406 msgid "Name \t\t\t\t" -msgstr "Ýsim \t\t\t\t" +msgstr "Ä°sim \t\t\t\t" -#: peigen.c:1400 pepigen.c:1400 +#: peigen.c:1412 pepigen.c:1412 #, c-format msgid "Ordinal Base \t\t\t%ld\n" msgstr "Onluk Sistem \t\t\t%ld\n" -#: peigen.c:1403 pepigen.c:1403 +#: peigen.c:1415 pepigen.c:1415 msgid "Number in:\n" -msgstr "Sayý içinde:\n" +msgstr "Sayı içinde:\n" -#: peigen.c:1406 pepigen.c:1406 +#: peigen.c:1418 pepigen.c:1418 #, c-format msgid "\tExport Address Table \t\t%08lx\n" -msgstr "\tÝhraç Adres Tablosu \t\t%08lx\n" +msgstr "\tÄ°hraç Adres Tablosu \t\t%08lx\n" -#: peigen.c:1410 pepigen.c:1410 +#: peigen.c:1422 pepigen.c:1422 #, c-format msgid "\t[Name Pointer/Ordinal] Table\t%08lx\n" -msgstr "\t[Ýsim Gösterge/Onluk] Tablo\t%08lx\n" +msgstr "\t[Ä°sim Gösterge/Onluk] Tablo\t%08lx\n" -#: peigen.c:1413 pepigen.c:1413 +#: peigen.c:1425 pepigen.c:1425 msgid "Table Addresses\n" msgstr "Tablo Adresleri\n" -#: peigen.c:1416 pepigen.c:1416 +#: peigen.c:1428 pepigen.c:1428 msgid "\tExport Address Table \t\t" -msgstr "\tÝhraç Adres Tablosu \t\t" +msgstr "\tÄ°hraç Adres Tablosu \t\t" -#: peigen.c:1421 pepigen.c:1421 +#: peigen.c:1433 pepigen.c:1433 msgid "\tName Pointer Table \t\t" -msgstr "\tÝsim Gösterge Tablosu \t\t" +msgstr "\tÄ°sim Gösterge Tablosu \t\t" -#: peigen.c:1426 pepigen.c:1426 +#: peigen.c:1438 pepigen.c:1438 msgid "\tOrdinal Table \t\t\t" msgstr "\tOnluk Tablo \t\t\t" -#: peigen.c:1441 pepigen.c:1441 +#: peigen.c:1453 pepigen.c:1453 #, c-format -msgid "\nExport Address Table -- Ordinal Base %ld\n" -msgstr "\nÝhraç Adres Tablosu -- Onluk Sistem %ld\n" +msgid "" +"\n" +"Export Address Table -- Ordinal Base %ld\n" +msgstr "" +"\n" +"Ä°hraç Adres Tablosu -- Onluk Sistem %ld\n" -#: peigen.c:1460 pepigen.c:1460 +#: peigen.c:1472 pepigen.c:1472 msgid "Forwarder RVA" -msgstr "RVA Yönlendiricisi" +msgstr "RVA Yönlendiricisi" -#: peigen.c:1471 pepigen.c:1471 +#: peigen.c:1483 pepigen.c:1483 msgid "Export RVA" -msgstr "RVA Ýhracý" +msgstr "RVA Ä°hracı" -#: peigen.c:1478 pepigen.c:1478 -msgid "\n[Ordinal/Name Pointer] Table\n" -msgstr "\n[Onluk/Ýsim Gösterge] Tablosu\n" +#: peigen.c:1490 pepigen.c:1490 +msgid "" +"\n" +"[Ordinal/Name Pointer] Table\n" +msgstr "" +"\n" +"[Onluk/Ä°sim Gösterge] Tablosu\n" -#: peigen.c:1533 pepigen.c:1533 +#: peigen.c:1545 pepigen.c:1545 #, c-format msgid "Warning, .pdata section size (%ld) is not a multiple of %d\n" -msgstr "Uyarý, .pdata bölüm boyu (%ld) %d'nin katý deðil\n" +msgstr "Uyarı, .pdata bölüm boyu (%ld) %d'nin katı deÄŸil\n" -#: peigen.c:1537 pepigen.c:1537 -msgid "\nThe Function Table (interpreted .pdata section contents)\n" -msgstr "\nÝþlev Tablosu (.pdata bölüm içeriði çözümlendi)\n" +#: peigen.c:1549 pepigen.c:1549 +msgid "" +"\n" +"The Function Table (interpreted .pdata section contents)\n" +msgstr "" +"\n" +"Ä°ÅŸlev Tablosu (.pdata bölüm içeriÄŸi çözümlendi)\n" -#: peigen.c:1540 pepigen.c:1540 +#: peigen.c:1552 pepigen.c:1552 msgid " vma:\t\t\tBegin Address End Address Unwind Info\n" -msgstr " vma:\t\t\tBaþlangýç Adresi Sonlanma Adresi Geri Al Bilgisi\n" +msgstr " vma:\t\t\tBaÅŸlangıç Adresi Sonlanma Adresi Geri Al Bilgisi\n" -#: peigen.c:1543 pepigen.c:1543 -msgid " vma:\t\tBegin End EH EH PrologEnd Exception\n" -msgstr " vma:\t\tBaþl. Son EH EH PrologSon Ýstisna\n" - -#: peigen.c:1545 pepigen.c:1545 -msgid " \t\tAddress Address Handler Data Address Mask\n" -msgstr " \t\tAdres Adres Yön. Veri Adres Mask\n" +#: peigen.c:1554 pepigen.c:1554 +msgid "" +" vma:\t\tBegin End EH EH PrologEnd Exception\n" +" \t\tAddress Address Handler Data Address Mask\n" +msgstr "" +" vma:\t\tBaÅŸl. Son EH EH PrologSon Ä°stisna\n" +" \t\tAdres Adres Yakalay Veri Adres Maske\n" -#: peigen.c:1613 pepigen.c:1613 +#: peigen.c:1624 pepigen.c:1624 msgid " Register save millicode" msgstr " Yazma milikodunu kaydet" -#: peigen.c:1616 pepigen.c:1616 +#: peigen.c:1627 pepigen.c:1627 msgid " Register restore millicode" msgstr " Geri alma milikodunu kaydet" -#: peigen.c:1619 pepigen.c:1619 +#: peigen.c:1630 pepigen.c:1630 msgid " Glue code sequence" -msgstr " Birleþtirici kod dizisi" +msgstr " BirleÅŸtirici kod dizisi" -#: peigen.c:1671 pepigen.c:1671 -msgid "\n\nPE File Base Relocations (interpreted .reloc section contents)\n" -msgstr "\n\nPE Dosya Temel Yerdeðiþimi (.reloc bölüm içeriði çözümlendi)\n" +#: peigen.c:1682 pepigen.c:1682 +msgid "" +"\n" +"\n" +"PE File Base Relocations (interpreted .reloc section contents)\n" +msgstr "" +"\n" +"\n" +"PE Dosya Temel YerdeÄŸiÅŸimi (.reloc bölüm içeriÄŸi çözümlendi)\n" -#: peigen.c:1701 pepigen.c:1701 +#: peigen.c:1712 pepigen.c:1712 #, c-format -msgid "\nVirtual Address: %08lx Chunk size %ld (0x%lx) Number of fixups %ld\n" -msgstr "\nSanal Adres: %08lx Parça boyu %ld (0x%lx) Düzeltme Sayýsý %ld\n" +msgid "" +"\n" +"Virtual Address: %08lx Chunk size %ld (0x%lx) Number of fixups %ld\n" +msgstr "" +"\n" +"Sanal Adres: %08lx Parça boyu %ld (0x%lx) Düzeltme Sayısı %ld\n" -#: peigen.c:1714 pepigen.c:1714 +#: peigen.c:1725 pepigen.c:1725 #, c-format msgid "\treloc %4d offset %4x [%4lx] %s" -msgstr "\tyer deðiþim %4d göreli konum %4x [%4lx] %s" +msgstr "\tyer deÄŸiÅŸim %4d göreli konum %4x [%4lx] %s" #. The MS dumpbin program reportedly ands with 0xff0f before #. printing the characteristics field. Not sure why. No reason to #. emulate it here. -#: peigen.c:1754 pepigen.c:1754 +#: peigen.c:1765 pepigen.c:1765 #, c-format -msgid "\nCharacteristics 0x%x\n" -msgstr "\nÖzellikler 0x%x\n" +msgid "" +"\n" +"Characteristics 0x%x\n" +msgstr "" +"\n" +"Özellikler 0x%x\n" + +#~ msgid "GP relative relocation when GP not defined" +#~ msgstr "GP tanımlanmamışken GP göreli yer deÄŸiÅŸtirmesi" + +#~ msgid "%s: ERROR: passes floats in float registers whereas target %s uses integer registers" +#~ msgstr "%s: HATA: kayan sayıları kayan yazmaçlarda geçiriyor fakat hedef %s tamsayı yazmaç kullanıyor" + +#~ msgid "%s: ERROR: passes floats in integer registers whereas target %s uses float registers" +#~ msgstr "%s: HATA: kayan sayıları tamsayı yazmaçlarda geçiriyor fakat hedef %s kayan yazmaç kullanıyor" + +#~ msgid "Warning: input file %s supports interworking, whereas %s does not." +#~ msgstr "Uyarı: %s girdi dosyası beraber çalışmayı destekliyor, fakat %s desteklemiyor." + +#~ msgid "Warning: input file %s does not support interworking, whereas %s does." +#~ msgstr "Uyarı: %s girdi dosyası beraber çalışmayı desteklemiyor, fakat %s destekliyor." + +#~ msgid "AUX tagndx %ld ttlsiz 0x%lx lnnos %ld next %ld" +#~ msgstr "AUX tagndx %ld ttlsiz 0x%lx lnnos %ld sonraki %ld" + +#~ msgid "elf_symbol_from_bfd_symbol 0x%.8lx, name = %s, sym num = %d, flags = 0x%.8lx%s\n" +#~ msgstr "bfd sembolünden elf sembolü:0x%.8lx, isim= %s, sem num = %d, bayrak = 0x%.8lx%s\n" + +#~ msgid "Warning: Not setting interwork flag of %s since it has already been specified as non-interworking" +#~ msgstr "Uyarı: beraber çalışmaz diye önceden belirtilmiÅŸ olduÄŸundan %s'nin beraber çalışma bayrağı atanmadı" + +#~ msgid "Warning: Clearing the interwork flag of %s due to outside request" +#~ msgstr "Uyarı: Dış isteÄŸe uyularak %s'nin beraber çalışma bayrağı temizlendi" + +#~ msgid " [APCS-26]" +#~ msgstr " [APCS-26]" + +#~ msgid " [APCS-32]" +#~ msgstr " [APCS-32]" + +#~ msgid "(unknown)" +#~ msgstr "(bilinmeyen)" + +#~ msgid " previously %s in %s" +#~ msgstr " daha önce %2$s içinde %1$s" + +#~ msgid "ETIR_S_C_STO_GBL: no symbol \"%s\"" +#~ msgstr "ETIR_S_C_STO_GBL: sembol yok \"%s\"" + +#~ msgid "ETIR_S_C_STO_CA: no symbol \"%s\"" +#~ msgstr "ETIR_S_C_STO_CA: sembol yok \"%s\"" + +#~ msgid "ETIR_S_C_STO_RB/AB: Not supported" +#~ msgstr "ETIR_S_C_STO_RB/AB: Desteklenmiyor" + +#~ msgid "ETIR_S_C_STO_LP_PSB: Not supported" +#~ msgstr "ETIR_S_C_STO_LP_PSB: Desteklenmiyor" + +#~ msgid "ETIR_S_C_STO_HINT_GBL: not implemented" +#~ msgstr "ETIR_S_C_STO_HINT_GBL: tamamlanmamış" + +#~ msgid "ETIR_S_C_STO_HINT_PS: not implemented" +#~ msgstr "ETIR_S_C_STO_HINT_PS: tamamlanmamış" + +#~ msgid "ETIR_S_C_OPR_INSV: Not supported" +#~ msgstr "ETIR_S_C_OPR_INSV: Desteklenmiyor" + +#~ msgid "ETIR_S_C_OPR_USH: Not supported" +#~ msgstr "ETIR_S_C_OPR_USH: Desteklenmiyor" + +#~ msgid "ETIR_S_C_OPR_ROT: Not supported" +#~ msgstr "ETIR_S_C_OPR_ROT: Desteklenmiyor" + +#~ msgid "ETIR_S_C_OPR_REDEF: Not supported" +#~ msgstr "ETIR_S_C_OPR_REDEF: Desteklenmiyor" + +#~ msgid "ETIR_S_C_OPR_DFLIT: Not supported" +#~ msgstr "ETIR_S_C_OPR_DFLIT: Desteklenmiyor" + +#~ msgid "ETIR_S_C_STC_GBL: not supported" +#~ msgstr "ETIR_S_C_STC_GBL: desteklenmiyor" + +#~ msgid "ETIR_S_C_STC_GCA: not supported" +#~ msgstr "ETIR_S_C_STC_GCA: desteklenmiyor" + +#~ msgid "ETIR_S_C_STC_PS: not supported" +#~ msgstr "ETIR_S_C_STC_PS: desteklenmiyor" + +#~ msgid "Unimplemented STO cmd %d" +#~ msgstr "Tamamlanmamış STO komutu %d" + +#~ msgid "TIR_S_C_OPR_ASH incomplete" +#~ msgstr "TIR_S_C_OPR_ASH tamamlanmamış" + +#~ msgid "TIR_S_C_OPR_USH incomplete" +#~ msgstr "TIR_S_C_OPR_USH tamamlanmamış" + +#~ msgid "TIR_S_C_OPR_ROT incomplete" +#~ msgstr "TIR_S_C_OPR_ROT tamamlanmamış" + +#~ msgid "TIR_S_C_OPR_REDEF not supported" +#~ msgstr "TIR_S_C_OPR_REDEF desteklenmiyor" + +#~ msgid "TIR_S_C_OPR_DFLIT not supported" +#~ msgstr "TIR_S_C_OPR_DFLIT desteklenmiyor" + +#~ msgid "TIR_S_C_CTL_DFLOC not fully implemented" +#~ msgstr "TIR_S_C_CTL_DFLOC tamamlanmamış" + +#~ msgid "TIR_S_C_CTL_STLOC not fully implemented" +#~ msgstr "TIR_S_C_CTL_STLOC tamamlanmamış" + +#~ msgid "TIR_S_C_CTL_STKDL not fully implemented" +#~ msgstr "TIR_S_C_CTL_STKDL tamamlanmamış" + +#~ msgid " vma: Hint Time Forward DLL First\n" +#~ msgstr " vma: Ä°pucu Zaman Ä°leri DLL Ä°lk\n" + +#~ msgid "\tThe Import Address Table (difference found)\n" +#~ msgstr "\tÄ°thal Adres Tablosu (fark bulundu)\n" + +#~ msgid "\t>>> Ran out of IAT members!\n" +#~ msgstr "\t>>> IAT üyeleri bitti!\n" + +#~ msgid "\tThe Import Address Table is identical\n" +#~ msgstr "\tÄ°thal Adres Tablosu aynı\n" + +#~ msgid " \t\tAddress Address Handler Data Address Mask\n" +#~ msgstr " \t\tAdres Adres Yön. Veri Adres Mask\n" diff -Nurpa binutils-2.13/bfd/reloc.c binutils-2.13.1/bfd/reloc.c --- binutils-2.13/bfd/reloc.c 2002-06-25 02:21:54.000000000 -0400 +++ binutils-2.13.1/bfd/reloc.c 2002-10-28 13:45:46.000000000 -0500 @@ -2123,6 +2123,12 @@ ENUMX ENUMX BFD_RELOC_386_GOTPC ENUMX + BFD_RELOC_386_TLS_TPOFF +ENUMX + BFD_RELOC_386_TLS_IE +ENUMX + BFD_RELOC_386_TLS_GOTIE +ENUMX BFD_RELOC_386_TLS_LE ENUMX BFD_RELOC_386_TLS_GD @@ -3568,7 +3574,7 @@ const char * bfd_get_reloc_code_name (code) bfd_reloc_code_real_type code; { - if (code > BFD_RELOC_UNUSED) + if ((int) code > (int) BFD_RELOC_UNUSED) return 0; return bfd_reloc_code_real_names[(int)code]; } @@ -3696,7 +3702,7 @@ bfd_generic_get_relocated_section_conten /* We're not relaxing the section, so just copy the size info. */ input_section->_cooked_size = input_section->_raw_size; - input_section->reloc_done = true; + input_section->reloc_done = (unsigned int) true; reloc_count = bfd_canonicalize_reloc (input_bfd, input_section, diff -Nurpa binutils-2.13/bfd/section.c binutils-2.13.1/bfd/section.c --- binutils-2.13/bfd/section.c 2002-07-04 10:40:25.000000000 -0400 +++ binutils-2.13.1/bfd/section.c 2002-10-28 13:45:46.000000000 -0500 @@ -643,7 +643,8 @@ bfd_section_hash_newfunc (entry, table, subclass. */ if (entry == NULL) { - entry = bfd_hash_allocate (table, sizeof (struct section_hash_entry)); + entry = (struct bfd_hash_entry *) + bfd_hash_allocate (table, sizeof (struct section_hash_entry)); if (entry == NULL) return entry; } @@ -1186,7 +1187,7 @@ bfd_set_section_contents (abfd, section, /* Record a copy of the data in memory if desired. */ if (section->contents - && location != section->contents + offset) + && location != (PTR) (section->contents + offset)) memcpy (section->contents + offset, location, (size_t) count); if (BFD_SEND (abfd, _bfd_set_section_contents, diff -Nurpa binutils-2.13/bfd/srec.c binutils-2.13.1/bfd/srec.c --- binutils-2.13/bfd/srec.c 2002-06-25 02:21:54.000000000 -0400 +++ binutils-2.13.1/bfd/srec.c 2002-10-28 13:45:46.000000000 -0500 @@ -181,7 +181,7 @@ unsigned int Chunk = DEFAULT_CHUNK; /* The type of srec output (free or forced to S3). This variable can be modified by objcopy's --srec-forceS3 parameter. */ -boolean S3Forced = 0; +boolean S3Forced = false; /* When writing an S-record file, the S-records can not be output as they are seen. This structure is used to hold them in memory. */ @@ -230,22 +230,23 @@ static boolean srec_mkobject (abfd) bfd *abfd; { + bfd_size_type amt; + tdata_type *tdata; + srec_init (); - if (abfd->tdata.srec_data == NULL) - { - bfd_size_type amt = sizeof (tdata_type); - tdata_type *tdata = (tdata_type *) bfd_alloc (abfd, amt); - if (tdata == NULL) - return false; - abfd->tdata.srec_data = tdata; - tdata->type = 1; - tdata->head = NULL; - tdata->tail = NULL; - tdata->symbols = NULL; - tdata->symtail = NULL; - tdata->csymbols = NULL; - } + amt = sizeof (tdata_type); + tdata = (tdata_type *) bfd_alloc (abfd, amt); + if (tdata == NULL) + return false; + + abfd->tdata.srec_data = tdata; + tdata->type = 1; + tdata->head = NULL; + tdata->tail = NULL; + tdata->symbols = NULL; + tdata->symtail = NULL; + tdata->csymbols = NULL; return true; } @@ -640,6 +641,7 @@ static const bfd_target * srec_object_p (abfd) bfd *abfd; { + PTR tdata_save; bfd_byte b[4]; srec_init (); @@ -654,9 +656,14 @@ srec_object_p (abfd) return NULL; } - if (! srec_mkobject (abfd) - || ! srec_scan (abfd)) - return NULL; + tdata_save = abfd->tdata.any; + if (! srec_mkobject (abfd) || ! srec_scan (abfd)) + { + if (abfd->tdata.any != tdata_save && abfd->tdata.any != NULL) + bfd_release (abfd, abfd->tdata.any); + abfd->tdata.any = tdata_save; + return NULL; + } if (abfd->symcount > 0) abfd->flags |= HAS_SYMS; @@ -670,6 +677,7 @@ static const bfd_target * symbolsrec_object_p (abfd) bfd *abfd; { + PTR tdata_save; char b[2]; srec_init (); @@ -684,9 +692,14 @@ symbolsrec_object_p (abfd) return NULL; } - if (! srec_mkobject (abfd) - || ! srec_scan (abfd)) - return NULL; + tdata_save = abfd->tdata.any; + if (! srec_mkobject (abfd) || ! srec_scan (abfd)) + { + if (abfd->tdata.any != tdata_save && abfd->tdata.any != NULL) + bfd_release (abfd, abfd->tdata.any); + abfd->tdata.any = tdata_save; + return NULL; + } if (abfd->symcount > 0) abfd->flags |= HAS_SYMS; @@ -1190,7 +1203,7 @@ srec_get_symtab (abfd, alocation) csymbols = (asymbol *) bfd_alloc (abfd, symcount * sizeof (asymbol)); if (csymbols == NULL && symcount != 0) - return false; + return (long) false; abfd->tdata.srec_data->csymbols = csymbols; for (s = abfd->tdata.srec_data->symbols, c = csymbols; diff -Nurpa binutils-2.13/bfd/stabs.c binutils-2.13.1/bfd/stabs.c --- binutils-2.13/bfd/stabs.c 2002-06-06 05:24:56.000000000 -0400 +++ binutils-2.13.1/bfd/stabs.c 2002-10-28 13:45:46.000000000 -0500 @@ -331,7 +331,7 @@ _bfd_link_section_stabs (abfd, psinfo, s symbol, ignoring nesting, adding up all the characters in the symbol names, not including the file numbers in types (the first number after an open parenthesis). */ - if (type == N_BINCL) + if (type == (int) N_BINCL) { bfd_vma val; int nest; @@ -351,13 +351,13 @@ _bfd_link_section_stabs (abfd, psinfo, s incl_type = incl_sym[TYPEOFF]; if (incl_type == 0) break; - else if (incl_type == N_EINCL) + else if (incl_type == (int) N_EINCL) { if (nest == 0) break; --nest; } - else if (incl_type == N_BINCL) + else if (incl_type == (int) N_BINCL) ++nest; else if (nest == 0) { @@ -400,7 +400,7 @@ _bfd_link_section_stabs (abfd, psinfo, s goto error_return; ne->offset = sym - stabbuf; ne->val = val; - ne->type = N_BINCL; + ne->type = (int) N_BINCL; ne->next = secinfo->excls; secinfo->excls = ne; @@ -422,7 +422,7 @@ _bfd_link_section_stabs (abfd, psinfo, s /* We have seen this header file before. Tell the final pass to change the type to N_EXCL. */ - ne->type = N_EXCL; + ne->type = (int) N_EXCL; /* Mark the skipped symbols. */ @@ -435,7 +435,7 @@ _bfd_link_section_stabs (abfd, psinfo, s incl_type = incl_sym[TYPEOFF]; - if (incl_type == N_EINCL) + if (incl_type == (int) N_EINCL) { if (nest == 0) { @@ -445,7 +445,7 @@ _bfd_link_section_stabs (abfd, psinfo, s } --nest; } - else if (incl_type == N_BINCL) + else if (incl_type == (int) N_BINCL) ++nest; else if (nest == 0) { @@ -597,7 +597,7 @@ _bfd_discard_section_stabs (abfd, stabse type = sym[TYPEOFF]; - if (type == N_FUN) + if (type == (int) N_FUN) { int strx = bfd_get_32 (abfd, sym + STRDXOFF); @@ -624,7 +624,7 @@ _bfd_discard_section_stabs (abfd, stabse else if (deleting == -1) { /* Outside of a function. Check for deleted variables. */ - if (type == N_STSYM || type == N_LCSYM) + if (type == (int) N_STSYM || type == (int) N_LCSYM) if ((*reloc_symbol_deleted_p) (sym + VALOFF - stabbuf, cookie)) { *pstridx = -1; @@ -674,7 +674,7 @@ _bfd_discard_section_stabs (abfd, stabse BFD_ASSERT (offset != 0); } - return (skip > 0); + return (boolean) (skip > 0); error_return: if (stabbuf != NULL) diff -Nurpa binutils-2.13/bfd/syms.c binutils-2.13.1/bfd/syms.c --- binutils-2.13/bfd/syms.c 2002-07-05 16:29:38.000000000 -0400 +++ binutils-2.13.1/bfd/syms.c 2002-10-28 13:45:46.000000000 -0500 @@ -713,7 +713,7 @@ boolean bfd_is_undefined_symclass (symclass) int symclass; { - return symclass == 'U' || symclass == 'w' || symclass == 'v'; + return (boolean) (symclass == 'U' || symclass == 'w' || symclass == 'v'); } /* @@ -1069,7 +1069,7 @@ _bfd_stab_section_find_nearest_line (abf saw_fun = 1; for (stab = info->stabs; stab < info->stabs + stabsize; stab += STABSIZE) { - if (stab[TYPEOFF] == N_SO) + if (stab[TYPEOFF] == (bfd_byte) N_SO) { /* N_SO with null name indicates EOF */ if (bfd_get_32 (abfd, stab + STRDXOFF) == 0) @@ -1083,12 +1083,12 @@ _bfd_stab_section_find_nearest_line (abf /* two N_SO's in a row is a filename and directory. Skip */ if (stab + STABSIZE < info->stabs + stabsize - && *(stab + STABSIZE + TYPEOFF) == N_SO) + && *(stab + STABSIZE + TYPEOFF) == (bfd_byte) N_SO) { stab += STABSIZE; } } - else if (stab[TYPEOFF] == N_FUN) + else if (stab[TYPEOFF] == (bfd_byte) N_FUN) { saw_fun = 1; ++info->indextablesize; @@ -1157,7 +1157,7 @@ _bfd_stab_section_find_nearest_line (abf { last_stab = stab; if (stab + STABSIZE >= info->stabs + stabsize - || *(stab + STABSIZE + TYPEOFF) != N_SO) + || *(stab + STABSIZE + TYPEOFF) != (bfd_byte) N_SO) { directory_name = NULL; } diff -Nurpa binutils-2.13/bfd/targets.c binutils-2.13.1/bfd/targets.c --- binutils-2.13/bfd/targets.c 2002-07-01 04:31:52.000000000 -0400 +++ binutils-2.13.1/bfd/targets.c 2002-11-07 11:57:33.000000000 -0500 @@ -519,8 +519,8 @@ extern const bfd_target bfd_elf32_h8300_ extern const bfd_target bfd_elf32_hppa_linux_vec; extern const bfd_target bfd_elf32_hppa_vec; extern const bfd_target bfd_elf32_i370_vec; +extern const bfd_target bfd_elf32_i386_freebsd_vec; extern const bfd_target bfd_elf32_i386_vec; -extern const bfd_target bfd_elf32_i386qnx_vec; extern const bfd_target bfd_elf32_i860_little_vec; extern const bfd_target bfd_elf32_i860_vec; extern const bfd_target bfd_elf32_i960_vec; @@ -564,6 +564,7 @@ extern const bfd_target bfd_elf32_us_cri extern const bfd_target bfd_elf32_v850_vec; extern const bfd_target bfd_elf32_vax_vec; extern const bfd_target bfd_elf32_xstormy16_vec; +extern const bfd_target bfd_elf64_alpha_freebsd_vec; extern const bfd_target bfd_elf64_alpha_vec; extern const bfd_target bfd_elf64_big_generic_vec; extern const bfd_target bfd_elf64_bigmips_vec; @@ -781,8 +782,8 @@ static const bfd_target * const _bfd_tar &bfd_elf32_hppa_linux_vec, &bfd_elf32_hppa_vec, &bfd_elf32_i370_vec, + &bfd_elf32_i386_freebsd_vec, &bfd_elf32_i386_vec, - &bfd_elf32_i386qnx_vec, &bfd_elf32_i860_little_vec, &bfd_elf32_i860_vec, &bfd_elf32_i960_vec, @@ -831,6 +832,7 @@ static const bfd_target * const _bfd_tar &bfd_elf32_vax_vec, &bfd_elf32_xstormy16_vec, #ifdef BFD64 + &bfd_elf64_alpha_freebsd_vec, &bfd_elf64_alpha_vec, &bfd_elf64_big_generic_vec, &bfd_elf64_bigmips_vec, @@ -1245,7 +1247,9 @@ bfd_target_list () return NULL; for (target = &bfd_target_vector[0]; *target != NULL; target++) - *(name_ptr++) = (*target)->name; + if (target == &bfd_target_vector[0] + || *target != bfd_target_vector[0]) + *name_ptr++ = (*target)->name; return name_list; } diff -Nurpa binutils-2.13/bfd/versados.c binutils-2.13.1/bfd/versados.c --- binutils-2.13/bfd/versados.c 2002-06-04 23:43:11.000000000 -0400 +++ binutils-2.13.1/bfd/versados.c 2002-09-23 18:12:42.000000000 -0400 @@ -612,6 +612,7 @@ versados_object_p (abfd) { struct ext_vheader ext; unsigned char len; + tdata_type *tdata_save; if (bfd_seek (abfd, (file_ptr) 0, SEEK_SET) != 0) return NULL; @@ -642,9 +643,12 @@ versados_object_p (abfd) /* OK, looks like a record, build the tdata and read in. */ - if (!versados_mkobject (abfd) - || !versados_scan (abfd)) - return NULL; + tdata_save = abfd->tdata.versados_data; + if (!versados_mkobject (abfd) || !versados_scan (abfd)) + { + abfd->tdata.versados_data = tdata_save; + return NULL; + } return abfd->xvec; } diff -Nurpa binutils-2.13/bfd/version.h binutils-2.13.1/bfd/version.h --- binutils-2.13/bfd/version.h 2002-08-06 09:25:49.000000000 -0400 +++ binutils-2.13.1/bfd/version.h 2002-11-06 18:00:10.000000000 -0500 @@ -1 +1 @@ -#define BFD_VERSION_DATE 20020806 +#define BFD_VERSION_DATE 20021107 diff -Nurpa binutils-2.13/bfd/vms-gsd.c binutils-2.13.1/bfd/vms-gsd.c --- binutils-2.13/bfd/vms-gsd.c 2002-06-07 11:04:49.000000000 -0400 +++ binutils-2.13.1/bfd/vms-gsd.c 2002-11-05 23:34:59.000000000 -0500 @@ -420,7 +420,7 @@ _bfd_vms_slurp_gsd (abfd, objtype) { bfd_set_error (bfd_error_no_memory); return -1; - } + } } } else @@ -661,13 +661,13 @@ _bfd_vms_slurp_gsd (abfd, objtype) } else /* symbol reference */ { - symbol->name = + symbol->name = _bfd_vms_save_counted_string (vms_rec+8); #if VMS_DEBUG vms_debug(4, "egsd sym ref #%d (%s, %04x=%s)\n", abfd->symcount, symbol->name, old_flags, flag2str(gsyflagdesc, old_flags)); #endif - symbol->section = bfd_make_section (abfd, BFD_UND_SECTION_NAME); + symbol->section = bfd_make_section (abfd, BFD_UND_SECTION_NAME); } symbol->flags = new_flags; @@ -901,7 +901,7 @@ _bfd_vms_write_gsd (abfd, objtype) unsigned long ca_psindx = 0; unsigned long psindx; - if (old_flags & BSF_FUNCTION) + if ((old_flags & BSF_FUNCTION) && symbol->udata.p != NULL) { code_address = ((asymbol *) (symbol->udata.p))->value; ca_psindx = ((asymbol *) (symbol->udata.p))->section->index; diff -Nurpa binutils-2.13/bfd/vms-misc.c binutils-2.13.1/bfd/vms-misc.c --- binutils-2.13/bfd/vms-misc.c 2002-01-06 02:30:35.000000000 -0500 +++ binutils-2.13.1/bfd/vms-misc.c 2002-09-23 18:12:42.000000000 -0400 @@ -292,23 +292,23 @@ _bfd_vms_get_record (abfd) if (PRIV (buf_size) == 0) { + bfd_size_type amt; + if (PRIV (is_vax)) { - PRIV (vms_buf) = (unsigned char *) malloc (OBJ_S_C_MAXRECSIZ); - PRIV (buf_size) = OBJ_S_C_MAXRECSIZ; + amt = OBJ_S_C_MAXRECSIZ; PRIV (file_format) = FF_VAX; } else - PRIV (vms_buf) = (unsigned char *) malloc (6); + amt = 6; + PRIV (vms_buf) = (unsigned char *) bfd_malloc (amt); + PRIV (buf_size) = amt; } vms_buf = PRIV (vms_buf); if (vms_buf == 0) - { - bfd_set_error (bfd_error_no_memory); - return -1; - } + return -1; switch (PRIV (file_format)) { @@ -371,7 +371,7 @@ _bfd_vms_get_record (abfd) if (PRIV (is_vax)) { PRIV (rec_length) = bfd_bread (vms_buf, (bfd_size_type) PRIV (buf_size), - abfd); + abfd); if (PRIV (rec_length) <= 0) { bfd_set_error (bfd_error_file_truncated); @@ -383,7 +383,7 @@ _bfd_vms_get_record (abfd) { /* extract vms record length */ - _bfd_vms_get_header_values (abfd, vms_buf+test_start, NULL, + _bfd_vms_get_header_values (abfd, vms_buf + test_start, NULL, &PRIV (rec_length)); if (PRIV (rec_length) <= 0) @@ -405,13 +405,11 @@ _bfd_vms_get_record (abfd) if (PRIV (rec_length) > PRIV (buf_size)) { PRIV (vms_buf) = ((unsigned char *) - realloc (vms_buf, (size_t) PRIV (rec_length))); + bfd_realloc (vms_buf, + (bfd_size_type) PRIV (rec_length))); vms_buf = PRIV (vms_buf); if (vms_buf == 0) - { - bfd_set_error (bfd_error_no_memory); - return -1; - } + return -1; PRIV (buf_size) = PRIV (rec_length); } @@ -593,7 +591,8 @@ add_new_contents (abfd, section) if (sptr != NULL) return sptr; - newptr = (vms_section *) bfd_malloc ((bfd_size_type) sizeof (vms_section)); + newptr = (vms_section *) bfd_alloc (abfd, + (bfd_size_type) sizeof (vms_section)); if (newptr == (vms_section *) NULL) return NULL; newptr->contents = (unsigned char *) bfd_alloc (abfd, section->_raw_size); diff -Nurpa binutils-2.13/bfd/vms.c binutils-2.13.1/bfd/vms.c --- binutils-2.13/bfd/vms.c 2002-06-25 02:21:54.000000000 -0400 +++ binutils-2.13.1/bfd/vms.c 2002-11-05 23:34:59.000000000 -0500 @@ -238,13 +238,10 @@ vms_initialize (abfd) int i; bfd_size_type amt; - if (abfd->tdata.any != 0) - return true; - bfd_set_start_address (abfd, (bfd_vma) -1); amt = sizeof (struct vms_private_data_struct); - abfd->tdata.any = (struct vms_private_data_struct*) bfd_malloc (amt); + abfd->tdata.any = (struct vms_private_data_struct*) bfd_alloc (abfd, amt); if (abfd->tdata.any == 0) return false; @@ -261,49 +258,32 @@ vms_initialize (abfd) PRIV (sections) = NULL; amt = sizeof (struct stack_struct) * STACKSIZE; - PRIV (stack) = (struct stack_struct *) bfd_malloc (amt); + PRIV (stack) = (struct stack_struct *) bfd_alloc (abfd, amt); if (PRIV (stack) == 0) - { - vms_init_no_mem1: - free (abfd->tdata.any); - abfd->tdata.any = 0; - return false; - } + goto error_ret1; PRIV (stackptr) = 0; amt = sizeof (struct bfd_hash_table); - PRIV (vms_symbol_table) = (struct bfd_hash_table *) bfd_malloc (amt); + PRIV (vms_symbol_table) = (struct bfd_hash_table *) bfd_alloc (abfd, amt); if (PRIV (vms_symbol_table) == 0) - { - vms_init_no_mem2: - free (PRIV (stack)); - PRIV (stack) = 0; - goto vms_init_no_mem1; - } + goto error_ret1; if (!bfd_hash_table_init (PRIV (vms_symbol_table), _bfd_vms_hash_newfunc)) - return false; + goto error_ret1; amt = sizeof (struct location_struct) * LOCATION_SAVE_SIZE; - PRIV (location_stack) = (struct location_struct *) bfd_malloc (amt); + PRIV (location_stack) = (struct location_struct *) bfd_alloc (abfd, amt); if (PRIV (location_stack) == 0) - { - vms_init_no_mem3: - free (PRIV (vms_symbol_table)); - PRIV (vms_symbol_table) = 0; - goto vms_init_no_mem2; - } + goto error_ret2; for (i = 0; i < VMS_SECTION_COUNT; i++) PRIV (vms_section_table)[i] = NULL; - PRIV (output_buf) = (unsigned char *) malloc (MAX_OUTREC_SIZE); + amt = MAX_OUTREC_SIZE; + PRIV (output_buf) = (unsigned char *) bfd_alloc (abfd, amt); if (PRIV (output_buf) == 0) - { - free (PRIV (location_stack)); - PRIV (location_stack) = 0; - goto vms_init_no_mem3; - } + goto error_ret2; + PRIV (push_level) = 0; PRIV (pushed_size) = 0; PRIV (length_pos) = 2; @@ -311,6 +291,13 @@ vms_initialize (abfd) PRIV (output_alignment) = 1; return true; + + error_ret2: + bfd_hash_table_free (PRIV (vms_symbol_table)); + error_ret1: + bfd_release (abfd, abfd->tdata.any); + abfd->tdata.any = 0; + return false; } /* Fill symbol->section with section ptr @@ -394,22 +381,18 @@ vms_object_p (abfd) int prev_type; const struct bfd_target *target_vector = 0; const bfd_arch_info_type *arch = 0; + PTR tdata_save = abfd->tdata.any; + bfd_vma saddr_save = bfd_get_start_address (abfd); #if VMS_DEBUG vms_debug (1, "vms_object_p(%p)\n", abfd); #endif if (!vms_initialize (abfd)) - { - fprintf (stderr, "vms_initialize () failed !!\n"); - return 0; - } + goto error_ret; if (bfd_seek (abfd, (file_ptr) 0, SEEK_SET)) - { - bfd_set_error (bfd_error_file_truncated); - return 0; - } + goto err_wrong_format; prev_type = -1; @@ -423,8 +406,7 @@ vms_object_p (abfd) #if VMS_DEBUG vms_debug (2, "next_record failed\n"); #endif - bfd_set_error (bfd_error_wrong_format); - return 0; + goto err_wrong_format; } if ((prev_type == EOBJ_S_C_EGSD) @@ -435,8 +417,7 @@ vms_object_p (abfd) #if VMS_DEBUG vms_debug (2, "vms_fixup_sections failed\n"); #endif - bfd_set_error (bfd_error_wrong_format); - return 0; + goto err_wrong_format; } } @@ -488,8 +469,7 @@ vms_object_p (abfd) #if VMS_DEBUG vms_debug (2, "slurp type %d failed with %d\n", prev_type, err); #endif - bfd_set_error (bfd_error_wrong_format); - return 0; + goto err_wrong_format; } } while ((prev_type != EOBJ_S_C_EEOM) && (prev_type != OBJ_S_C_EOM) && (prev_type != OBJ_S_C_EOMW)); @@ -501,8 +481,7 @@ vms_object_p (abfd) #if VMS_DEBUG vms_debug (2, "vms_fixup_sections failed\n"); #endif - bfd_set_error (bfd_error_wrong_format); - return 0; + goto err_wrong_format; } /* set arch_info to vax */ @@ -529,12 +508,20 @@ vms_object_p (abfd) #if VMS_DEBUG vms_debug (2, "arch not found\n"); #endif - bfd_set_error (bfd_error_wrong_format); - return 0; + goto err_wrong_format; } abfd->arch_info = arch; return target_vector; + + err_wrong_format: + bfd_set_error (bfd_error_wrong_format); + error_ret: + if (abfd->tdata.any != tdata_save && abfd->tdata.any != NULL) + bfd_release (abfd, abfd->tdata.any); + abfd->tdata.any = tdata_save; + bfd_set_start_address (abfd, saddr_save); + return NULL; } /* Check the format for a file being read. @@ -562,10 +549,7 @@ vms_mkobject (abfd) #endif if (!vms_initialize (abfd)) - { - fprintf (stderr, "vms_initialize () failed !!\n"); - return 0; - } + return 0; { #ifdef __VAX @@ -646,10 +630,6 @@ static boolean vms_close_and_cleanup (abfd) bfd *abfd; { - asection *sec; - vms_section *es, *es1; - int i; - #if VMS_DEBUG vms_debug (1, "vms_close_and_cleanup(%p)\n", abfd); #endif @@ -657,63 +637,15 @@ vms_close_and_cleanup (abfd) return true; if (PRIV (vms_buf) != NULL) - { - free (PRIV (vms_buf)); - PRIV (vms_buf) = NULL; - } - PRIV (buf_size) = 0; - - if (PRIV (output_buf) != 0) - { - free (PRIV (output_buf)); - PRIV (output_buf) = 0; - } - - sec = abfd->sections; - while (sec != NULL) - { - if (sec->contents) - free (sec->contents); - sec = sec->next; - } + free (PRIV (vms_buf)); if (PRIV (sections) != NULL) - { - free (PRIV (sections)); - PRIV (sections) = NULL; - } + free (PRIV (sections)); if (PRIV (vms_symbol_table)) - { - bfd_hash_table_free (PRIV (vms_symbol_table)); - PRIV (vms_symbol_table) = 0; - } - - if (PRIV (stack)) - { - free (PRIV (stack)); - PRIV (stack) = 0; - } - - if (PRIV (location_stack)) - { - free (PRIV (location_stack)); - PRIV (location_stack) = 0; - } - - for (i = 0; i < VMS_SECTION_COUNT; i++) - { - es = PRIV (vms_section_table)[i]; - while (es != NULL) - { - es1 = es->next; - free (es); - es = es1; - } - PRIV (vms_section_table)[i] = NULL; - } + bfd_hash_table_free (PRIV (vms_symbol_table)); - free (abfd->tdata.any); + bfd_release (abfd, abfd->tdata.any); abfd->tdata.any = NULL; return true; diff -Nurpa binutils-2.13/bfd/xcofflink.c binutils-2.13.1/bfd/xcofflink.c --- binutils-2.13/bfd/xcofflink.c 2002-06-25 02:21:54.000000000 -0400 +++ binutils-2.13.1/bfd/xcofflink.c 2002-10-11 04:56:14.000000000 -0400 @@ -1986,6 +1986,7 @@ xcoff_link_add_symbols (abfd, info) && h->descriptor == NULL) { struct xcoff_link_hash_entry *hds; + struct bfd_link_hash_entry *bh; hds = xcoff_link_hash_lookup (xcoff_hash_table (info), h->root.root.string + 1, @@ -1994,13 +1995,14 @@ xcoff_link_add_symbols (abfd, info) goto error_return; if (hds->root.type == bfd_link_hash_new) { + bh = &hds->root; if (! (_bfd_generic_link_add_one_symbol (info, abfd, hds->root.root.string, (flagword) 0, bfd_und_section_ptr, (bfd_vma) 0, (const char *) NULL, false, - true, - (struct bfd_link_hash_entry **) &hds))) + true, &bh))) goto error_return; + hds = (struct xcoff_link_hash_entry *) bh; } hds->flags |= XCOFF_DESCRIPTOR; BFD_ASSERT ((hds->flags & XCOFF_CALLED) == 0 @@ -5887,7 +5889,10 @@ xcoff_write_global_symbol (h, inf) isym.n_value = (h->root.u.def.section->output_section->vma + h->root.u.def.section->output_offset + h->root.u.def.value); - isym.n_scnum = h->root.u.def.section->output_section->target_index; + if (bfd_is_abs_section (h->root.u.def.section->output_section)) + isym.n_scnum = N_ABS; + else + isym.n_scnum = h->root.u.def.section->output_section->target_index; isym.n_sclass = C_HIDEXT; aux.x_csect.x_smtyp = XTY_SD; diff -Nurpa binutils-2.13/binutils/ChangeLog binutils-2.13.1/binutils/ChangeLog --- binutils-2.13/binutils/ChangeLog 2002-07-30 14:18:08.000000000 -0400 +++ binutils-2.13.1/binutils/ChangeLog 2002-11-07 12:04:36.000000000 -0500 @@ -1,3 +1,48 @@ +2002-11-07 Nick Clifton + + * configure.in (LINGUAS): Add 'da'. + * configure: Regenerate. + * po/da.po: New Danish translation. + +2002-10-30 Daniel Jacobowitz + + * po/binutils.pot: Regenerated. + +2002-10-28 Daniel Jacobowitz + + Merge from mainline: + 2002-10-21 Alan Modra + * bucomm.c (list_supported_targets): Use bfd_target_list. + + 2002-10-09 Daniel Jacobowitz + * readelf.c (display_debug_info): Ignore empty .rela.debug_info + sections. Allow relocations against the absolute symbol. Don't + use the value in compunit.cu_abbrev_offset if we found a RELA + relocation. + +2002-10-21 Svein E. Seldal + + * objdump.c (dump_data): Correct addr_offset for opb != 1. + +2002-09-23 Daniel Jacobowitz + + Merge from mainline: + 2002-09-11 Nick Clifton + * po/tr.po: Updated Turkish translation. + + 2002-08-14 Luke Dunstan + * rcparse.y (acc_entry): Don't warn about ALT use with + non-VIRTKEY. + + 2002-08-09 Nick Clifton + * po/sv.po: Updated Swedish translation. + + 2002-07-31 Nick Clifton + * addr2line.c (process_file): Rename parameter 'filename' to + 'file_name' in order to avoid shadowing global symbol of the + same name. + (main): Likewise. + 2002-07-30 Daniel Jacobowitz Merge from mainline: @@ -14,7 +59,7 @@ * po/fr.po: Updated French translation. 2002-07-24 Nick Clifton - + * po/es.po: Updated Spanish translation. 2002-07-23 Daniel Jacobowitz @@ -132,7 +177,7 @@ 2002-06-18 Elias Athanasopoulos * nm.c (print_size_symbols): Remove assignment, which makes - the symbol's size equal to its value when --size-sort is + the symbol's size equal to its value when --size-sort is used. 2002-06-18 Dave Brolley @@ -192,7 +237,7 @@ DW_CFA_def_cfa_sf and DW_CFA_def_cfa_offset_sf. 2002-06-07 Elias Athanasopoulos - + * nm.c: When computing size of symbols for an ELF target use the internal size field. @@ -409,8 +454,8 @@ bfd_find_nearest_line is non-NULL. 2002-04-25 Elena Zannoni - - * readelf.c (get_AT_name): Handle DW_AT_GNU_vector. + + * readelf.c (get_AT_name): Handle DW_AT_GNU_vector. 2002-04-24 Christian Groessler @@ -436,11 +481,11 @@ 2002-04-15 Eric Kohl - * rcparse.y: Allow two to five parameter in FONT statement of + * rcparse.y: Allow two to five parameter in FONT statement of DIALOGEX resources. * resbin.c (bin_to_res_dialog): Fixed read/write code for dialogex resource data. - (res_to_bin_dialog): Likewise. + (res_to_bin_dialog): Likewise. * windres.h: Added misssing charset variable to dialog_ex structure. @@ -450,7 +495,7 @@ 2002-04-09 Bernd Herd - * rcparse.y: CLASS definitions in DIALOG resources + * rcparse.y: CLASS definitions in DIALOG resources are quoted. Fix typo in BEDIT warning. Don't add default dialog style when explicit style specified. @@ -563,10 +608,10 @@ 2002-02-18 Timothy Daly - * readelf.c (dump_relocations): Display 2nd and 3rd reloc - types for 64-bit MIPS. Narrow some fields for 80-char + * readelf.c (dump_relocations): Display 2nd and 3rd reloc + types for 64-bit MIPS. Narrow some fields for 80-char output. - (dump_relocations): Change spelling from 'unrecognised' + (dump_relocations): Change spelling from 'unrecognised' to 'unrecognized'. (decode_ARM_machine_flags): Likewise. (parse_args): Likewise. @@ -693,7 +738,7 @@ (main): Accept -H as an alias for --help. * objcopy.c (strip_main): Accept -H as an alias for --help. * objdump.c (main): Accept -v as an alias for --verbose. - * readelf.c (usage): Adjust format to match style used in + * readelf.c (usage): Adjust format to match style used in other binutils. * size.c (usage): Update text to provide verbose description of the command line options. @@ -745,9 +790,9 @@ 2002-01-15 Nick Clifton * objcopy.c (copy_usage): Use "options" instead of "switches". - (strip_usage): Use "options" instead of "switches". + (strip_usage): Use "options" instead of "switches". * doc/binutils.texi (dlltool): Refer to "options" instead of - "switches". + "switches". 2002-01-14 Richard Earnshaw @@ -1348,9 +1393,9 @@ 2001-08-03 John Healy - Patch suggested by Frank Eigler . - * objdump.c (disassemble_data): Fill in section member of the - disasm_info structure. + Patch suggested by Frank Eigler . + * objdump.c (disassemble_data): Fill in section member of the + disasm_info structure. 2001-08-03 Tom Walsh @@ -1368,18 +1413,18 @@ 2001-07-31 Nick Clifton - * objcopy.c: Fix formatting. - (section_rename): New structure. - (OPTION_RENAME_SECTION): New switch. - (copy_usage): Document new switch. - (add_section_rename): New function: Add a node to the section - rename list. - (find_section_rename): New function: Find the new name and - flags for a section. - (setup_section): Call find_section_name to determine the name - of the output section. - (copy_main): Handle OPTION_RENAME_SECTION. - * binutils.texi: Document new switch. + * objcopy.c: Fix formatting. + (section_rename): New structure. + (OPTION_RENAME_SECTION): New switch. + (copy_usage): Document new switch. + (add_section_rename): New function: Add a node to the section + rename list. + (find_section_rename): New function: Find the new name and + flags for a section. + (setup_section): Call find_section_name to determine the name + of the output section. + (copy_main): Handle OPTION_RENAME_SECTION. + * binutils.texi: Document new switch. * NEWS: Mention new switch. 2001-07-30 Nick Clifton @@ -1543,23 +1588,23 @@ 2001-06-18 H.J. Lu & Nick Clifton - * Makefile.am: Move documentation into doc subdirectory. - * Makefile.in: Regenerated. + * Makefile.am: Move documentation into doc subdirectory. + * Makefile.in: Regenerated. * binutils.texi: Move into doc subdirectory. - * addr2line.1: Removed. - * ar.1: Likewise. - * dlltool.1: Likewise. - * nlmconv.1: Likewise. - * nm.1: Likewise. - * objcopy.1: Likewise. - * objdump.1: Likewise. - * ranlib.1: Likewise. - * readelf.1: Likewise. - * size.1: Likewise. - * strings.1: Likewise. - * strip.1: Likewise. - * windres.1: Likewise. - * cxxfilt.man: Likewise. + * addr2line.1: Removed. + * ar.1: Likewise. + * dlltool.1: Likewise. + * nlmconv.1: Likewise. + * nm.1: Likewise. + * objcopy.1: Likewise. + * objdump.1: Likewise. + * ranlib.1: Likewise. + * readelf.1: Likewise. + * size.1: Likewise. + * strings.1: Likewise. + * strip.1: Likewise. + * windres.1: Likewise. + * cxxfilt.man: Likewise. * doc: New Directory. * doc/Makefile.am: New file. * doc/Makefile.in: Generate. @@ -1627,7 +1672,7 @@ 2001-04-27 Johan Rydberg - * NEWS: Announce support for OpenRISC. + * NEWS: Announce support for OpenRISC. 2001-04-17 Danny Smith diff -Nurpa binutils-2.13/binutils/addr2line.c binutils-2.13.1/binutils/addr2line.c --- binutils-2.13/binutils/addr2line.c 2002-07-02 00:21:24.000000000 -0400 +++ binutils-2.13.1/binutils/addr2line.c 2002-09-23 18:13:11.000000000 -0400 @@ -233,19 +233,19 @@ translate_addresses (abfd) /* Process a file. */ static void -process_file (filename, target) - const char *filename; +process_file (file_name, target) + const char *file_name; const char *target; { bfd *abfd; char **matching; - abfd = bfd_openr (filename, target); + abfd = bfd_openr (file_name, target); if (abfd == NULL) - bfd_fatal (filename); + bfd_fatal (file_name); if (bfd_check_format (abfd, bfd_archive)) - fatal (_("%s: can not get addresses from archive"), filename); + fatal (_("%s: can not get addresses from archive"), file_name); if (! bfd_check_format_matches (abfd, bfd_object, &matching)) { @@ -278,7 +278,7 @@ main (argc, argv) int argc; char **argv; { - const char *filename; + const char *file_name; char *target; int c; @@ -297,7 +297,7 @@ main (argc, argv) bfd_init (); set_default_bfd_target (); - filename = NULL; + file_name = NULL; target = NULL; while ((c = getopt_long (argc, argv, "b:Ce:sfHhVv", long_options, (int *) 0)) != EOF) @@ -324,7 +324,7 @@ main (argc, argv) } break; case 'e': - filename = optarg; + file_name = optarg; break; case 's': base_names = true; @@ -346,13 +346,13 @@ main (argc, argv) } } - if (filename == NULL) - filename = "a.out"; + if (file_name == NULL) + file_name = "a.out"; addr = argv + optind; naddr = argc - optind; - process_file (filename, target); + process_file (file_name, target); return 0; } diff -Nurpa binutils-2.13/binutils/bucomm.c binutils-2.13.1/binutils/bucomm.c --- binutils-2.13/binutils/bucomm.c 2002-06-08 03:38:30.000000000 -0400 +++ binutils-2.13.1/binutils/bucomm.c 2002-10-28 13:45:47.000000000 -0500 @@ -128,16 +128,18 @@ list_supported_targets (name, f) const char *name; FILE *f; { - extern const bfd_target *const *bfd_target_vector; int t; + const char **targ_names = bfd_target_list (); if (name == NULL) fprintf (f, _("Supported targets:")); else fprintf (f, _("%s: supported targets:"), name); - for (t = 0; bfd_target_vector[t] != NULL; t++) - fprintf (f, " %s", bfd_target_vector[t]->name); + + for (t = 0; targ_names[t] != NULL; t++) + fprintf (f, " %s", targ_names[t]); fprintf (f, "\n"); + free (targ_names); } /* List the supported architectures. */ diff -Nurpa binutils-2.13/binutils/configure binutils-2.13.1/binutils/configure --- binutils-2.13/binutils/configure 2002-06-20 22:41:52.000000000 -0400 +++ binutils-2.13.1/binutils/configure 2002-11-07 12:04:37.000000000 -0500 @@ -2717,7 +2717,7 @@ EOF fi -ALL_LINGUAS="fr tr ja es sv" +ALL_LINGUAS="fr tr ja es sv da" # Extract the first word of "ranlib", so it can be a program name with args. set dummy ranlib; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 diff -Nurpa binutils-2.13/binutils/configure.in binutils-2.13.1/binutils/configure.in --- binutils-2.13/binutils/configure.in 2002-06-20 22:41:51.000000000 -0400 +++ binutils-2.13.1/binutils/configure.in 2002-11-07 12:04:37.000000000 -0500 @@ -64,7 +64,7 @@ AC_PROG_CC AC_PROG_YACC AM_PROG_LEX -ALL_LINGUAS="fr tr ja es sv" +ALL_LINGUAS="fr tr ja es sv da" CY_GNU_GETTEXT AM_MAINTAINER_MODE diff -Nurpa binutils-2.13/binutils/doc/binutils.info binutils-2.13.1/binutils/doc/binutils.info --- binutils-2.13/binutils/doc/binutils.info 2002-08-06 09:31:31.000000000 -0400 +++ binutils-2.13.1/binutils/doc/binutils.info 2002-11-07 17:39:53.000000000 -0500 @@ -33,37 +33,37 @@ Free Documentation License".  Indirect: binutils.info-1: 1669 -binutils.info-2: 44263 -binutils.info-3: 92355 +binutils.info-2: 44265 +binutils.info-3: 92357  Tag Table: (Indirect) Node: Top1669 -Node: ar3166 -Node: ar cmdline5340 -Node: ar scripts13472 -Node: nm19151 -Node: objcopy26675 -Node: objdump44263 -Node: ranlib55864 -Node: size56615 -Node: strings59478 -Node: strip61777 -Node: c++filt64767 -Ref: c++filt-Footnote-167709 -Node: addr2line67815 -Node: nlmconv70409 -Node: windres73012 -Node: dlltool78064 -Node: readelf87512 -Node: Selecting The Target System91338 -Node: Target Selection92355 -Node: Architecture Selection95056 -Node: Linker Emulation Selection96301 -Node: Reporting Bugs97179 -Node: Bug Criteria97955 -Node: Bug Reporting98501 -Node: GNU Free Documentation License105528 -Node: Index123956 +Node: ar3168 +Node: ar cmdline5342 +Node: ar scripts13474 +Node: nm19153 +Node: objcopy26677 +Node: objdump44265 +Node: ranlib55866 +Node: size56617 +Node: strings59480 +Node: strip61779 +Node: c++filt64769 +Ref: c++filt-Footnote-167711 +Node: addr2line67817 +Node: nlmconv70411 +Node: windres73014 +Node: dlltool78066 +Node: readelf87514 +Node: Selecting The Target System91340 +Node: Target Selection92357 +Node: Architecture Selection95058 +Node: Linker Emulation Selection96303 +Node: Reporting Bugs97181 +Node: Bug Criteria97957 +Node: Bug Reporting98503 +Node: GNU Free Documentation License105530 +Node: Index123958  End Tag Table diff -Nurpa binutils-2.13/binutils/doc/binutils.info-1 binutils-2.13.1/binutils/doc/binutils.info-1 --- binutils-2.13/binutils/doc/binutils.info-1 2002-08-06 09:31:31.000000000 -0400 +++ binutils-2.13.1/binutils/doc/binutils.info-1 2002-11-07 17:39:53.000000000 -0500 @@ -37,7 +37,7 @@ Introduction ************ This brief manual contains preliminary documentation for the GNU -binary utilities (collectively version 2.13): +binary utilities (collectively version 2.13.1): This document is distributed under the terms of the GNU Free Documentation License. A copy of the license is included in the diff -Nurpa binutils-2.13/binutils/objdump.c binutils-2.13.1/binutils/objdump.c --- binutils-2.13/binutils/objdump.c 2002-07-02 00:21:24.000000000 -0400 +++ binutils-2.13.1/binutils/objdump.c 2002-10-20 22:23:25.000000000 -0400 @@ -2237,7 +2237,7 @@ dump_data (abfd) stop_offset = bfd_section_size (abfd, section) / opb; } for (addr_offset = start_offset; - addr_offset < stop_offset; addr_offset += onaline) + addr_offset < stop_offset; addr_offset += onaline / opb) { bfd_size_type j; @@ -2255,7 +2255,8 @@ dump_data (abfd) } printf (" "); - for (j = addr_offset; j < addr_offset * opb + onaline; j++) + for (j = addr_offset * opb; + j < addr_offset * opb + onaline; j++) { if (j >= stop_offset * opb) printf (" "); diff -Nurpa binutils-2.13/binutils/po/binutils.pot binutils-2.13.1/binutils/po/binutils.pot --- binutils-2.13/binutils/po/binutils.pot 2002-07-23 16:17:49.000000000 -0400 +++ binutils-2.13.1/binutils/po/binutils.pot 2002-10-30 11:29:42.000000000 -0500 @@ -1,12 +1,13 @@ # SOME DESCRIPTIVE TITLE. -# Copyright (C) YEAR Free Software Foundation, Inc. +# Copyright (C) YEAR THE PACKAGE'S COPYRIGHT HOLDER +# This file is distributed under the same license as the PACKAGE package. # FIRST AUTHOR , YEAR. # #, fuzzy msgid "" msgstr "" "Project-Id-Version: PACKAGE VERSION\n" -"POT-Creation-Date: 2002-07-23 15:55-0400\n" +"POT-Creation-Date: 2002-10-30 10:07-0500\n" "PO-Revision-Date: YEAR-MO-DA HO:MI+ZONE\n" "Last-Translator: FULL NAME \n" "Language-Team: LANGUAGE \n" @@ -43,7 +44,7 @@ msgid "" msgstr "" #: addr2line.c:89 ar.c:297 coffdump.c:479 nlmconv.c:1119 objcopy.c:424 -#: objcopy.c:457 readelf.c:2310 size.c:104 srconv.c:1962 strings.c:666 +#: objcopy.c:457 readelf.c:2313 size.c:104 srconv.c:1962 strings.c:666 #: sysdump.c:774 windres.c:733 #, c-format msgid "Report bugs to %s\n" @@ -54,7 +55,7 @@ msgstr "" msgid "%s: can not get addresses from archive" msgstr "" -#: addr2line.c:320 nm.c:395 objdump.c:2782 +#: addr2line.c:320 nm.c:395 objdump.c:2783 #, c-format msgid "unknown demangling style `%s'" msgstr "" @@ -346,16 +347,16 @@ msgstr "" msgid "%s: supported targets:" msgstr "" -#: bucomm.c:153 +#: bucomm.c:155 msgid "Supported architectures:" msgstr "" -#: bucomm.c:155 +#: bucomm.c:157 #, c-format msgid "%s: supported architectures:" msgstr "" -#: bucomm.c:262 +#: bucomm.c:264 #, c-format msgid "%s: bad number: %s" msgstr "" @@ -1516,17 +1517,17 @@ msgstr "" msgid "data size %ld" msgstr "" -#: nm.c:523 readelf.c:5306 readelf.c:5342 +#: nm.c:523 readelf.c:5391 readelf.c:5427 #, c-format msgid ": %d" msgstr "" -#: nm.c:525 readelf.c:5308 readelf.c:5354 +#: nm.c:525 readelf.c:5393 readelf.c:5439 #, c-format msgid ": %d" msgstr "" -#: nm.c:527 readelf.c:5310 readelf.c:5357 +#: nm.c:527 readelf.c:5395 readelf.c:5442 #, c-format msgid ": %d" msgstr "" @@ -2101,16 +2102,16 @@ msgstr "" msgid "Contents of section %s:\n" msgstr "" -#: objdump.c:2718 +#: objdump.c:2719 #, c-format msgid "BFD header file version %s\n" msgstr "" -#: objdump.c:2807 +#: objdump.c:2808 msgid "unrecognized -E option" msgstr "" -#: objdump.c:2818 +#: objdump.c:2819 #, c-format msgid "unrecognized --endian type `%s'" msgstr "" @@ -2296,15 +2297,15 @@ msgstr "" msgid "None" msgstr "" -#: readelf.c:2278 +#: readelf.c:2280 msgid "Usage: readelf elf-file(s)\n" msgstr "" -#: readelf.c:2279 +#: readelf.c:2281 msgid " Display information about the contents of ELF format files\n" msgstr "" -#: readelf.c:2280 +#: readelf.c:2282 msgid "" " Options are:\n" " -a --all Equivalent to: -h -l -S -s -r -d -V -A -I\n" @@ -2326,18 +2327,19 @@ msgid "" " -D --use-dynamic Use the dynamic section info when displaying " "symbols\n" " -x --hex-dump= Dump the contents of section \n" -" -w --debug-dump[=line,=info,=abbrev,=pubnames,=ranges,=macro,=frames,=str," +" -w[liaprmfFso] or\n" +" --debug-dump[=line,=info,=abbrev,=pubnames,=ranges,=macro,=frames,=str," "=loc]\n" " Display the contents of DWARF2 debug sections\n" msgstr "" -#: readelf.c:2301 +#: readelf.c:2304 msgid "" " -i --instruction-dump=\n" " Disassemble the contents of section \n" msgstr "" -#: readelf.c:2305 +#: readelf.c:2308 msgid "" " -I --histogram Display histogram of bucket list lengths\n" " -W --wide Allow output width to exceed 80 characters\n" @@ -2345,312 +2347,312 @@ msgid "" " -v --version Display the version number of readelf\n" msgstr "" -#: readelf.c:2327 +#: readelf.c:2330 msgid "Out of memory allocating dump request table." msgstr "" -#: readelf.c:2491 +#: readelf.c:2494 readelf.c:2570 #, c-format msgid "Unrecognized debug option '%s'\n" msgstr "" -#: readelf.c:2519 +#: readelf.c:2604 #, c-format msgid "Invalid option '-%c'\n" msgstr "" -#: readelf.c:2532 +#: readelf.c:2617 msgid "Nothing to do.\n" msgstr "" -#: readelf.c:2545 readelf.c:2562 readelf.c:4867 +#: readelf.c:2630 readelf.c:2647 readelf.c:4952 msgid "none" msgstr "" -#: readelf.c:2549 readelf.c:2566 readelf.c:2594 +#: readelf.c:2634 readelf.c:2651 readelf.c:2679 #, c-format msgid "" msgstr "" -#: readelf.c:2563 +#: readelf.c:2648 msgid "2's complement, little endian" msgstr "" -#: readelf.c:2564 +#: readelf.c:2649 msgid "2's complement, big endian" msgstr "" -#: readelf.c:2591 +#: readelf.c:2676 msgid "Standalone App" msgstr "" -#: readelf.c:2609 +#: readelf.c:2694 msgid "Not an ELF file - it has the wrong magic bytes at the start\n" msgstr "" -#: readelf.c:2617 +#: readelf.c:2702 msgid "ELF Header:\n" msgstr "" -#: readelf.c:2618 +#: readelf.c:2703 msgid " Magic: " msgstr "" -#: readelf.c:2622 +#: readelf.c:2707 #, c-format msgid " Class: %s\n" msgstr "" -#: readelf.c:2624 +#: readelf.c:2709 #, c-format msgid " Data: %s\n" msgstr "" -#: readelf.c:2626 +#: readelf.c:2711 #, c-format msgid " Version: %d %s\n" msgstr "" -#: readelf.c:2633 +#: readelf.c:2718 #, c-format msgid " OS/ABI: %s\n" msgstr "" -#: readelf.c:2635 +#: readelf.c:2720 #, c-format msgid " ABI Version: %d\n" msgstr "" -#: readelf.c:2637 +#: readelf.c:2722 #, c-format msgid " Type: %s\n" msgstr "" -#: readelf.c:2639 +#: readelf.c:2724 #, c-format msgid " Machine: %s\n" msgstr "" -#: readelf.c:2641 +#: readelf.c:2726 #, c-format msgid " Version: 0x%lx\n" msgstr "" -#: readelf.c:2644 +#: readelf.c:2729 msgid " Entry point address: " msgstr "" -#: readelf.c:2646 +#: readelf.c:2731 msgid "" "\n" " Start of program headers: " msgstr "" -#: readelf.c:2648 +#: readelf.c:2733 msgid "" " (bytes into file)\n" " Start of section headers: " msgstr "" -#: readelf.c:2650 +#: readelf.c:2735 msgid " (bytes into file)\n" msgstr "" -#: readelf.c:2652 +#: readelf.c:2737 #, c-format msgid " Flags: 0x%lx%s\n" msgstr "" -#: readelf.c:2655 +#: readelf.c:2740 #, c-format msgid " Size of this header: %ld (bytes)\n" msgstr "" -#: readelf.c:2657 +#: readelf.c:2742 #, c-format msgid " Size of program headers: %ld (bytes)\n" msgstr "" -#: readelf.c:2659 +#: readelf.c:2744 #, c-format msgid " Number of program headers: %ld\n" msgstr "" -#: readelf.c:2661 +#: readelf.c:2746 #, c-format msgid " Size of section headers: %ld (bytes)\n" msgstr "" -#: readelf.c:2663 +#: readelf.c:2748 #, c-format msgid " Number of section headers: %ld" msgstr "" -#: readelf.c:2668 +#: readelf.c:2753 #, c-format msgid " Section header string table index: %ld" msgstr "" -#: readelf.c:2702 readelf.c:2738 +#: readelf.c:2787 readelf.c:2823 msgid "program headers" msgstr "" -#: readelf.c:2772 +#: readelf.c:2857 msgid "" "\n" "There are no program headers in this file.\n" msgstr "" -#: readelf.c:2778 +#: readelf.c:2863 #, c-format msgid "" "\n" "Elf file type is %s\n" msgstr "" -#: readelf.c:2779 +#: readelf.c:2864 msgid "Entry point " msgstr "" -#: readelf.c:2781 +#: readelf.c:2866 #, c-format msgid "" "\n" "There are %d program headers, starting at offset " msgstr "" -#: readelf.c:2792 readelf.c:3019 readelf.c:3065 readelf.c:3128 readelf.c:3195 -#: readelf.c:4229 readelf.c:4272 readelf.c:4461 readelf.c:5414 readelf.c:5428 -#: readelf.c:9659 readelf.c:9699 +#: readelf.c:2877 readelf.c:3104 readelf.c:3150 readelf.c:3213 readelf.c:3280 +#: readelf.c:4314 readelf.c:4357 readelf.c:4546 readelf.c:5499 readelf.c:5513 +#: readelf.c:9747 readelf.c:9787 msgid "Out of memory\n" msgstr "" -#: readelf.c:2810 readelf.c:2812 +#: readelf.c:2895 readelf.c:2897 msgid "" "\n" "Program Headers:\n" msgstr "" -#: readelf.c:2816 +#: readelf.c:2901 msgid "" " Type Offset VirtAddr PhysAddr FileSiz MemSiz Flg Align\n" msgstr "" -#: readelf.c:2819 +#: readelf.c:2904 msgid "" " Type Offset VirtAddr PhysAddr FileSiz " "MemSiz Flg Align\n" msgstr "" -#: readelf.c:2823 +#: readelf.c:2908 msgid " Type Offset VirtAddr PhysAddr\n" msgstr "" -#: readelf.c:2825 +#: readelf.c:2910 msgid " FileSiz MemSiz Flags Align\n" msgstr "" -#: readelf.c:2925 +#: readelf.c:3010 msgid "more than one dynamic segment\n" msgstr "" -#: readelf.c:2933 +#: readelf.c:3018 msgid "Unable to find program interpreter name\n" msgstr "" -#: readelf.c:2940 +#: readelf.c:3025 #, c-format msgid "" "\n" " [Requesting program interpreter: %s]" msgstr "" -#: readelf.c:2958 +#: readelf.c:3043 msgid "" "\n" " Section to Segment mapping:\n" msgstr "" -#: readelf.c:2959 +#: readelf.c:3044 msgid " Segment Sections...\n" msgstr "" -#: readelf.c:3010 readelf.c:3056 +#: readelf.c:3095 readelf.c:3141 msgid "section headers" msgstr "" -#: readelf.c:3104 readelf.c:3171 +#: readelf.c:3189 readelf.c:3256 msgid "symbols" msgstr "" -#: readelf.c:3115 readelf.c:3182 +#: readelf.c:3200 readelf.c:3267 msgid "symtab shndx" msgstr "" -#: readelf.c:3284 +#: readelf.c:3369 msgid "" "\n" "There are no sections in this file.\n" msgstr "" -#: readelf.c:3290 +#: readelf.c:3375 #, c-format msgid "There are %d section headers, starting at offset 0x%lx:\n" msgstr "" -#: readelf.c:3307 readelf.c:3621 readelf.c:3968 readelf.c:5565 +#: readelf.c:3392 readelf.c:3706 readelf.c:4053 readelf.c:5650 msgid "string table" msgstr "" -#: readelf.c:3328 +#: readelf.c:3413 msgid "File contains multiple dynamic symbol tables\n" msgstr "" -#: readelf.c:3340 +#: readelf.c:3425 msgid "File contains multiple dynamic string tables\n" msgstr "" -#: readelf.c:3346 +#: readelf.c:3431 msgid "dynamic strings" msgstr "" -#: readelf.c:3352 +#: readelf.c:3437 msgid "File contains multiple symtab shndx tables\n" msgstr "" -#: readelf.c:3390 +#: readelf.c:3475 msgid "" "\n" "Section Headers:\n" msgstr "" -#: readelf.c:3392 +#: readelf.c:3477 msgid "" "\n" "Section Header:\n" msgstr "" -#: readelf.c:3396 +#: readelf.c:3481 msgid "" " [Nr] Name Type Addr Off Size ES Flg Lk " "Inf Al\n" msgstr "" -#: readelf.c:3399 +#: readelf.c:3484 msgid "" " [Nr] Name Type Address Off Size ES " "Flg Lk Inf Al\n" msgstr "" -#: readelf.c:3402 +#: readelf.c:3487 msgid " [Nr] Name Type Address Offset\n" msgstr "" -#: readelf.c:3403 +#: readelf.c:3488 msgid " Size EntSize Flags Link Info Align\n" msgstr "" -#: readelf.c:3498 +#: readelf.c:3583 msgid "" "Key to Flags:\n" " W (write), A (alloc), X (execute), M (merge), S (strings)\n" @@ -2658,500 +2660,500 @@ msgid "" " O (extra OS processing required) o (OS specific), p (processor specific)\n" msgstr "" -#: readelf.c:3559 +#: readelf.c:3644 #, c-format msgid "" "\n" "Relocation section at offset 0x%lx contains %ld bytes:\n" msgstr "" -#: readelf.c:3566 +#: readelf.c:3651 msgid "" "\n" "There are no dynamic relocations in this file.\n" msgstr "" -#: readelf.c:3593 +#: readelf.c:3678 msgid "" "\n" "Relocation section " msgstr "" -#: readelf.c:3598 readelf.c:4031 readelf.c:4045 +#: readelf.c:3683 readelf.c:4116 readelf.c:4130 #, c-format msgid "'%s'" msgstr "" -#: readelf.c:3600 readelf.c:4047 +#: readelf.c:3685 readelf.c:4132 #, c-format msgid " at offset 0x%lx contains %lu entries:\n" msgstr "" -#: readelf.c:3638 +#: readelf.c:3723 msgid "" "\n" "There are no relocations in this file.\n" msgstr "" -#: readelf.c:3834 +#: readelf.c:3919 msgid "unwind table" msgstr "" -#: readelf.c:3885 readelf.c:3897 readelf.c:7890 readelf.c:7901 +#: readelf.c:3970 readelf.c:3982 readelf.c:7977 readelf.c:7989 #, c-format msgid "Skipping unexpected symbol type %u\n" msgstr "" -#: readelf.c:3905 +#: readelf.c:3990 #, c-format msgid "Skipping unexpected relocation type %s\n" msgstr "" -#: readelf.c:3950 readelf.c:3975 +#: readelf.c:4035 readelf.c:4060 msgid "" "\n" "There are no unwind sections in this file.\n" msgstr "" -#: readelf.c:4026 +#: readelf.c:4111 msgid "" "\n" "Could not find unwind info section for " msgstr "" -#: readelf.c:4038 +#: readelf.c:4123 msgid "unwind info" msgstr "" -#: readelf.c:4040 +#: readelf.c:4125 msgid "" "\n" "Unwind section " msgstr "" -#: readelf.c:4213 readelf.c:4256 +#: readelf.c:4298 readelf.c:4341 msgid "dynamic segment" msgstr "" -#: readelf.c:4334 +#: readelf.c:4419 msgid "" "\n" "There is no dynamic segment in this file.\n" msgstr "" -#: readelf.c:4368 +#: readelf.c:4453 msgid "Unable to seek to end of file!" msgstr "" -#: readelf.c:4379 +#: readelf.c:4464 msgid "Unable to determine the number of symbols to load\n" msgstr "" -#: readelf.c:4409 +#: readelf.c:4494 msgid "Unable to seek to end of file\n" msgstr "" -#: readelf.c:4415 +#: readelf.c:4500 msgid "Unable to determine the length of the dynamic string table\n" msgstr "" -#: readelf.c:4420 +#: readelf.c:4505 msgid "dynamic string table" msgstr "" -#: readelf.c:4454 +#: readelf.c:4539 msgid "symbol information" msgstr "" -#: readelf.c:4478 +#: readelf.c:4563 #, c-format msgid "" "\n" "Dynamic segment at offset 0x%x contains %ld entries:\n" msgstr "" -#: readelf.c:4481 +#: readelf.c:4566 msgid " Tag Type Name/Value\n" msgstr "" -#: readelf.c:4517 +#: readelf.c:4602 msgid "Auxiliary library" msgstr "" -#: readelf.c:4521 +#: readelf.c:4606 msgid "Filter library" msgstr "" -#: readelf.c:4525 +#: readelf.c:4610 msgid "Configuration file" msgstr "" -#: readelf.c:4529 +#: readelf.c:4614 msgid "Dependency audit library" msgstr "" -#: readelf.c:4533 +#: readelf.c:4618 msgid "Audit library" msgstr "" -#: readelf.c:4551 readelf.c:4577 readelf.c:4603 +#: readelf.c:4636 readelf.c:4662 readelf.c:4688 msgid "Flags:" msgstr "" -#: readelf.c:4553 readelf.c:4579 readelf.c:4605 +#: readelf.c:4638 readelf.c:4664 readelf.c:4690 msgid " None\n" msgstr "" -#: readelf.c:4724 +#: readelf.c:4809 #, c-format msgid "Shared library: [%s]" msgstr "" -#: readelf.c:4727 +#: readelf.c:4812 msgid " program interpreter" msgstr "" -#: readelf.c:4731 +#: readelf.c:4816 #, c-format msgid "Library soname: [%s]" msgstr "" -#: readelf.c:4735 +#: readelf.c:4820 #, c-format msgid "Library rpath: [%s]" msgstr "" -#: readelf.c:4739 +#: readelf.c:4824 #, c-format msgid "Library runpath: [%s]" msgstr "" -#: readelf.c:4802 +#: readelf.c:4887 #, c-format msgid "Not needed object: [%s]\n" msgstr "" -#: readelf.c:4913 +#: readelf.c:4998 #, c-format msgid "" "\n" "Version definition section '%s' contains %ld entries:\n" msgstr "" -#: readelf.c:4916 +#: readelf.c:5001 msgid " Addr: 0x" msgstr "" -#: readelf.c:4918 readelf.c:5113 +#: readelf.c:5003 readelf.c:5198 #, c-format msgid " Offset: %#08lx Link: %lx (%s)\n" msgstr "" -#: readelf.c:4925 +#: readelf.c:5010 msgid "version definition section" msgstr "" -#: readelf.c:4951 +#: readelf.c:5036 #, c-format msgid " %#06x: Rev: %d Flags: %s" msgstr "" -#: readelf.c:4954 +#: readelf.c:5039 #, c-format msgid " Index: %d Cnt: %d " msgstr "" -#: readelf.c:4965 +#: readelf.c:5050 #, c-format msgid "Name: %s\n" msgstr "" -#: readelf.c:4967 +#: readelf.c:5052 #, c-format msgid "Name index: %ld\n" msgstr "" -#: readelf.c:4982 +#: readelf.c:5067 #, c-format msgid " %#06x: Parent %d: %s\n" msgstr "" -#: readelf.c:4985 +#: readelf.c:5070 #, c-format msgid " %#06x: Parent %d, name index: %ld\n" msgstr "" -#: readelf.c:5004 +#: readelf.c:5089 #, c-format msgid "" "\n" "Version needs section '%s' contains %ld entries:\n" msgstr "" -#: readelf.c:5007 +#: readelf.c:5092 msgid " Addr: 0x" msgstr "" -#: readelf.c:5009 +#: readelf.c:5094 #, c-format msgid " Offset: %#08lx Link to section: %ld (%s)\n" msgstr "" -#: readelf.c:5015 +#: readelf.c:5100 msgid "version need section" msgstr "" -#: readelf.c:5037 +#: readelf.c:5122 #, c-format msgid " %#06x: Version: %d" msgstr "" -#: readelf.c:5040 +#: readelf.c:5125 #, c-format msgid " File: %s" msgstr "" -#: readelf.c:5042 +#: readelf.c:5127 #, c-format msgid " File: %lx" msgstr "" -#: readelf.c:5044 +#: readelf.c:5129 #, c-format msgid " Cnt: %d\n" msgstr "" -#: readelf.c:5062 +#: readelf.c:5147 #, c-format msgid " %#06x: Name: %s" msgstr "" -#: readelf.c:5065 +#: readelf.c:5150 #, c-format msgid " %#06x: Name index: %lx" msgstr "" -#: readelf.c:5068 +#: readelf.c:5153 #, c-format msgid " Flags: %s Version: %d\n" msgstr "" -#: readelf.c:5104 +#: readelf.c:5189 msgid "version string table" msgstr "" -#: readelf.c:5108 +#: readelf.c:5193 #, c-format msgid "" "\n" "Version symbols section '%s' contains %d entries:\n" msgstr "" -#: readelf.c:5111 +#: readelf.c:5196 msgid " Addr: " msgstr "" -#: readelf.c:5121 +#: readelf.c:5206 msgid "version symbol data" msgstr "" -#: readelf.c:5148 +#: readelf.c:5233 msgid " 0 (*local*) " msgstr "" -#: readelf.c:5152 +#: readelf.c:5237 msgid " 1 (*global*) " msgstr "" -#: readelf.c:5187 readelf.c:5622 +#: readelf.c:5272 readelf.c:5707 msgid "version need" msgstr "" -#: readelf.c:5197 +#: readelf.c:5282 msgid "version need aux (2)" msgstr "" -#: readelf.c:5238 readelf.c:5684 +#: readelf.c:5323 readelf.c:5769 msgid "version def" msgstr "" -#: readelf.c:5257 readelf.c:5699 +#: readelf.c:5342 readelf.c:5784 msgid "version def aux" msgstr "" -#: readelf.c:5288 +#: readelf.c:5373 msgid "" "\n" "No version information found in this file.\n" msgstr "" -#: readelf.c:5420 +#: readelf.c:5505 msgid "Unable to read in dynamic data\n" msgstr "" -#: readelf.c:5462 +#: readelf.c:5547 msgid "Unable to seek to start of dynamic information" msgstr "" -#: readelf.c:5468 +#: readelf.c:5553 msgid "Failed to read in number of buckets\n" msgstr "" -#: readelf.c:5474 +#: readelf.c:5559 msgid "Failed to read in number of chains\n" msgstr "" -#: readelf.c:5494 +#: readelf.c:5579 msgid "" "\n" "Symbol table for image:\n" msgstr "" -#: readelf.c:5496 +#: readelf.c:5581 msgid " Num Buc: Value Size Type Bind Vis Ndx Name\n" msgstr "" -#: readelf.c:5498 +#: readelf.c:5583 msgid " Num Buc: Value Size Type Bind Vis Ndx Name\n" msgstr "" -#: readelf.c:5543 +#: readelf.c:5628 #, c-format msgid "" "\n" "Symbol table '%s' contains %lu entries:\n" msgstr "" -#: readelf.c:5547 +#: readelf.c:5632 msgid " Num: Value Size Type Bind Vis Ndx Name\n" msgstr "" -#: readelf.c:5549 +#: readelf.c:5634 msgid " Num: Value Size Type Bind Vis Ndx Name\n" msgstr "" -#: readelf.c:5595 +#: readelf.c:5680 msgid "version data" msgstr "" -#: readelf.c:5635 +#: readelf.c:5720 msgid "version need aux (3)" msgstr "" -#: readelf.c:5660 +#: readelf.c:5745 msgid "bad dynamic symbol" msgstr "" -#: readelf.c:5722 +#: readelf.c:5807 msgid "" "\n" "Dynamic symbol information is not available for displaying symbols.\n" msgstr "" -#: readelf.c:5734 +#: readelf.c:5819 #, c-format msgid "" "\n" "Histogram for bucket list length (total of %d buckets):\n" msgstr "" -#: readelf.c:5736 +#: readelf.c:5821 #, c-format msgid " Length Number %% of total Coverage\n" msgstr "" -#: readelf.c:5741 readelf.c:5760 readelf.c:9146 readelf.c:9338 +#: readelf.c:5826 readelf.c:5845 readelf.c:9234 readelf.c:9426 msgid "Out of memory" msgstr "" -#: readelf.c:5809 +#: readelf.c:5894 #, c-format msgid "" "\n" "Dynamic info segment at offset 0x%lx contains %d entries:\n" msgstr "" -#: readelf.c:5812 +#: readelf.c:5897 msgid " Num: Name BoundTo Flags\n" msgstr "" -#: readelf.c:5864 +#: readelf.c:5949 #, c-format msgid "" "\n" "Assembly dump of section %s\n" msgstr "" -#: readelf.c:5887 +#: readelf.c:5972 #, c-format msgid "" "\n" "Section '%s' has no data to dump.\n" msgstr "" -#: readelf.c:5892 +#: readelf.c:5977 #, c-format msgid "" "\n" "Hex dump of section '%s':\n" msgstr "" -#: readelf.c:5897 +#: readelf.c:5982 msgid "section data" msgstr "" -#: readelf.c:6046 +#: readelf.c:6131 msgid "badly formed extended line op encountered!\n" msgstr "" -#: readelf.c:6053 +#: readelf.c:6138 #, c-format msgid " Extended opcode %d: " msgstr "" -#: readelf.c:6058 +#: readelf.c:6143 msgid "" "End of Sequence\n" "\n" msgstr "" -#: readelf.c:6064 +#: readelf.c:6149 #, c-format msgid "set Address to 0x%lx\n" msgstr "" -#: readelf.c:6069 +#: readelf.c:6154 msgid " define new File Table entry\n" msgstr "" -#: readelf.c:6070 readelf.c:6199 +#: readelf.c:6155 readelf.c:6284 msgid " Entry\tDir\tTime\tSize\tName\n" msgstr "" -#: readelf.c:6072 +#: readelf.c:6157 #, c-format msgid " %d\t" msgstr "" -#: readelf.c:6075 readelf.c:6077 readelf.c:6079 readelf.c:6211 readelf.c:6213 -#: readelf.c:6215 +#: readelf.c:6160 readelf.c:6162 readelf.c:6164 readelf.c:6296 readelf.c:6298 +#: readelf.c:6300 #, c-format msgid "%lu\t" msgstr "" -#: readelf.c:6080 +#: readelf.c:6165 #, c-format msgid "" "%s\n" "\n" msgstr "" -#: readelf.c:6084 +#: readelf.c:6169 #, c-format msgid "UNKNOWN: length %d\n" msgstr "" -#: readelf.c:6110 +#: readelf.c:6195 #, c-format msgid "" "\n" @@ -3159,672 +3161,672 @@ msgid "" "\n" msgstr "" -#: readelf.c:6122 +#: readelf.c:6207 msgid "64-bit DWARF line info is not supported yet.\n" msgstr "" -#: readelf.c:6129 +#: readelf.c:6214 msgid "The line info appears to be corrupt - the section is too small\n" msgstr "" -#: readelf.c:6137 +#: readelf.c:6222 msgid "Only DWARF version 2 line info is currently supported.\n" msgstr "" -#: readelf.c:6152 +#: readelf.c:6237 #, c-format msgid " Length: %ld\n" msgstr "" -#: readelf.c:6153 +#: readelf.c:6238 #, c-format msgid " DWARF Version: %d\n" msgstr "" -#: readelf.c:6154 +#: readelf.c:6239 #, c-format msgid " Prologue Length: %d\n" msgstr "" -#: readelf.c:6155 +#: readelf.c:6240 #, c-format msgid " Minimum Instruction Length: %d\n" msgstr "" -#: readelf.c:6156 +#: readelf.c:6241 #, c-format msgid " Initial value of 'is_stmt': %d\n" msgstr "" -#: readelf.c:6157 +#: readelf.c:6242 #, c-format msgid " Line Base: %d\n" msgstr "" -#: readelf.c:6158 +#: readelf.c:6243 #, c-format msgid " Line Range: %d\n" msgstr "" -#: readelf.c:6159 +#: readelf.c:6244 #, c-format msgid " Opcode Base: %d\n" msgstr "" -#: readelf.c:6168 +#: readelf.c:6253 msgid "" "\n" " Opcodes:\n" msgstr "" -#: readelf.c:6171 +#: readelf.c:6256 #, c-format msgid " Opcode %d has %d args\n" msgstr "" -#: readelf.c:6177 +#: readelf.c:6262 msgid "" "\n" " The Directory Table is empty.\n" msgstr "" -#: readelf.c:6180 +#: readelf.c:6265 msgid "" "\n" " The Directory Table:\n" msgstr "" -#: readelf.c:6184 +#: readelf.c:6269 #, c-format msgid " %s\n" msgstr "" -#: readelf.c:6195 +#: readelf.c:6280 msgid "" "\n" " The File Name Table is empty.\n" msgstr "" -#: readelf.c:6198 +#: readelf.c:6283 msgid "" "\n" " The File Name Table:\n" msgstr "" -#: readelf.c:6206 +#: readelf.c:6291 #, c-format msgid " %d\t" msgstr "" -#: readelf.c:6217 +#: readelf.c:6302 #, c-format msgid "%s\n" msgstr "" #. Now display the statements. -#: readelf.c:6225 +#: readelf.c:6310 msgid "" "\n" " Line Number Statements:\n" msgstr "" -#: readelf.c:6241 +#: readelf.c:6326 #, c-format msgid " Special opcode %d: advance Address by %d to 0x%lx" msgstr "" -#: readelf.c:6245 +#: readelf.c:6330 #, c-format msgid " and Line by %d to %d\n" msgstr "" -#: readelf.c:6256 +#: readelf.c:6341 msgid " Copy\n" msgstr "" -#: readelf.c:6263 +#: readelf.c:6348 #, c-format msgid " Advance PC by %d to %lx\n" msgstr "" -#: readelf.c:6271 +#: readelf.c:6356 #, c-format msgid " Advance Line by %d to %d\n" msgstr "" -#: readelf.c:6278 +#: readelf.c:6363 #, c-format msgid " Set File Name to entry %d in the File Name Table\n" msgstr "" -#: readelf.c:6286 +#: readelf.c:6371 #, c-format msgid " Set column to %d\n" msgstr "" -#: readelf.c:6293 +#: readelf.c:6378 #, c-format msgid " Set is_stmt to %d\n" msgstr "" -#: readelf.c:6298 +#: readelf.c:6383 msgid " Set basic block\n" msgstr "" -#: readelf.c:6306 +#: readelf.c:6391 #, c-format msgid " Advance PC by constant %d to 0x%lx\n" msgstr "" -#: readelf.c:6314 +#: readelf.c:6399 #, c-format msgid " Advance PC by fixed size amount %d to 0x%lx\n" msgstr "" -#: readelf.c:6319 +#: readelf.c:6404 msgid " Set prologue_end to true\n" msgstr "" -#: readelf.c:6323 +#: readelf.c:6408 msgid " Set epilogue_begin to true\n" msgstr "" -#: readelf.c:6329 +#: readelf.c:6414 #, c-format msgid " Set ISA to %d\n" msgstr "" -#: readelf.c:6333 +#: readelf.c:6418 #, c-format msgid " Unknown opcode %d with operands: " msgstr "" -#: readelf.c:6365 readelf.c:6827 readelf.c:6899 +#: readelf.c:6450 readelf.c:6912 readelf.c:6984 #, c-format msgid "" "Contents of the %s section:\n" "\n" msgstr "" -#: readelf.c:6384 +#: readelf.c:6469 msgid "64-bit DWARF pubnames are not supported yet.\n" msgstr "" -#: readelf.c:6394 +#: readelf.c:6479 msgid "Only DWARF 2 pubnames are currently supported\n" msgstr "" -#: readelf.c:6401 +#: readelf.c:6486 #, c-format msgid " Length: %ld\n" msgstr "" -#: readelf.c:6403 +#: readelf.c:6488 #, c-format msgid " Version: %d\n" msgstr "" -#: readelf.c:6405 +#: readelf.c:6490 #, c-format msgid " Offset into .debug_info section: %ld\n" msgstr "" -#: readelf.c:6407 +#: readelf.c:6492 #, c-format msgid " Size of area in .debug_info section: %ld\n" msgstr "" -#: readelf.c:6410 +#: readelf.c:6495 msgid "" "\n" " Offset\tName\n" msgstr "" -#: readelf.c:6501 +#: readelf.c:6586 #, c-format msgid "Unknown TAG value: %lx" msgstr "" -#: readelf.c:6612 +#: readelf.c:6697 #, c-format msgid "Unknown AT value: %lx" msgstr "" -#: readelf.c:6649 +#: readelf.c:6734 #, c-format msgid "Unknown FORM value: %lx" msgstr "" -#: readelf.c:6848 +#: readelf.c:6933 #, c-format msgid " DW_MACINFO_start_file - lineno: %d filenum: %d\n" msgstr "" -#: readelf.c:6853 +#: readelf.c:6938 msgid " DW_MACINFO_end_file\n" msgstr "" -#: readelf.c:6861 +#: readelf.c:6946 #, c-format msgid " DW_MACINFO_define - lineno : %d macro : %s\n" msgstr "" -#: readelf.c:6869 +#: readelf.c:6954 #, c-format msgid " DW_MACINFO_undef - lineno : %d macro : %s\n" msgstr "" -#: readelf.c:6880 +#: readelf.c:6965 #, c-format msgid " DW_MACINFO_vendor_ext - constant : %d string : %s\n" msgstr "" -#: readelf.c:6908 +#: readelf.c:6993 msgid " Number TAG\n" msgstr "" -#: readelf.c:6914 +#: readelf.c:6999 #, c-format msgid " %ld %s [%s]\n" msgstr "" -#: readelf.c:6917 +#: readelf.c:7002 msgid "has children" msgstr "" -#: readelf.c:6917 +#: readelf.c:7002 msgid "no children" msgstr "" -#: readelf.c:6921 +#: readelf.c:7006 #, c-format msgid " %-18s %s\n" msgstr "" -#: readelf.c:6942 +#: readelf.c:7027 #, c-format msgid " %lu byte block: " msgstr "" -#: readelf.c:7265 +#: readelf.c:7350 msgid "(User defined location op)" msgstr "" -#: readelf.c:7267 +#: readelf.c:7352 msgid "(Unknown location op)" msgstr "" -#: readelf.c:7305 +#: readelf.c:7390 msgid "debug_loc section data" msgstr "" -#: readelf.c:7336 +#: readelf.c:7421 msgid "" "\n" "The .debug_loc section is empty.\n" msgstr "" -#: readelf.c:7339 +#: readelf.c:7424 msgid "" "Contents of the .debug_loc section:\n" "\n" msgstr "" -#: readelf.c:7340 +#: readelf.c:7425 msgid "" "\n" " Offset Begin End Expression\n" msgstr "" -#: readelf.c:7412 +#: readelf.c:7497 msgid "debug_str section data" msgstr "" -#: readelf.c:7431 +#: readelf.c:7516 msgid "" msgstr "" -#: readelf.c:7434 +#: readelf.c:7519 msgid "" msgstr "" -#: readelf.c:7454 +#: readelf.c:7539 msgid "" "\n" "The .debug_str section is empty.\n" msgstr "" -#: readelf.c:7458 +#: readelf.c:7543 msgid "" "Contents of the .debug_str section:\n" "\n" msgstr "" -#: readelf.c:7629 +#: readelf.c:7714 #, c-format msgid " (indirect string, offset: 0x%lx): " msgstr "" -#: readelf.c:7638 +#: readelf.c:7723 #, c-format msgid "Unrecognized form: %d\n" msgstr "" -#: readelf.c:7651 +#: readelf.c:7736 msgid "(not inlined)" msgstr "" -#: readelf.c:7652 +#: readelf.c:7737 msgid "(inlined)" msgstr "" -#: readelf.c:7653 +#: readelf.c:7738 msgid "(declared as inline but ignored)" msgstr "" -#: readelf.c:7654 +#: readelf.c:7739 msgid "(declared as inline and inlined)" msgstr "" -#: readelf.c:7655 +#: readelf.c:7740 #, c-format msgid " (Unknown inline attribute value: %lx)" msgstr "" -#: readelf.c:7826 readelf.c:8029 +#: readelf.c:7911 readelf.c:8117 #, c-format msgid "" "The section %s contains:\n" "\n" msgstr "" -#: readelf.c:7850 +#: readelf.c:7935 msgid "64-bit DWARF debug info is not supported yet.\n" msgstr "" -#: readelf.c:7919 +#: readelf.c:8007 #, c-format msgid " Compilation Unit @ %lx:\n" msgstr "" -#: readelf.c:7920 +#: readelf.c:8008 #, c-format msgid " Length: %ld\n" msgstr "" -#: readelf.c:7921 +#: readelf.c:8009 #, c-format msgid " Version: %d\n" msgstr "" -#: readelf.c:7922 +#: readelf.c:8010 #, c-format msgid " Abbrev Offset: %ld\n" msgstr "" -#: readelf.c:7923 +#: readelf.c:8011 #, c-format msgid " Pointer Size: %d\n" msgstr "" -#: readelf.c:7927 +#: readelf.c:8015 msgid "Only version 2 DWARF debug information is currently supported.\n" msgstr "" -#: readelf.c:7948 +#: readelf.c:8036 msgid "Unable to locate .debug_abbrev section!\n" msgstr "" -#: readelf.c:7954 +#: readelf.c:8042 msgid "debug_abbrev section data" msgstr "" -#: readelf.c:7991 +#: readelf.c:8079 #, c-format msgid "Unable to locate entry %lu in the abbreviation table\n" msgstr "" -#: readelf.c:7996 +#: readelf.c:8084 #, c-format msgid " <%d><%lx>: Abbrev Number: %lu (%s)\n" msgstr "" -#: readelf.c:8050 +#: readelf.c:8138 msgid "64-bit DWARF aranges are not supported yet.\n" msgstr "" -#: readelf.c:8056 +#: readelf.c:8144 msgid "Only DWARF 2 aranges are currently supported.\n" msgstr "" -#: readelf.c:8060 +#: readelf.c:8148 #, c-format msgid " Length: %ld\n" msgstr "" -#: readelf.c:8061 +#: readelf.c:8149 #, c-format msgid " Version: %d\n" msgstr "" -#: readelf.c:8062 +#: readelf.c:8150 #, c-format msgid " Offset into .debug_info: %lx\n" msgstr "" -#: readelf.c:8063 +#: readelf.c:8151 #, c-format msgid " Pointer Size: %d\n" msgstr "" -#: readelf.c:8064 +#: readelf.c:8152 #, c-format msgid " Segment Size: %d\n" msgstr "" -#: readelf.c:8066 +#: readelf.c:8154 msgid "" "\n" " Address Length\n" msgstr "" -#: readelf.c:8248 +#: readelf.c:8336 #, c-format msgid "The section %s contains:\n" msgstr "" -#: readelf.c:8271 +#: readelf.c:8359 msgid "64-bit DWARF format frames are not supported yet.\n" msgstr "" -#: readelf.c:8820 +#: readelf.c:8908 #, c-format msgid "Displaying the debug contents of section %s is not yet supported.\n" msgstr "" -#: readelf.c:8886 +#: readelf.c:8974 #, c-format msgid "" "\n" "Section '%s' has no debugging data.\n" msgstr "" -#: readelf.c:8891 readelf.c:8953 +#: readelf.c:8979 readelf.c:9041 msgid "debug section data" msgstr "" -#: readelf.c:8907 +#: readelf.c:8995 #, c-format msgid "Unrecognized debug section: %s\n" msgstr "" -#: readelf.c:8981 +#: readelf.c:9069 msgid "Some sections were not dumped because they do not exist!\n" msgstr "" -#: readelf.c:9054 readelf.c:9418 +#: readelf.c:9142 readelf.c:9506 msgid "liblist" msgstr "" -#: readelf.c:9139 +#: readelf.c:9227 msgid "options" msgstr "" -#: readelf.c:9170 +#: readelf.c:9258 #, c-format msgid "" "\n" "Section '%s' contains %d entries:\n" msgstr "" -#: readelf.c:9331 +#: readelf.c:9419 msgid "conflict list found without a dynamic symbol table" msgstr "" -#: readelf.c:9349 readelf.c:9365 +#: readelf.c:9437 readelf.c:9453 msgid "conflict" msgstr "" -#: readelf.c:9375 +#: readelf.c:9463 #, c-format msgid "" "\n" "Section '.conflict' contains %ld entries:\n" msgstr "" -#: readelf.c:9377 +#: readelf.c:9465 msgid " Num: Index Value Name" msgstr "" -#: readelf.c:9426 +#: readelf.c:9514 msgid "liblist string table" msgstr "" -#: readelf.c:9435 +#: readelf.c:9523 #, c-format msgid "" "\n" "Library list section '%s' contains %lu entries:\n" msgstr "" -#: readelf.c:9484 +#: readelf.c:9572 msgid "NT_PRSTATUS (prstatus structure)" msgstr "" -#: readelf.c:9485 +#: readelf.c:9573 msgid "NT_FPREGSET (floating point registers)" msgstr "" -#: readelf.c:9486 +#: readelf.c:9574 msgid "NT_PRPSINFO (prpsinfo structure)" msgstr "" -#: readelf.c:9487 +#: readelf.c:9575 msgid "NT_TASKSTRUCT (task structure)" msgstr "" -#: readelf.c:9488 +#: readelf.c:9576 msgid "NT_PRXFPREG (user_xfpregs structure)" msgstr "" -#: readelf.c:9489 +#: readelf.c:9577 msgid "NT_PSTATUS (pstatus structure)" msgstr "" -#: readelf.c:9490 +#: readelf.c:9578 msgid "NT_FPREGS (floating point registers)" msgstr "" -#: readelf.c:9491 +#: readelf.c:9579 msgid "NT_PSINFO (psinfo structure)" msgstr "" -#: readelf.c:9492 +#: readelf.c:9580 msgid "NT_LWPSTATUS (lwpstatus_t structure)" msgstr "" -#: readelf.c:9493 +#: readelf.c:9581 msgid "NT_LWPSINFO (lwpsinfo_t structure)" msgstr "" -#: readelf.c:9494 +#: readelf.c:9582 msgid "NT_WIN32PSTATUS (win32_pstatus structure)" msgstr "" -#: readelf.c:9496 readelf.c:9520 +#: readelf.c:9584 readelf.c:9608 #, c-format msgid "Unknown note type: (0x%08x)" msgstr "" #. NetBSD core "procinfo" structure. -#: readelf.c:9510 +#: readelf.c:9598 msgid "NetBSD procinfo structure" msgstr "" -#: readelf.c:9537 readelf.c:9551 +#: readelf.c:9625 readelf.c:9639 msgid "PT_GETREGS (reg structure)" msgstr "" -#: readelf.c:9539 readelf.c:9553 +#: readelf.c:9627 readelf.c:9641 msgid "PT_GETFPREGS (fpreg structure)" msgstr "" -#: readelf.c:9559 +#: readelf.c:9647 #, c-format msgid "PT_FIRSTMACH+%d" msgstr "" -#: readelf.c:9613 +#: readelf.c:9701 msgid "notes" msgstr "" -#: readelf.c:9619 +#: readelf.c:9707 #, c-format msgid "" "\n" "Notes at offset 0x%08lx with length 0x%08lx:\n" msgstr "" -#: readelf.c:9621 +#: readelf.c:9709 msgid " Owner\t\tData size\tDescription\n" msgstr "" -#: readelf.c:9640 +#: readelf.c:9728 #, c-format msgid "corrupt note found at offset %x into core notes\n" msgstr "" -#: readelf.c:9642 +#: readelf.c:9730 #, c-format msgid " type: %x, namesize: %08lx, descsize: %08lx\n" msgstr "" -#: readelf.c:9744 +#: readelf.c:9832 msgid "No note segments present in the core file.\n" msgstr "" -#: readelf.c:9822 +#: readelf.c:9910 msgid "" "This instance of readelf has been built without support for a\n" "64 bit data type and so it cannot read 64 bit ELF files.\n" msgstr "" -#: readelf.c:9868 +#: readelf.c:9956 #, c-format msgid "Cannot stat input file %s.\n" msgstr "" -#: readelf.c:9875 +#: readelf.c:9963 #, c-format msgid "Input file %s not found.\n" msgstr "" -#: readelf.c:9881 +#: readelf.c:9969 #, c-format msgid "%s: Failed to read file header\n" msgstr "" -#: readelf.c:9895 +#: readelf.c:9983 #, c-format msgid "" "\n" diff -Nurpa binutils-2.13/binutils/po/da.gmo binutils-2.13.1/binutils/po/da.gmo --- binutils-2.13/binutils/po/da.gmo 1969-12-31 19:00:00.000000000 -0500 +++ binutils-2.13.1/binutils/po/da.gmo 2002-11-07 17:39:59.000000000 -0500 @@ -0,0 +1,934 @@ +Þ•:ìO¼3øDùDE'E"FE+iE•E«E&½EäE ÿE F *FKF cF„F'œFÄFÝFìFýF(G(DG;mG6©GEàG&H +M8rM:«M8æM N-N4N<LN3‰N3½N:ñN/,OD\O2¡O4ÔO, P46P<kP5¨P7ÞP5Q3LQ€Q+˜Q8ÄQ9ýQ87R8pR+©R0ÕR0S27S'jS8’S"ËS0îS7THWTJ T9ëT7%UL]U7ªU2âUNV:dV?ŸV>ßV=W>\W6›W<ÒW7X8GX<€X<½XIúXNDY)“Y=½Y>ûY:ZMZ`ZwZ@ŽZ8ÏZ[[4[M[$_[„[œ[¸[Í[Ó['Ù[f\pha(Ùa +b b)b%Db.jb(™b +ÂbÍbèb"ðb(cen.¤n)Ón6ýnQ4o†o1£oÕo-ôo4"p5WpIp-×p2q8qJq8^q#—q$»qàq èqòq7r7?r,wr¤r0ºr+ër3s*Ksvs7}sµsÈs'ßst %t1tFt +[t#ftŠtŸt¤t¨t­t ÄtÎtétuu1uFu du!…u §u³uÓu(éuv7)v avov&‚v&©vÐvïv,w4wLw8`w&™wÀwÝwüw x)xCxUxrx$Žx'³xÛxóxyy)6y`y }yŠy!™y»yÏyìyzz -z=;z2yz +¬z·zÍz èz { *{ 4{B{]{,{{.¨{2×{- +|-8|f|y|—|°|Â|Ú|î|} !} /}=} L}Z}w} •}£}µ}Ò} î}ü}%~&=~$d~‰~¢~¿~×~ñ~&Ea}–®Â2à€/€C€V€p€‰€%§€Í€Þ€ø€+AWmƒœ¼Ûú‚B/‚:r‚­‚ ½‚Ê‚á‚ ó‚*ƒ+ƒ@ƒÒWƒ$*„#O„-s„-¡„+Ï„û„ +……(…C… V…b…r… Œ…&­…$Ô…&ù…N †>o†'®†Ö†æ†(‡)‡?‡R‡q‡‡È­‡vˆ!‹ˆ­ˆÁˆ׈숉4&‰[‰ m‰$y‰&ž‰"ʼn$è‰ Š .Š$OŠtŠ‘Š°ŠÏŠ`ìŠPM‹ž‹ ¯‹¹‹Ó‹ë‹ŒŒ+0Œ\Œ<aŒžŒ·ŒÇŒÙŒ.ôŒ.#7R?ŠÊä ŽŽ) Ž,JŽwŽŽŽ¼Ž׎öŽ 7Nf#–$ºßò +)'>#f9ŠÄ%Óù‘%‘?D‘„‘ž‘8¹‘wò‘”j’ÿ’ ““!-“"O“r“,†“;³“2ï“("”(K”5t”ª”Ç”+æ”!•4•T•q••.¯•Þ•ï• +– –8–O–k–‡–§– Ç– è–ô–(—6,—c—+ƒ—¯—5À—*ö—J!˜.l˜4›˜+И ü˜ ™-™@™X™k™|™š™­™¿™Ö™ æ™+š3šRš"qš”š(°š Ùš6úš1›O›'f›Ž›¥›"Ä›ç›ü›œ(8œaœ/vœ¦œÀœÔœèœ ñœ1 MY-`Ž + ¨¶É/ã1ž!Ež'gž'ž/·ž2çž7Ÿ+RŸ ~Ÿ1ŸŸ"ÑŸ+ôŸ'  &H #o )“ .½ ì #¡'¡*G¡r¡¡•¡¨¡ ¿¡Í¡Þ¡ ø¡¢¢'¢<¢L¢f¢€¢&›¢&¢ é¢! +£,£?£E£T£\£p£‚£ ‘£ž£ +²£½£ ϣܣ ö£)¤-¤B¤U¤(l¤4•¤ʤ-椥 .¥O¥k¥z¥Œ¥¢¥ª¥¼¥ Ö¥ã¥ ê¥ ö¥ ¦¦¦+¦;¦N¦c¦z¦‰¦¨¦¾¦ͦ$ঠ§§)§SD§ ˜§¦§¾§Ö§ í§+ú§&¨+¨1¨P¨a¨i¨-†¨#´¨ بå¨$õ¨© !© -©;©N© d© p©}© ©š©©©©Ù©ï©ªª(ª:ªIªNªiªxª#ˆª!¬ª ΪÛªùª «&«9«X«w«‹«ž« ¦«)³«Ý«û«¬%¬?¬'X¬)€¬.ª¬&Ù¬­ ­>­P­g­)…­&¯­Ö­.ð­(®.H®w®"’®µ®Æ®Ö®ï®¯'¯>¯S¯q¯Š¯'š¯*¯&í¯°%°E°\°z°˜°%µ°Û°ø°!±:±'Y±±“±¥±$Á±æ± ² ² ² (²4²D²4_² ”²¡²¶²˲à²õ² ³³.³2³';³&c³5Š³ À³'á³4 ´2>´ q´*~´©µ¾µ ×µ$øµ#¶A¶U¶&g¶Ž¶ §¶"´¶׶ò¶·"·7·W·n· }·(‹·-´·0â·=¸8Q¸NŠ¸Ù¸ í¸÷¸:¹4R¹2‡¹º¹?Ó¹$º+8º1dº,–º)úíº »8+»:d».Ÿ»0λ)ÿ»8)¼0b¼“¼7¬¼2ä¼2½J½D[½R ½ó½B¾BR¾>•¾>Ô¾;¿ O¿]¿d¿A|¿3¾¿4ò¿6'À4^ÀV“À6êÀ7!Á-YÁL‡ÁAÔÁBÂ<YÂ5–Â3ÌÂÃ*ÃCBÃ;†Ã7ÂÃ7úÃ22Ä3eÄ-™Ä4ÇÄ(üÄ;%Å#aÅ>…Å7ÄÅEüÅWBÆ6šÆ5ÑÆIÇ8QÇ6ŠÇVÁÇDÈE]È@£È<äÈ;!É3]É7‘É4ÉÉ<þÉ@;Ê>|ÊK»ÊJË0RË<ƒË:ÀËûËÌ!Ì8ÌAOÌ9‘ÌËÌãÌùÌÍ'$ÍLÍgÍ‚Í–ÍœÍ#¢ÍgÆÍn.Ó(Ó ÆÓÐÓðÓ"Ô)+Ô(UÔ ~ÔˆÔ ¤Ô"®Ô(ÑÔúÔ%Õ?Õ +VÕ aÕkÕ-rÕ Õ¹ÕÌÕ ãÕ+Ö#0Ö TÖ"uÖ"˜Ö(»Ö äÖ#ðÖC×;X×!”× ¶×)Ä×(î×(Ø+@Ø lØ-Ø!»ØÝØ"ýØ Ù0Ù$PÙuÙ"•Ù<¸Ù(õÙÚ5Ú/UÚ…Ú—ÚªÚÁÚàÚöÚ*Û0>Û0oÛ0 Û1ÑÛ6Ü>:Ü`yÜNÚÜ))Ý!SÝ*uÝ+ Ý+ÌÝøÝ1ÞCJÞQŽÞYàÞA:ß0|ß)­ß2×ßB +à9Mà,‡à*´à;ßà=á#Yá&}á¤á&Àá4çá>âF[â*¢â(Íâöâã8ã$Vã#{ãŸã¦ã¯ã)Æã<ðã+-äYä-oä*ä3Èä)üä&å5.å dårå(‘å$ºå ßåíåæ æ$ æEæWæ\æ`æeæ æ‰æ¥æÁæÙæõæ ç$(ç#Mç +qç!|çžç'³çÛç3øç,è;è+Rè,~è«èÉè9ãèé:é?Wé-—é Åéæéê!ê;êUêiê…ê$¢ê'Çêïêëë7ë5Këë¡ë²ë Êëëëì"ì<ìSìgì=vì9´ì +îìùì í"&í%Ií oíyíˆí¡í1½í7ïí7'î7_î7—îÏîâîïï/ïJïbï{ï –ï £ï °ï ¾ï&Ëï%òïð*ð&=ðdð}ð‘ð'ªð)Òð+üð(ñFñdñ~ñ™ñ¯ñ)Îñ"øñ"ò>òYòsò%‰ò4¯ò(äò ó*ó<óVóoó!ˆóªóÄóßóôóô+ô=ôUôjôô›ô·ôÖôôôHõ=]õ›õ ±õ½õÓõçõ+öõ"ö6öïTö$D÷%i÷0÷7À÷-ø÷&ø6ø<øRøkø zø„ø”ø!®ø1Ðø3ù.6ùPeù@¶ù'÷ù ú,ú"Húkú€ú•ú²úÏúÎïú¾û%Òûøûü,üGücü-‚ü°ü Áü Îü"ïü!ý#4ýXýxý#˜ý¼ýØýöýþ`2þP“þäþ ôþþþÿ8ÿMÿdÿ1~ÿ°ÿ>¶ÿõÿ23L0€;±Jí8Pm€4”BÉ '7U o§ÄÚñ ,=-jH˜Iá+ @L+a"<°í"þ!=PBp³Ë?äw$ œ= R`)p+šÆ,Ù79>'x, /Íý '5 ] #} ¡ &¿ &æ : +H +-Z +ˆ + +´ +Ê +é +!ÿ +! A  a n 2} 9° "ê . < 9N 4ˆ L½ 7 + 1B 't  œ  ¨ 2² å ý 9#]x¬$À-å##7([&„5«á.ÿ!.P,l™%³"Ùü)9-c‘9¨âþ1 :[w —£)ªÔèñ06;g"£*Æ)ñ15M=ƒ5Á!÷81R-„(²'Û$,(5U‹:¢ Ý'þ &4GZ u"•¸ÀÐáö#<)V(€©Éèú ÿ  ">a z‡ +š¥¶¿ Ø'æ"5/L6|$³+Ø"@ \iyŽž± Ì Ú çñ +.@Tj ‚­ÃÕ"ì +3WH ±Çá*; AMfw3|0°(á +%%K +\ gsŒ Ÿ «¸ÈÙí  7 N _ u  †  “ % à Õ &è '! 7!"C!f!y!’!!®!)Ð!ú!"#" ,"(9"b"}"“"«"Å")Þ"/#-8#"f#‰#¦# Á#Í#Þ#-ø#*&$Q$.h$(—$2À$ó$& %2%B%Q%g%|%'‹%³%É%ä%û%# +&(.&"W&z&&§&¶&Í&å&ú&'8'Q'k'&„'«'Ã'Û'*ø'#(A(U( j( w(„(–(3°( ä(ò( ) )6)J)])s)‡)‹).”)-Ã)<ñ)$.*.S*:‚*?½* ý*™^g%Wr4À° hÉŒµgïªõÀqé«zËÝn_26¤šg;a !jŸ\¯í$MA‰b÷¥~4 ÐòPyظ“‹%NiÈfh­Æö6R^ðxÐÈñ N©Ì–·_šopË$Õ_*cøÙ:R„‚ࡈ(•'F“mÙkŠ‚J/º÷©¢î´N[“#X¡*.îé+rÏY…mç*ás¼J%–Ö3³Óäù…E@3ãɺî’¥Ìk´•&7’jÇ! +,Î/ª}E£òô0?2Å Ä4D3ßB}Ö5‡ ¹aõâtEô•úc¿"(¼þÇV½ç6¨/«Uì—ÍæI+›9ϲÃúBSø]ŠØ(Tºï" Ã+{9)é¸|\~ôÎë1.¿„²YãóÂø¾ÊýÓÖ$p߬Ñ`”†V­žäiÛµwÒ–jH™¿ÿi¢v  AŸKpCå[6üx¤Ý"OðWè1Ç’ý‰¯d Âlo/?»>ï× Õ8uÜWf¶ÅH×K@)Ÿ¥!!}-RÞ»»ÄŽ)8Q˜q-¬˜‚ëM 2S@UÜ°=P ¡Qvž'‰tœÙ\LØT<£¨«#UöXµv(¼áÀI:´Û>½ >¦#†T4ÿOÁÊ +*,™ ±7¾|dÓßœâê‘üà„ +^5,ûÞ ' ÌF;tùÑ€Z8-IJÍÑlÝŽÒ&oŽ—`æì[ã 0Œ®G{Gˆ1IJá:c½ü+ñÞ±›:-.å~5®ÒÆ#­"õP¨—È”æ`ëó ¤GuL¢ܧ¹x£œäbåur‡ù·D‘Vm¦Õ÷&þ°zwMžÚkH.íˆ3Ô1óAÃ<X0'9¸¬Zí ‹CyD)BŒƒyþ®Qñ= §Cè±…aZ?³q†%É5›šö‘;·¹‹”d¾]©ê| w˜0S +ƒÁOhð=ýÛÚê³8òeŠâËÿ¯û]¦çÍF7s¶<zÁ$7nnflªúÎèàÚ‡,L§2ì&e ÆeÏÊs×ÐÅÔ{û9¶b€Ô€ƒKY + +Symbols from %s: + + + +Symbols from %s[%s]: + + + +Undefined symbols from %s: + + + +Undefined symbols from %s[%s]: + + + [Requesting program interpreter: %s] + Address Length + + Offset Name + + Start of program headers: + Line Number Statements: + + Opcodes: + + Section to Segment mapping: + + The Directory Table is empty. + + The Directory Table: + + The File Name Table is empty. + + The File Name Table: + + The following switches are optional: + +%s: file format %s + + + + +Archive index: + +Assembly dump of section %s + +Could not find unwind info section for +Dump of debug contents of section %s: + + +Dynamic info segment at offset 0x%lx contains %d entries: + +Dynamic segment at offset 0x%x contains %ld entries: + +Dynamic symbol information is not available for displaying symbols. + +Elf file type is %s + +File: %s + +Hex dump of section '%s': + +Histogram for bucket list length (total of %d buckets): + +No version information found in this file. + +Notes at offset 0x%08lx with length 0x%08lx: + +Relocation section +Relocation section at offset 0x%lx contains %ld bytes: + +Section '%s' contains %d entries: + +Section '%s' has no data to dump. + +Section '%s' has no debugging data. + +Section '.conflict' contains %ld entries: + +Symbol table '%s' contains %lu entries: + +Symbol table for image: + +The .debug_str section is empty. + +There are %d program headers, starting at offset +There are no dynamic relocations in this file. + +There are no program headers in this file. + +There are no relocations in this file. + +There are no sections in this file. + +There are no unwind sections in this file. + +There is no dynamic segment in this file. + +Unwind section +Version definition section '%s' contains %ld entries: + +Version needs section '%s' contains %ld entries: + +Version symbols section '%s' contains %d entries: + +start address 0x FileSiz MemSiz Flags Align + possible : arm[_interwork], i386, mcore[-elf]{-le|-be}, ppc, thumb + %s -M [ Don't export + --export-all-symbols Export all symbols to .def + --no-export-all-symbols Only export listed symbols + --yydebug Turn on parser debugging + %-18s %s + %d %ld %s [%s] + --add-indirect Add dll indirects to export file. + --add-stdcall-alias Add aliases without @ + --as Use for assembler + --base-file Read linker generated base file + --def Name input .def file + --dllname Name of input dll to put into output lib. + --dlltool-name Defaults to "dlltool" + --driver-flags Override default ld flags + --driver-name Defaults to "gcc" + --dry-run Show what needs to be run + --entry Specify alternate DLL entry point + --exclude-symbols Exclude from .def + --export-all-symbols Export all symbols to .def + --image-base Specify image base address + --implib Synonym for --output-lib + --machine + --mno-cygwin Create Mingw DLL + --no-default-excludes Zap default exclude symbols + --no-export-all-symbols Only export .drectve symbols + --no-idata4 Don't generate idata$4 section + --no-idata5 Don't generate idata$5 section + --nodelete Keep temp files. + --output-def Name output .def file + --output-exp Generate export file. + --output-lib Generate input library. + --quiet, -q Work quietly + --target i386-cygwin32 or i386-mingw32 + --verbose, -v Verbose + --version Print dllwrap version + -A --add-stdcall-alias Add aliases without @. + -C --compat-implib Create backward compatible import library. + -D --dllname Name of input dll to put into interface lib. + -F --linker-flags Pass to the linker. + -L --linker Use as the linker. + -M --mcore-elf Process mcore-elf object files into . + -S --as Use for assembler. + -U Add underscores to .lib + -U --add-underscore Add underscores to symbols in interface library. + -V --version Display the program version. + -a --add-indirect Add dll indirects to export file. + -b --base-file Read linker generated base file. + -c --no-idata5 Don't generate idata$5 section. + -d --input-def Name of .def file to be read in. + -e --output-exp Generate an export file. + -f --as-flags Pass to the assembler. + -h --help Display this information. + -k Kill @ from exported names + -k --kill-at Kill @ from exported names. + -l --output-lib Generate an interface library. + -m --machine Create as DLL for . [default: %s] + -n --no-delete Keep temp files (repeat for extra preservation). + -v --verbose Be verbose. + -x --no-idata4 Don't generate idata$4 section. + -z --output-def Name of .def file to be created. + 0 (*local*) 1 (*global*) Abbrev Offset: %ld + Length: %ld + Num: Value Size Type Bind Vis Ndx Name + Num: Value Size Type Bind Vis Ndx Name + Pointer Size: %d + Version: %d + %#06x: Name index: %lx %#06x: Name: %s %#06x: Parent %d, name index: %ld + %#06x: Parent %d: %s + %#06x: Rev: %d Flags: %s %#06x: Version: %d %d %s + (Unknown inline attribute value: %lx) -b, --target=BFDNAME Specify the target object format as BFDNAME + -m, --architecture=MACHINE Specify the target architecture as MACHINE + -j, --section=NAME Only display information for section NAME + -M, --disassembler-options=OPT Pass text OPT on to the disassembler + -EB --endian=big Assume big endian format when disassembling + -EL --endian=little Assume little endian format when disassembling + --file-start-context Include context from start of file (with -S) + -l, --line-numbers Include line numbers and filenames in output + -C, --demangle[=STYLE] Decode mangled/processed symbol names + The STYLE, if specified, can be `auto', 'gnu', + 'lucid', 'arm', 'hp', 'edg', or 'gnu-new-abi' + -w, --wide Format output for more than 80 columns + -z, --disassemble-zeroes Do not skip blocks of zeroes when disassembling + --start-address=ADDR Only process data whoes address is >= ADDR + --stop-address=ADDR Only process data whoes address is <= ADDR + --prefix-addresses Print complete address alongside disassembly + --[no-]show-raw-insn Display hex alongside symbolic disassembly + --adjust-vma=OFFSET Add OFFSET to all displayed section addresses + + -h --help Print this help message + -V --version Print version information + ABI Version: %d + Addr: 0x Advance Line by %d to %d + Advance PC by %d to %lx + Advance PC by constant %d to 0x%lx + Advance PC by fixed size amount %d to 0x%lx + Class: %s + Cnt: %d + Compilation Unit @ %lx: + Copy + DWARF Version: %d + Data: %s + Entry Dir Time Size Name + Entry point address: Extended opcode %d: File: %lx File: %s Flags Flags: 0x%lx%s + Flags: %s Version: %d + Generic options: + Index: %d Cnt: %d Initial value of 'is_stmt': %d + Length: %ld + Length: %ld + Length: %ld + Line Base: %d + Line Range: %d + Machine: %s + Magic: Minimum Instruction Length: %d + Num Buc: Value Size Type Bind Vis Ndx Name + Num Buc: Value Size Type Bind Vis Ndx Name + Num: Index Value Name Number TAG + Number of program headers: %ld + Number of section headers: %ld OS/ABI: %s + Offset into .debug_info section: %ld + Offset into .debug_info: %lx + Offset: %#08lx Link to section: %ld (%s) + Offset: %#08lx Link: %lx (%s) + Opcode %d has %d args + Opcode Base: %d + Options for %s: + Options passed to DLLTOOL: + Owner Data size Description + Pointer Size: %d + Prologue Length: %d + Rest are passed unmodified to the language driver + Section header string table index: %ld Segment Sections... + Segment Size: %d + Set File Name to entry %d in the File Name Table + Set ISA to %d + Set basic block + Set column to %d + Set epilogue_begin to true + Set is_stmt to %d + Set prologue_end to true + Size of area in .debug_info section: %ld + Size of program headers: %ld (bytes) + Size of section headers: %ld (bytes) + Size of this header: %ld (bytes) + Special opcode %d: advance Address by %d to 0x%lx Tag Type Name/Value + Type Offset VirtAddr PhysAddr + Type Offset VirtAddr PhysAddr FileSiz MemSiz Flg Align + Type Offset VirtAddr PhysAddr FileSiz MemSiz Flg Align + Type: %s + Unknown opcode %d with operands: Version: %d + Version: %d %s + Version: 0x%lx + Version: %d + [N] - use instance [count] of name + [Nr] Name Type Address Offset + [Nr] Name Type Addr Off Size ES Flg Lk Inf Al + [Nr] Name Type Address Off Size ES Flg Lk Inf Al + [P] - use full path names when matching + [S] - do not build a symbol table + [V] - display the version number + [a] - put file(s) after [member-name] + [b] - put file(s) before [member-name] (same as [i]) + [c] - do not warn if the library had to be created + [f] - truncate inserted file names + [o] - preserve original dates + [s] - create an archive index (cf. ranlib) + [u] - only replace files that are newer than current archive contents + [v] - be verbose + d - delete file(s) from the archive + define new File Table entry + m[ab] - move file(s) in the archive + p - print file(s) found in the archive + q[f] - quick append file(s) to the archive + r[ab][f][u] - replace existing or insert new file(s) into the archive + t - display contents of archive + x[o] - extract file(s) from the archive + %lu byte block: (bytes into file) + (bytes into file) + Start of section headers: (indirect string, offset: 0x%lx): <%d><%lx>: Abbrev Number: %lu (%s) + Addr: Addr: 0x Argument %s ignored At least one of the following switches must be given: + Convert an object file into a NetWare Loadable Module + DW_MACINFO_define - lineno : %d macro : %s + DW_MACINFO_end_file + DW_MACINFO_start_file - lineno: %d filenum: %d + DW_MACINFO_undef - lineno : %d macro : %s + DW_MACINFO_vendor_ext - constant : %d string : %s + Length Number %% of total Coverage + None + Num: Name BoundTo Flags + The options are: + and Line by %d to %d + at offset 0x%lx contains %lu entries: + command specific modifiers: + commands: + generic modifiers: + program interpreter#lines %d %ld: .bf without preceding function%ld: unexpected .ef +%lu %s +%s + +%s %s%c0x%s never used%s %s: %s%s both copied and removed%s exited with status %d%s has no %s section%s is not a valid archive%s is not an archive%s: %s: address out of bounds%s: Can't open input archive %s +%s: Can't open output archive %s +%s: Error: %s: Failed to read file header +%s: Matching formats:%s: Multiple redefinition of symbol "%s"%s: No dynamic symbols%s: Symbol "%s" is target of more than one redefinition%s: Warning: %s: bad number: %s%s: can not get addresses from archive%s: can't create debugging section: %s%s: can't find module file %s +%s: can't open file %s +%s: can't set debugging section contents: %s%s: cannot set time: %s%s: cannot stat: %s%s: don't know how to write debugging information for %s%s: error copying private BFD data: %s%s: execution of %s failed: %s: file %s is not an archive +%s: fread failed%s: fseek to %lu failed: %s%s: invalid output format%s: invalid radix%s: no archive map to update%s: no open output archive +%s: no output archive specified yet +%s: no recognized debugging information%s: no resource section%s: no symbols%s: not a dynamic object%s: not enough binary data%s: printing debugging information failed%s: read of %lu returned %lu%s: read: %s%s: rename: %s%s: section `%s': error in %s: %s%s: simple_copy: %s%s: supported architectures:%s: supported formats:%s: supported targets:%s: unexpected EOF%s: warning: %s: warning: shared libraries can not have uninitialized data%s: warning: unknown size for field `%s' in struct%s:%d: %s +(Unknown location op)(User defined location op)(declared as inline and inlined)(declared as inline but ignored)(inlined)(not inlined)2's complement, big endian2's complement, little endian64-bit DWARF aranges are not supported yet. +64-bit DWARF debug info is not supported yet. +64-bit DWARF format frames are not supported yet. +64-bit DWARF line info is not supported yet. +64-bit DWARF pubnames are not supported yet. +: duplicate value +: expected to be a directory +: expected to be a leaf +: %d: %d: %d: %lx: %xAdded exports to output fileAdding exports to output fileAudit libraryAuxiliary libraryBCD float type not supportedBFD header file version %s +Bad stab: %s +C++ base class not definedC++ base class not found in containerC++ data member not found in containerC++ default values not in a functionC++ object has no fieldsC++ reference is not pointerC++ reference not foundC++ static virtual methodCORE (Core file)Can't add padding to %s: %sCan't disassemble for architecture %s +Can't fill gap after %s: %sCan't have LIBRARY and NAMECan't open .lib file: %sCan't open def file: %sCan't open file %s +Can't use supplied machine %sCannot produce mcore-elf dll from archive file: %sCannot stat input file %s. +Cannot stat: %s: %sConfiguration fileContents of %s section: + +Contents of section %s: +Contents of the %s section: + +Contents of the .debug_str section: + +Created lib fileCreating library file: %sCreating stub file: %sCurrent open archive is %s +DLLTOOL name : %s +DLLTOOL options : %s +DRIVER name : %s +DRIVER options : %s +DYN (Shared object file)Deleting temporary base file %sDeleting temporary def file %sDeleting temporary exp file %sDependency audit libraryDisassembly of section %s: +Displaying the debug contents of section %s is not yet supported. +Don't know about relocations on this machine architecture +Done reading %sELF Header: +EXEC (Executable file)End of Sequence + +Entry point Error, duplicate EXPORT with oridinals: %sExcluding symbol: %sExecution of %s failedFORMAT is one of rc, res, or coff, and is deduced from the file name +extension if not specified. A single file name is an input file. +No input-file is stdin, default rc. No output-file is stdout, default rc. +Failed to read in number of buckets +Failed to read in number of chains +File contains multiple dynamic string tables +File contains multiple dynamic symbol tables +File contains multiple symtab shndx tables +Filter libraryFlags:Generated exports fileGenerating export file: %sID directory entryID resourceID subdirectoryIEEE numeric overflow: 0xIEEE string length overflow: %u +IEEE unsupported complex type size %u +IEEE unsupported float type size %u +IEEE unsupported integer type size %u +Idx Name Size VMA LMA File off AlgnIdx Name Size VMA LMA File off AlgnIgnoring rubbish found on line %d of %sIn archive %s: +Input file %s not found. +Internal error: Unknown machine type: %dInvalid option '-%c' +Invalid radix: %s +Keeping temporary base file %sKeeping temporary def file %sKeeping temporary exp file %sKey to Flags: + W (write), A (alloc), X (execute), M (merge), S (strings) + I (info), L (link order), G (group), x (unknown) + O (extra OS processing required) o (OS specific), p (processor specific) +LIBRARY: %s base: %xLast stabs entries before error: +Library rpath: [%s]Library runpath: [%s]Library soname: [%s]Machine '%s' not supportedMultiple renames of section %sMust provide at least one of -o or --dllname optionsNAME: %s base: %xNONE (None)NT_FPREGS (floating point registers)NT_FPREGSET (floating point registers)NT_LWPSINFO (lwpsinfo_t structure)NT_LWPSTATUS (lwpstatus_t structure)NT_PRPSINFO (prpsinfo structure)NT_PRSTATUS (prstatus structure)NT_PRXFPREG (user_xfpregs structure)NT_PSINFO (psinfo structure)NT_PSTATUS (pstatus structure)NT_TASKSTRUCT (task structure)N_LBRAC not within function +Name Value Class Type Size Line Section + +Name Value Class Type Size Line Section + +Name index: %ld +Name: %s +NetBSD procinfo structureNo %s section present + +No entry %s in archive. +No mangling for "%s" +No member named `%s' +No note segments present in the core file. +NoneNot an ELF file - it has the wrong magic bytes at the start +Not needed object: [%s] +Nothing to do. +OS Specific: (%x)Only -X 32_64 is supportedOnly DWARF 2 aranges are currently supported. +Only DWARF 2 pubnames are currently supported +Only DWARF version 2 line info is currently supported. +Only version 2 DWARF debug information is currently supported. +Opened temporary file: %sOperating System specific: %lxOut of memoryOut of memory +Out of memory allocating %d bytes for %s +Out of memory allocating dump request table.Out of virtual memoryPT_FIRSTMACH+%dPT_GETFPREGS (fpreg structure)PT_GETREGS (reg structure)Pascal file name not supportedProcessed def fileProcessed definitionsProcessing def file: %sProcessing definitionsProcessor Specific: %lxProcessor Specific: (%x)REL (Relocatable file)Reading %s section of %s failed: %sReading %s section of %s failed: %s +Report bugs to %s +Report bugs to %s. +Scanning object file %sSections: +Shared library: [%s]Skipping unexpected relocation type %s +Skipping unexpected symbol type %u +Some sections were not dumped because they do not exist! +Standalone AppSucking in info from %s section in %sSupported architectures:Supported targets:Syntax error in def file %s:%dThe line info appears to be corrupt - the section is too small +The section %s contains: +The section %s contains: + +There are %d section headers, starting at offset 0x%lx: +This instance of readelf has been built without support for a +64 bit data type and so it cannot read 64 bit ELF files. +This program is free software; you may redistribute it under the terms of +the GNU General Public License. This program has absolutely no warranty. +Too many N_RBRACs +Tried `%s' +Tried file: %sType file number %d out of range +Type index number %d out of range +UNKNOWN: length %d +Unable to change endianness of input file(s)Unable to determine the length of the dynamic string table +Unable to determine the number of symbols to load +Unable to find program interpreter name +Unable to locate .debug_abbrev section! +Unable to locate entry %lu in the abbreviation table +Unable to open base-file: %sUnable to open object file: %sUnable to open temporary assembler file: %sUnable to read in %d bytes of %s +Unable to read in dynamic data +Unable to seek to %x for %s +Unable to seek to end of file +Unable to seek to end of file!Unable to seek to start of dynamic informationUndefined N_EXCLUnhandled data length: %d +Unknown AT value: %lxUnknown FORM value: %lxUnknown TAG value: %lxUnknown note type: (0x%08x)Unrecognized XCOFF type %d +Unrecognized debug option '%s' +Unrecognized debug section: %s +Usage: %s [option(s)] [addr(s)] +Using `%s' +Using file: %sUsing popen to read preprocessor output +Using temporary file `%s' to read preprocessor output +Value for `N' must be positive.Warning, ignoring duplicate EXPORT %s %d,%dWarning: %s: %s +Warning: Output file cannot represent architecture %sWarning: changing type size from %d to %d +Warning: input target 'binary' required for binary architecture parameter.Warning: truncating gap-fill from 0x%s to 0x%x`N' is only meaningful with the `x' and `d' options.`u' is only meaningful with the `r' option.acceleratoralignmentalternate machine code index must be positivearchitecture %s unknownarchitecture: %s, bad ATN65 recordbad C++ field bit pos or sizebad dynamic symbolbad format for %sbad mangled name `%s' +bad misc recordbad type for C++ method functionbadly formed extended line op encountered! +bfd_coff_get_auxent failed: %sbfd_coff_get_syment failed: %sbfd_open failed open stub file: %sblocks left on stack at endbyte number must be less than interleavebyte number must be non-negativecan not determine type of file `%s'; use the -I optioncan't create section `%s': %scan't execute `%s': %scan't get BFD_RELOC_RVA relocation typecan't open %s `%s': %scan't open `%s' for output: %scan't open temporary file `%s': %scan't popen `%s': %scan't read resource sectioncan't redirect stdout: `%s': %scan't set BFD default target to `%s': %scannot delete %s: %scannot mkdir %s for archive copying (error: %s)cannot open input file %scannot open: %s: %scannot stat: %s: %sconflictconst/volatile indicator missingcontrol data requires DIALOGEXcopy from %s(%s) to %s(%s) +creating %scursorcursor file `%s' does not contain cursor datacustom sectiondata entrydata size %lddebug section datadebug_abbrev section datadebug_add_to_current_namespace: no current filedebug_end_block: attempt to close top level blockdebug_end_block: no current blockdebug_end_common_block: not implementeddebug_end_function: no current functiondebug_end_function: some blocks were not closeddebug_find_named_type: no current compilation unitdebug_get_real_type: circular debug information for %s +debug_make_undefined_type: unsupported kinddebug_name_type: no current filedebug_record_function: no debug_set_filename calldebug_record_line: no current unitdebug_record_parameter: no current functiondebug_record_variable: no current blockdebug_record_variable: no current filedebug_start_block: no current blockdebug_start_common_block: not implementeddebug_start_source: no debug_set_filename calldebug_str section datadebug_tag_type: extra tag attempteddebug_tag_type: no current filedebug_write_type: illegal type encountereddialog controldialog control datadialog control enddialog font point sizedialog headerdialogex controldialogex font informationdirectorydirectory entry namedynamic segmentdynamic string tabledynamic stringsexpression stack mismatchexpression stack overflowexpression stack underflowfailed to open temporary head file: %sfailed to open temporary tail file: %sfilename required for COFF inputfilename required for COFF outputfixed version infoflagsflags 0x%08x: +fontdirfontdir device namefontdir face namefontdir headergroup cursorgroup cursor headergroup icongroup icon headerhas childrenhelp ID requires DIALOGEXhelp sectionicon file `%s' does not contain icon dataillegal option -- %cillegal type indexillegal variable indexinput and output files must be differentinput file named both on command line and with INPUTinterleave must be positiveinternal error -- this option not implementedinternal stat error on %sinvalid argument to --format: %sinvalid integer argument %sinvalid numberinvalid number %sinvalid string lengthliblistmake .bss sectionmake .nlmsections sectionmake sectionmakingmenu headermenuex headermenuex offsetmenuitemmenuitem headermessage sectionmissing index typemissing required ASNmissing required ATN65module sectionmore than one dynamic segment +named directory entrynamed resourcenamed subdirectoryno argument types in mangled string +no childrenno entry %s in archive +no entry %s in archive %s!no export definition file provided. +Creating one, but that may not be what you wantno input fileno input file specifiedno name for output fileno operation specifiedno resourcesno type information for C++ method functionnonenotesnull terminated unicode stringnumeric overflowoptionsout of memory parsing relocsoverflow when adjusting relocation against %sparse_coff_type: Bad type code 0x%xprivate dataprogram headersreference parameter is not a pointerrelocsresource IDresource dataresource data sizeresource type unknownrpc sectionsection datasection headersset .bss vmaset .data sizeset .nlmsection contentsset .nlmsections flagsset .nlmsections sizeset Address to 0x%lx +set section flagsset section sizeset start addressshared sectionsizestab_int_type: bad size %ustack overflowstack underflowstat failed on bitmap file `%s': %sstat returns negative size for %sstring tablestring_hash_lookup failed: %sstringtable stringstringtable string lengthstub section sizessubprocess got fatal signal %dsupport not compiled in for %ssupported flags: %ssymbol informationsymbolssymtab shndxtwo different operation options specifiedunable to open output file %sundefined C++ objectundefined C++ vtableundefined variable in ATNundefined variable in TYunexpected end of debugging informationunexpected fixed version info version %luunexpected fixed version information length %dunexpected fixed version signature %luunexpected group cursor type %dunexpected group icon type %dunexpected numberunexpected record typeunexpected string in C++ miscunexpected stringfileinfo value length %dunexpected varfileinfo value length %dunexpected version stringunexpected version string length %d != %d + %dunexpected version string length %d < %dunexpected version stringtable value length %dunexpected version type %dunexpected version value length %dunknown ATN typeunknown BB typeunknown C++ encoded nameunknown C++ visibilityunknown TY codeunknown alternate machine code, ignoredunknown builtin typeunknown demangling style `%s'unknown format type `%s'unknown sectionunknown virtual character for baseclassunknown visibility character for baseclassunknown visibility character for fieldunnamed $vb typeunrecognized --endian type `%s'unrecognized -E optionunrecognized C++ abbreviationunrecognized C++ default typeunrecognized C++ misc recordunrecognized C++ object overhead specunrecognized C++ object specunrecognized C++ reference typeunrecognized cross reference typeunrecognized section flag `%s'unresolved PC relative reloc against %sunsupported ATN11unsupported ATN12unsupported C++ object typeunsupported IEEE expression operatorunsupported menu version %dunwind infounwind tableversion dataversion defversion def auxversion definition sectionversion length %d does not match resource length %luversion needversion need aux (2)version need aux (3)version need sectionversion string tableversion symbol dataversion var infoversion varfileinfovmawait: %swarning: CHECK procedure %s not definedwarning: EXIT procedure %s not definedwarning: MAP and FULLMAP are not supported; try ld -Mwarning: No version number givenwarning: START procedure %s not definedwarning: input and output formats are not compatiblewarning: symbol %s imported but not in import listwriting stubProject-Id-Version: binutils 2.12.91 +POT-Creation-Date: 2002-07-23 15:55-0400 +PO-Revision-Date: 2002-09-07 19:55+0200 +Last-Translator: Keld Simonsen +Language-Team: Danish +MIME-Version: 1.0 +Content-Type: text/plain; charset=iso-8859-1 +Content-Transfer-Encoding: 8bit + + +Symboler fra %s: + + + +Symboler fra %s[%s]: + + + +Udefinerede symboler fra %s: + + + +Udefinerede symboler fra %s[%s]: + + + [Anmoder programtolkere: %s] + adresselængde + + Offset Navn + + Start for programhoveder: + Linjenummersætninger: + + Op-koder: + + Sektion til segment-afbildning: + + Katalogtabellen er tom. + + Katalogtabellen: + + Filnavnstabellen er tom. + + Filnavnstabellen: + + Føljende flag er frivillige: + +%s: filformat %s + + + + +Arkivindex: + +Disassembleringsudskrift af sektion %s + +Kunne ikke finde tilbagerulningssektion til +Udskrift af fejlsøgningsindhold i sektion %s: + + +Dynamisk info-segment på offset 0x%lx indeholder %d poster: + +Dynamisk segment på offset 0x%x indeholder %ld poster: + +Informationen om dynamiske symboler er ikke tilgænglig til at vise symboler. + +Elf-filtype er %s + +Fil: %s + +Hex.udskrift af sektion "%s": + +Histogram over spandenes listelængde (totalt %d spande): + +Der fandtes ingen versionsinformation i denne fil. + +Kommentarer på offset 0x%08lx af længde 0x%08lx: + +Relokaliseringssektion +Relokaliseringssektionen på offset 0x%lx indeholder %ld byte: + +Sektion "%s" indeholder %d poster: + +Sektion "%s" har ingen data at skrive ud. + +Sektion "%s" indeholder ingen fejlsøgningsdata. + +Sektion ".conflict" indeholder %ld poster: + +Symboltabel "%s" indeholder %lu poster: + +Symboltabel for filbilleder: + +.debug_str-sektionen er tom. + +Der findes %d programhoveder, med begyndelse på offset +Der findes ingen dynamiske relokaliseringer i denne fil. + +Der findes ingen programhoveder i denne fil. + +Der findes ingen relokaliseringer i denne fil. + +Der findes ingen sektioner i denne fil. + +Der findes ingen tilbagerulningssektioner i denne fil. + +Der findes intet dynamisk segment i denne fil. + +Tilbagerulningssektion +Versiondefinitionssektion "%s" indeholder %ld poster: + +Versionbehovssektion "%s" indeholder %ld poster: + +Versionsymbolssektion "%s" indeholder %d poster: + +startadresse 0x FilStrl HukommelseStrl Flag Just + mulige : arm[_interwork], i386, mcore[-elf]{-le|-be}, ppc, thumb + %s -M [ Eksportér ikke symboler i + --export-all-symbols Eksportér alle symboler til .def + --no-export-all-symbols Exportér kun listede symboler + --yydebug Aktivér tolkens fejlsøgning + %-18s %s + %d %ld %s [%s] + --add-indirect Tilføj indirekte dll til eksportfilen. + --add-stdcall-alias Tilføj aliaser uden @ + --as Brug som assembler + --base-file Læs lænkergenereret basefil + --def Navngiv .def-inddatafilen + --dllname Navn på inddata-dll som skal indsættes i uddatabiblioteket. + --dlltool-name Forvalgt til "dlltool" + --driver-flags Forbigå forvalgte flag for ld + --driver-name Forvalgt til "gcc" + --dry-run Gør intet andet end at vise hvad som bliver køret + --entry Giv alternativ indgangspunkt i DLL'en + --exclude-symbols Undtag symbolerne i fra .def + --export-all-symbols Exportér alle symboler til .def + --image-base Giv billedets baseadresse + --implib Synonym for --output-lib + --machine + --mno-cygwin Opret Mingw-DLL + --no-default-excludes Bortse fra forvalgte undtagne symboler + --no-export-all-symbols Exportér kun .drectve-symboler + --no-idata4 Generér ingen idata$4-sektion + --no-idata5 Generér ingen idata$5-sektion + --nodelete Behold temporære filer. + --output-def Navngiv .def-uddatafilen + --output-exp Generér exportfil. + --output-lib Generér inddatabibliotek. + --quiet, -q Arbejd stille + --target i386-cygwin32 eller i386-mingw32 + --verbose, -v Udførlig + --version Vis versionsinformation for dllwrap + -A --add-stdcall-alias Tilføj aliaser uden @. + -C --compat-implib Opret bagudkompatibelt importbibliotek. + -D --dllname Navn på inddata-dll at indsætte i grænsesnitsbiblioteket. + -F --linker-flags Send til lænkeren. + -L --linker Brug som lænker. + -M --mcore-elf Behandl mcore-elf-objektfiler til . + -S --as Brug som assembler. + -U Sæt understregninger i .lib + -U --add-underscore Sæt dit understreg på symboler i grænsesnitsbiblioteket. + -V --version Vis versionsinformation om programmet. + -a --add-indirect Tilføj inddirekte dll til eksportfilen. + -b --base-file Læs den lænker-genererede basefil. + -c --no-idata5 Generér ingen idata$5-sektion. + -d --input-def Navn på .def-fil at læse ind. + -e --output-exp Generer en eksportfil. + -f --as-flags Send til assembleren. + -h --help Vis denne information. + -k Fjern @ fra eksporterede navne + -k --kill-at Fjern @ fra eksporterede navne. + -l --output-lib Generere et grænsesnitsbibliotek. + -m --machine Opret som DLL for . [forvalgt: %s] + -n --no-delete Behold temp.-filer (repetér for øget antal). + -v --verbose Beskriv udførligt. + -x --no-idata4 Generér ingen idata$4-sektion. + -z --output-def Navn på .def-fil at oprette. + 0 (*lokal*) 1 (*global*) fork.-offset: %ld + længd: %ld + Nr: Værdi Strl Type Bind Synl Idx Navn + Nr: Værdi Strl Type Bind Synl Idx Navn + pekarstørrelse: %d + version: %d + %#06x: Navneindex: %lx %#06x: Navn: %s %#06x: Forældrer %d, navneindex: %ld + %#06x: Forældrer %d: %s + %#06x: Rev: %d Flag: %s %#06x: Version: %d %d %s + (ukendt inlineattributværdi: %lx) -b, --target=BFDNAVN Specificér at målobjektets format er BFDNAVN + -m, --architecture=MASKINE Specificér at målarkitekturen er MASKINE + -j, --section=NAVN Vis kun information om sektion NAVN + -M, --disassembler-options=FLG Videresend FLG til disassemblereren + -EB --endian=big Antag big endian-format ved disassemblering + -EL --endian=little Antag little endian-format ved disassemblering + --file-start-context Medtag omgivelsen i begyndelsen af filen (med -S) + -l, --line-numbers Medtag linjenummre og filnavne i uddata + -C, --demangle[=STIL] Afkod kodede symbolnavne + STIL, hvis givet, kan være: "auto", "gnu", + "lucid", "arm", "hp", "edg", "gnu-new-abi" + -w, --wide Tilpas uddata til mere end 80 kolonner + -z, --disassemble-zeroes Hop ikke over blokke af nuller ved + disassemblering + --start-address=ADR Behandl kun data på adresser >= ADR + --stop-address=ADR Behandl kun data på adresser <= ADR + --prefix-addresses Vis fuldstændige adresser sammen med disassemblering. + --[no-]show-raw-insn Vis hex.-kode sammen med disassemblering + --adjust-vma=OFFSET Tilføj OFFSET til alle viste sektionsadresser + + -h --help Vis denne hjælpetekst + -V --version Vis versionsinformation + ABI-version: %d + Adr: 0x Øg linjenumret med %d til %d + Øg PC med %d til %lx + Øg PC med konstant %d til 0x%lx + Øg PC med fastlængdeantal %d til 0x%lx + Klasse: %s + Ant: %d + Kompileringsenhed @ %lx: + Kopiér + DWARF version: %d + Data: %s + Post Katalog Tid Strl. Navn + Indgangsodresse: Udvidet op-kode %d: Fil: %lx Fil: %s Flag Flag: 0x%lx%s + Flag: %s Version: %d + Generelle flag: + Index: %d Ant: %d initialværdi på "is_stmt": %d + længde: %ld + længde: %ld + længde: %ld + linjebase: %d + linjeområde: %d + Maskine: %s + Magi: min.-instruktionslængde: %d + Nr Spa: Værdi Strl Type Bind Synl Idx Navn + Nr Spa: Værdi Strl Type Bind Synl Idx Navn + Num: Index Værdi Navn Nummer TAG + Antal programhoveder: %ld + Antal sektionshoveder: %ld OS/ABI: %s + offset i .debug_info-sektionen: %ld + offset i .debug_info: %lx + Offset: %#08lx Lænk til sektion: %ld (%s) + Offset: %#08lx Lænk: %lx (%s) + Op-kode %d har %d argumenter + op-kodebase: %d + Flag for %s: + Flag som sendes til DLLTOOL: + Ægare Data-størrelse Beskrivelse + pegerstørrelse: %d + prologlængde: %d + Øvrige flag sendes uændrede til programeringsprogsenheden + Sektionshovedets strengtabelsndx: %ld Segmentsektioner... + segmentstørrelse: %d + Sæt filnavnet til post %d i filnavnstabellen + Sæt ISA til %d + Sæt baseblokken + Sæt kolonnen til %d + Sæt epilogue_begin til sand + Sæt is_stmt til %d + Sæt prologue_end til sand + strl. på omr. i .debug_info-sekt.: %ld + Programhovedernes størrelse: %ld (byte) + Sektionshovedernes størrelse: %ld (byte) + Dette hoveds størrelse: %ld (byte) + Særlig op-kode %d: øg adressen med %d til 0x%lx Mærke Type Navn/Værdi + Type Offset VirtAdr FysAdr + Type Offset VirtAdr FysAdr FilStrl HukommelseSt Flg Just + Type Offset VirtAdr FysAdr FilSt HukommelseSt Flg Just + Type: %s + Ukendt op-kode %d med operand: version: %d + Version: %d %s + Version: 0x%lx + version: %d + [N] - brug forekomst [nummer] af navn + [Nr] Navn Type Adresse Offset + [Nr] Navn Type Adr Off Strl PS Flg Lk Inf Ju + [Nr] Navn Type Adresse Off Strl PS Flg Lk Inf Ju + [P] - brug fuldstændiga søgestien ved sammenligninger + [S] - opret intet index over arkivet + [V] - vis versionsinformation + [a] - indsæt filer efter [medlemsnavn] + [b] - indsætte filer for [medlemsnavn] (samme som [i]) + [c] - advar ikke om biblioteket skal oprettes + [f] - afkort indsættede filnavne + [o] - bevar oprindelige datoer + [s] - opret et index over arkivet (jfr. ranlib) + [u] - erstat kun filer som er nyere end i arkivet + [v] - beskriv udførligt + d - slet filer i arkivet + definer ny filtabelspost + m[ab] - flyt filer i arkivet + p - udskriv filer som mødtes i arkivet + q[f] - hurtigtilføj filer til slutningen af arkivet + r[ab][f][u] - erstat eksisterende eller indsæt nye filer i arkivet + t - vis indeholdet i arkivet + x[o] - hent filer fra arkivet + %lu byte-blok: (byte inde i filen) + (byte in i filen) + Start for sektionshoveder: (indirekte streng, offset: 0x%lx): <%d><%lx>: Fork.-nummer: %lu (%s) + Adr: Adr: 0x Argument %s ignoreresMindst et af følgende flag skal angives: +Konvertér en objektfil til et indlæsningsbart NetWare-modul + DW_MACINFO_define - linje : %d makro : %s + DW_MACINFO_end_file + DW_MACINFO_start_file - linje: %d filnr: %d + DW_MACINFO_undef - linje : %d makro : %s + DW_MACINFO_vendor_ext - konstant : %d streng : %s + Længde Nummer %% af alle Dækning + Ingen + Nr: Navn Bind til Flag + Flagene er: + og linjenumret med %d til %d + på offset 0x%lx indeholder %lu poster: + ændrere specifikke for kommandoer: + kommandoer: + generelle ændrere: + Programfortolker#linjer %d %ld: .bf mangler indledende funktion%ld: uventet .ef +%lu %s +%s + +%s %s%c0x%s bruges aldrig%s %s: %s%s både kopieret og fjernet%s afsluttede med status %d%s har ingen %s-sektion%s er ikke et gyldigt arkiv%s er ikke et arkiv%s: %s: adresse udenfor område%s: Kan ikke åbne inddataarkivet %s +%s: Kan ikke åbne uddataarkivet %s +%s: Fejl: %s: Mislykkedes at læse filhoved +%s: Passende format:%s: Flere omdefineringer af symbol "%s"%s: Ingen dynamiske symboler%s: Symbol "%s" er mål for mere end en omdefinering%s: Advarsel: %s: fejlagtigt tal: %s%s: kan ikke få fat på adresserne i arkivet%s: kan ikke oprette fejlsøgningssektion: %s%s: kan ikke finde medlem %s +%s: kan ikke åbne fil %s +%s: kan ikke sætte indeholdet i fejlsøgningssektionen: %s%s: kan ikke sætte tiden: %s%s: kan ikke tage status: %s%s: véd ikke hvordan man skriver fejlsøgningsinformation for %s%s: fejl ved kopiering af privat BFD-data: %s%s: udførsel af %s mislykkedes: %s: fil %s er ikke et arkiv +%s: fread mislykkedes%s: fseek til %lu mislykkedes: %s%s: ugyldigt uddataformat%s: ugyldig talbase%s: intet index at opdatere%s: intet åbent uddataarkiv +%s: intet uddataarkiv angivet endnu +%s: ingen kendt fejlsøgningsinformation%s: ingen resursesektion%s: ingen symboler%s: ikke et dynamisk objekt%s: ikke nok rådata%s: udskrift af fejlsøgningsinformationen mislykkedes%s: læsning af %lu byte gav %lu%s: læsefejl: %s%s: kan ikke omdøbe: %s%s: sektion "%s": fejl på %s: %s%s: kopieringsfejl: %s%s: arkitekturer som håndteres:%s: format som håndteres:%s: mål som håndteres:%s: uventet filslut%s: advarsel: %s: advarsel: delte biblioteker kan ikke have uinitieret data%s: advarsel: ukendt størrelsen på felt "%s" i strukturen%s:%d: %s +(ukendt plads-op)(brugerdefineret plads-op)(deklareret som inline og inlined)(deklareret som inline men ignoreret)(inlined)(ikke inlined)2-komplement, big endian2-komplement, little endian64-bit DWARF-a-interval understøttes ikke endnu. +64-bit DWARF-fejlsøgningsinfo understøttes ikke endnu. +64-bit DWARF-formatskabeloner understøttes ikke endnu. +64-bit DWARF-linjeinformation understøttes ikke endnu. +64-bit DWARF-offentlige navne understøttes ikke endnu. +: dublet af værdi +: forventedes være et katalog +: forventedes være et blad +: %d: %d: %d: %lx: %xTilføjede eksportering til uddatafilenTilføjer eksportering til uddatafilenKontrolsbibliotekEksternt bibliotekflydendetalstype BCD understøttes ikkeBFD-hovedfil version %s +Fejlagtig stab: %s +udefineret C++-baseklassFandt ikke C++-baseklassen i beholderenFandt ikke C++-datamedlemmet i beholderenC++-standardværdier ikke inde i en funktionC++-objektet har ingen felterC++-referencen er ingen pegerfandt ikke C++-referencenstatisk virtuel C++-metodeCORE (hukommelsesfil)Kan ikke fylde ud efter %s: %sKan ikke disassemblere for arkitektur %s +Kan ikke fylde hullet efter %s: %sKan ikke have både LIBRARY og NAMEKan ikke åbne .lib-fil: %sKan ikke åbne def-fil: %sKan ikke åbne fil %s +Kan ikke bruge den opgivne maskine %sKan ikke producere en mcore-elf-dll fra arkivfil: %sKan ikke tage status for inddatafil %s. +Kan ikke tage status: %s: %sKonfigurationsfilIndhold i %s-sektionen: + +Indhold i %s-sektionen: +%s-sektionens indhold: + +Indhold i .debug_str-sektionen: + +Oprettede biblioteksfilenOpretter biblioteksfil: %sOpretter stubfil: %sDet aktuelle åbne arkiv er %s +DLLVERKTYG navn : %s +DLLTOOL flag: %s +ENHED navn : %s +ENHED flag : %s +DYN (delt objektfil)Fjerner temporær basefil %sFjerner temporær def-fil %sFjerner temporær eksportfil %sAfhængighedskontrolsbibliotekDisassemblering af sektion %s: +Visning af fejlsøgningsindeholdet i sektion %s understøttes ikke endnu. +Ved ikke hvordan man relokaliserer på denne maskinarkitektur +Færdig med at læse %sELF-hoved: +EXEC (exekverbar fil)Slut på sekvensen + +Indgangspunkt Fejl, duplikeret EXPORT med ordningstal: %sUndtager symbol: %sEksekvering af %s mislykkedesFORMAT er én af rc, res eller coff, og afledes fra filnavnsendelsen +hvis det ikke specificeres. Et enketl filnavn er en inddatafil. Ingen +inddatafil betyder standard-ind, med format rc. Ingen uddatafil betyder +standard-ud, med format rc. +Mislykkedes at indlæse antal spande +Mislykkedes at indlæse antalet kæder +Filen indeholder flere dynamiske strengtabeller +Filen indeholder flere tabeller med dynamiske symboler +Filen indeholder flere symtab-shndx-tabeller +FilterbibliotekFlag:Genererede eksportfilGenererer eksportfil: %sID-katalogpostID-resursID-underkatalogIEEE numerisk overløb: 0xIEEE overløb i strenglængden: %u +IEEE klarer ikke komplekse typer af størrelse %u +IEEE klarer ikke flydendetalstyper af størrelse %u +IEEE klarer ikke heltalstyper af størrelse %u +Idx Navn Størrelse VMA LMA Filoffs JustIdx Navn Størrelse VMA LMA Filoffs JustIgnorerer snavs fundet på linje %d i %sI arkiv %s: +Inddatafil %s findes ikke. +Intern fejl: Ukendt maskintype: %dUgyldigt flag "-%c" +Ugyldig talbase: %s +Beholder temporær basefil %sBeholder temporær def-fil %sBeholder temporær eksportfil %sNøgle til flagna: + W (skriv), A (allokér), X (eksekvér), M (flet), S (strenge) + I (info), L (lænkerorden), G (gruppe), x (ukendt) + O (ekstra OS-behandling kræves) o (OS-specifik), p (processor-specifik) +LIBRARY: %s bas: %xDe sidste stabs-poster inden fejlen: +Bibliotekets rpath: [%s]Bibliotekets runpath: [%s]Bibliotekets so-navn: [%s]Maskine "%s" håndteres ikkeFlere navneskift på sektion %sAngiv mindst et af flagene -o eller --dllnameNAME: %s bas: %xNONE (ingen)NT_FPREGS (flydendetalsregister)NT_FPREGSET (flydendetalsregister)NT_LWPSINFO (lwpsinfo_t-struktur)NT_LWPSTATUS (lwpstatus_t-struktur)NT_PRPSINFO (prpsinfo-struktur)NT_PRSTATUS (prstatus-struktur)NT_PRXFPREG (user_xfpregs-struktur)NT_PSINFO (psinfo-struktur)NT_PSTATUS (pstatus-struktur)NT_TASKSTRUCT (task-struktur)N_LBRAC ikke inde i funktion +Navn Værdi Klasse Type Størr. Linje Sektion + +Navn Værdi Klasse Type Størr. Linje Sektion + +Navnindex: %ld +Navn: %s +NetBSD processinfo-strukturDer findes ingen %s-sektion + +Ingen %s i arkivet. +Ingen kodning af "%s" +Intet medlem hedder "%s" +Der findes ingen kommentarer i hukommelsesfilen. +IngenIkke en ELF-fil - den har forkerte magiske byte i begyndelsen +Unødvendigt objekt: [%s] +Intet at gøre. +OS-specifikt: (%x)Kun -X 32_64 understøttesKun DWARF2's a-interval understøttes i øjeblikket. +Kun DWARF 2 pub.-navn understøttes i øjeblikket +Kun DWARF version 2's linjeinfo understøttes i øjeblikket. +Kun version 2 af DWARF fejlsøgningsinformation understøttes i øjeblikket. +Åbnede temporær fil: %sOperativsystemsspecifik: %lxSlut på hukommelseSlut på hukommelse +Slut på hukommelse ved allokering af %d byte for %s +Slut på hukommelse ved allokering af tabel for ønskede udskrifter.Slut på virtuel hukommelsePT_FIRSTMACH+%dPT_GETFPREGS (fpreg-struktur)PT_GETREGS (reg-struktur)Pascal-filnavn understøttes ikkeDef-filen er behandletDefinitionerne er behandledeBehandler def-fil: %sBehandler definitionerprocessorspecifik: %lxprocessorspecifik: (%x)REL (relokaliseringsbar fil)Læsning af %s-sektionen i %s mislykkedes: %sLæsning af %s-sektionen i %s mislykkedes: %s +Rapportere fejl til %s +Rapporter fejl i oversættelsen til dansk@klid.dk +Rapportér fejl til %s. +Rapportér fejl i oversættelsen til dansk@klid.dk. +Aflæser objektfil %sSektioner: +Delt bibliotek: [%s]Hopper over uventet relokaliseringstype %s +Hopper over uventet symboltype %u +Nogen sektioner blev ikke skrevet ud da de ikke eksisterer! +Selvstændig app.Suger ind info fra sektion %s i %sArkitekturer som håndteres:Mål som håndteres:Syntaktisk fejl i def-fil %s:%dLinjeinformationen virker være i stykker - sektionen er for lille +Sektion %s indeholder: +Sektion %s indeholder: + +Der findes %d sektionshoveder, med begyndelse på offset 0x%lx: +Denne binære af readelf er bygget uden understøttelse for en 64-bit +datatype og kan derfor ikke læse 64-bit ELF-filer. +Dette program er frit programmel; du kan distribuere det videre under betingelserne +i GNU General Public License. Dette program har ingen som helst garantier. +For mange N_RBRAC's +Prøvede "%s" +Prøvede fil: %sTypens filnummer %d udenfor sit interval +Typens indexnummer %d udenfor sit interval +UKENDT: længde %d +Kan ikke ændre endian-type på inddatafilerneKan ikke bestemme længden på den dynamiske strengtabel +Kan ikke bestemme hvor mange symboler som skal læses ind +Kan ikke finde navnet på programtolken +Kan ikke finde nogen .debug_abbrev-sektion! +Kan ikke finde post %lu i forkortelsestabellen +Kan ikke åbne basefilen: %sKan ikke åbne objektfil: %sKan ikke åbne temporær assemblerfil: %sKan ikke indlæse %d byte af %s +Kan ikke indlæse de dynamiske data +Kan ikke opsøge %2$s på %1$x +Kan ikke søge til slutningen af filen +Kan ikke søge til slutningen af filen!Kan ikke søge til begyndelsen af den dynamiske informationUdefineret N_EXCLStørrelse på data som ikke kan behandles: %d +Ukendt AT-værdi: %lxUkendt FORM-værdi: %lxUkendt TAG-værdi: %lxUkendt kommentartype: (0x%08x)Ukendt XCOFF-type %d +Ukendt fejlsøgningsargument "%s" +Ukendt fejlsøgningssektion: %s +Brug: %s inddatafil(er) +Bruger "%s" +Bruger fil: %sBruger popen til at læse uddata fra præprocessorn +Udnytter temporærfil "%s" til at læse præprocessoruddata +"N"'s argument skal være positivt.Advarsel, ignorerer duplikeret EXPORT %s %d,%dAdvarsel: %s: %s +Advarsel: Uddatafilen kan ikke repræsentere arkitektur %sAdvarsel: ændrer datatypens størrelse fra %d til %d +Advarsel: inddata skal have formatet 'binary' for binærarkitektursparametre.Advarsel: afkorter udfyldningsværdien fra 0x%s til 0x%x"N" er kun meningsfuldt sammen med "x" eller "d"."u" er kun meningsfuldt sammen med "r".acceleratorjusteringindex for alternativ maskinkode skal være positivtarkitektur %s er ukendtarkitektur: %s, fejlagtig ATN65-postC++-feltets bit-position eller bit-størrelse er fejlagtigfejlagtigt dynamisk symbolfejlagtigt format på %sfejlagtigt kodet navn "%s" +fejlagtig misc-postfejlagtig type på C++-metodefunktionfejlagtigt udformet udvidet linje-op mødtes! +bfd_coff_get_auxent mislykkedes: %sbfd_coff_get_syment mislykkedes: %sbfd_open mislykkedes at åbne stubfil: %sblock stadig på stakken ved slutningenbyte-nr skal være mindre end antal byte i intervalletbyte-nr må ikke være negativtkan ikke bestemme "%s"'s filtype; brug flag -Ikan ikke oprette sektion "%s": %skan ikke eksekvere "%s": %skan ikke finde BFD_RELOC_RVA-relokeringstypekan ikke åbne %s "%s": %skan ikke åbne "%s" for udskivning: %skan ikke åbne temporærfil "%s": %skan ikke kalde popen "%s": %skan ikke læse resursesektionenkan ikke omdirigere standard-ud: "%s": %skan ikke sætte BFD's standardmål til "%s": %skan ikke slette %s: %skan ikke oprette katalog %s for arkivkopiering (fejl: %s)kan ikke åbne inddatafil %skan ikke åbne: %s: %skan ikke tage status: %s: %skonfliktconst/volatile-indikator manglerkontroldata kræver DIALOGEXkopierer fra %s(%s) til %s(%s) +opretter %smarkørmarkørfil "%s" indeholder ikke markørdatatilrettelig sektiondatapostdatastørrelse %ldfejlsøgningssektionsdatadebug_abbrev sektionsdatadebug_add_to_current_namespace: ingen aktuel fildebug_end_block: forsøg gjordes på at afslutte øverste blokdebug_end_block: ingen aktuel blokdebug_end_common_block: ikke implementeretdebug_end_function: ingen aktuel funktiondebug_end_function: nogen blokke afsluttedes ikkedebug_find_named_type: ingen aktuel kompileringsenheddebug_get_real_type: %s har cirkulær fejlsøgningsinformation +debug_make_undefined_type: slagsen kan ikke håndteresdebug_name_type: ingen aktuel fildebug_record_function: intet kald til debug_set_filenamedebug_record_line: ingen aktuel kompileringsenheddebug_record_parameter: ingen aktuel funktiondebug_record_variable: ingen aktuel blokdebug_record_variable: ingen aktuel fildebug_start_block: ingen aktuel blokdebug_start_common_block: ikke implementeretdebug_start_source: intet kald til debug_set_filenamedebug_str sektionsdatadebug_tag_type: forsøg gjordes på at sætte et ekstra mærkedebug_tag_type: ingen aktuel fildebug_write_type: mødte en ugyldig typedialogkontroldialogkontrolsdatadialogkontrolsslutdialogskrifttypesstørrelsedialoghoveddioalog-ext.kontroldialog-ext.-skrifttypesinformationkatalogkatalogpostnavndynamisk segmentdynamisk strengtabeldynamiske strengefejlbalanceret udtryksstakoverløb i udtryksstakkenunderløb i udtryksstakkenmislykkedes at åbne temporær hovedfil: %smislykkedes at åbne temporær halefil: %sfilnavn kræves for COFF-inddatafilnavn kræves for COFF-uddatafast versionsinfoflagflag 0x%08x: +skrifttypeskatalogskrifttypeskatalogsenhedsnavnskrifttypeskatalogsskrifttypesnavnskrifttypeskatalogshovedgruppemarkørgruppemarkørshovedgruppeikongruppeikonshovedhar børnhjælp-ID kræver DIALOGEXhjælpesektionikon-fil "%s" indeholder ikke ikonddatautilladt flag -- %cutilladt typeindexutilladt variabelindexuddatafilen skal være en anden end inddatafileninddatafilen nævnt både på kommandolinjen og via INPUTintervalstørrelsen skal være positivintern fejl -- flaget er ikke implementeretinternt stat-fejl for %sugyldigt argument til --format: %sugyldigt heltalsargument %sugyldigt talugyldigt tal %sugyldig strenglængdebibliotekslisteopret .bss-sektionopret .nlmsections-sektionopret sektionfremstillingmenuhovedmenu-ext.-hovedmenu-ext.-offsetmenuobjektmenuobjektshovedmeddelelsesektionmanglende indextypemangler nødvendig ASNmangler nødvendig ATN65modulsektionmere end et dynamisk segment +navngivet katalogpostnavngiven resursenavngivet underkatalogingen argumenttype i kodet streng +ingen børningen post %s i arkivet +ingen %s i arkiv %s!ingen eksport-definitionsfil angaves. +Opretter én, men det er måske ikke hvad du ønskeringen inddatafilingen inddatafil gavsintet navn på uddatafileningen kommandoflag belv angivetingen resurseringen typinformation om C++-metodefunktioningenkommentarernultermineret UCS-strengnumerisk overløbflagslut på hukommelse ved tolkning af relokaliseringeroverløb ved justeringen af relokalisering mod %sparse_coff_type: Fejlagtig typekode 0x%xprivat dataprogramhovederreferenceparameteren er ikke en pegerrelokaliseringerresurse-IDresursedatastørrelse på resursedataukendt resursetyperpc-sectionsektionsdatasektionshovedersæt vma for .bsssæt .data-størrelsesæt .nlmsektions indholdsæt .nlmsections-flagsæt .nlmsektions størrelsesæt Adresse til 0x%lx +sæt sektionsflagsæt sektionsstørrelsesæt startadressedelt sektionstørrelsestab_int_type: fejlagtig størrelse %uoverløb i stakkenunderløb i stakkenstat mislykkedes på billedfil "%s": %sstat returnerer negativ størrelse på %sstrengtabelstring_hash_lookup mislykkedes: %sstrengtabelsstrengstrengtabelsstrenglængdesektionsstørrelser for stubsubprocessen fik fatalt signal %dikke kompileret med understøttelse for %sflag som håndteres: %ssymbolinformationsymbolersymtab shndxto forskellige kommandoflag blev angivetkan ikke åbne uddatafil %sudefineret C++-objektudefineret C++-v-tabelludefineret variabel i ATNudefineret variabel i TYuventet slut på fejlsøgningsinformationenuventet version %lu af fast versionsinformationuventet længde %d på fast versionsinformationuventet fast versions-signatur %luuventet gruppemarkørstype %duventet gruppeikonstype %duventet taluventet posttypeuventet streng i C++-miscuventet længde %d på værdi for strengfilsinfouventet længde %d på værdi for var.filinfouventet versionsstrenguventet længde %d != %d + %d på versionsstrenguventet længde %d < %d på versionsstrenguventet længde %d på værdi for versionsstrengtabeluventet versionstype %duventet længde %d på værdi for versionukendt ATN-typeukendt BB-typeukendt C++-kodet navnukendt C++-synlighedukendt TY-kodeukendt alternativ maskinkode, ignoreretukendt indbygget typeukendt afkodningsstil "%s"ukendt formattype "%s"ukendt sektionukendt virtuelt tegn for baseklasseukendt synlighedskarakter for baseklasseukendt synlighedskarakter for felt$vb-type uden navnukendt --endian-type "%s"ukendt -E-flagukendt C++-forkortelseukendt C++-standardtypeukendt C++-misc-postukendt C++-objektoversigtsspecukendt C++-objektspecifikationukendt C++-referencetypeukendt krydsreferencetypeukendt sektionsflag "%s"uløst PC-relativ relokalisering mod %sATN11 understøttes ikkeATN12 understøttes ikkeuunderstøttet C++-objekttypeIEEE-udtryksoperator som ikke understøttesu-understøttet menuversion %dtilbagerulningsinfotilbagerulningstabelversionsdataversionsdef.ydre versionsdef.versiondefinitionssektionversionslængde %d passer ikke med resurselængde %luversionsbehovydre versionsbehov (2)ydre versionsbehov (3)versionsbehovssektionversionsstrengtabelversionsymbolsdatavariabel versionsinfoversionsvar.filinfovmawait: %sadvarsel: CHECK-procedure %s er ikke defineretadvarsel: EXIT-procedure %s er ikke defineretadvarsel: MAP og FULLMAP understøttes ikke; forsøg med ld -Madvarsel: Intet versionsnummer givetadvarsel: START-procedure %s er ikke defineretadvarsel: formaterne for ind- og uddata er ikke kompatibleadvarsel: symbol %s importeredes men findes ikke i importlistenskriver stub \ No newline at end of file diff -Nurpa binutils-2.13/binutils/po/da.po binutils-2.13.1/binutils/po/da.po --- binutils-2.13/binutils/po/da.po 1969-12-31 19:00:00.000000000 -0500 +++ binutils-2.13.1/binutils/po/da.po 2002-11-07 12:04:37.000000000 -0500 @@ -0,0 +1,4822 @@ +# Danish messages for binutils. +# Copyright (C) 2001, 2002 Free Software Foundation, Inc. +# Keld Simonsen , 2002. +# +msgid "" +msgstr "" +"Project-Id-Version: binutils 2.12.91\n" +"POT-Creation-Date: 2002-07-23 15:55-0400\n" +"PO-Revision-Date: 2002-09-07 19:55+0200\n" +"Last-Translator: Keld Simonsen \n" +"Language-Team: Danish \n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=iso-8859-1\n" +"Content-Transfer-Encoding: 8bit\n" + +#: addr2line.c:74 +#, c-format +msgid "Usage: %s [option(s)] [addr(s)]\n" +msgstr "Brug: %s inddatafil(er)\n" + +#: addr2line.c:75 +msgid " Convert addresses into line number/file name pairs.\n" +msgstr "" + +#: addr2line.c:76 +msgid " If no addresses are specified on the command line, they will be read from stdin\n" +msgstr "" + +#: addr2line.c:77 +msgid "" +" The options are:\n" +" -b --target= Set the binary file format\n" +" -e --exe= Set the input file name (default is a.out)\n" +" -s --basenames Strip directory names\n" +" -f --functions Show function names\n" +" -C --demangle[=style] Demangle function names\n" +" -h --help Display this information\n" +" -v --version Display the program's version\n" +"\n" +msgstr "" + +#: addr2line.c:89 ar.c:297 coffdump.c:479 nlmconv.c:1119 objcopy.c:424 +#: objcopy.c:457 readelf.c:2310 size.c:104 srconv.c:1962 strings.c:666 +#: sysdump.c:774 windres.c:733 +#, c-format +msgid "Report bugs to %s\n" +msgstr "" +"Rapportere fejl til %s\n" +"Rapporter fejl i oversættelsen til dansk@klid.dk\n" + +#: addr2line.c:248 +#, c-format +msgid "%s: can not get addresses from archive" +msgstr "%s: kan ikke få fat på adresserne i arkivet" + +#: addr2line.c:320 nm.c:395 objdump.c:2782 +#, c-format +msgid "unknown demangling style `%s'" +msgstr "ukendt afkodningsstil \"%s\"" + +#: ar.c:238 +#, c-format +msgid "no entry %s in archive\n" +msgstr "ingen post %s i arkivet\n" + +#: ar.c:255 +#, fuzzy, c-format +msgid "Usage: %s [emulation options] [-]{dmpqrstx}[abcfilNoPsSuvV] [member-name] [count] archive-file file...\n" +msgstr "Brug: %s [-X32_64] [-]{dmpqrstx}[abcfilNoPsSuvV] [medlemsnavn] [nummer] arkivfil fil...\n" + +#: ar.c:258 +#, c-format +msgid " %s -M [\n" +"\n" +msgstr "" +"\n" +"\n" +"\n" + +#: ar.c:857 ar.c:925 +#, c-format +msgid "%s is not a valid archive" +msgstr "%s er ikke et gyldigt arkiv" + +#: ar.c:893 +#, c-format +msgid "stat returns negative size for %s" +msgstr "stat returnerer negativ størrelse på %s" + +#: ar.c:1020 +#, c-format +msgid "%s is not an archive" +msgstr "%s er ikke et arkiv" + +#: ar.c:1027 +#, c-format +msgid "creating %s" +msgstr "opretter %s" + +#: ar.c:1233 +#, c-format +msgid "No member named `%s'\n" +msgstr "Intet medlem hedder \"%s\"\n" + +#: ar.c:1285 +#, c-format +msgid "no entry %s in archive %s!" +msgstr "ingen %s i arkiv %s!" + +# archive map virker være vad indexet kaldes i kildekodeen +#: ar.c:1422 +#, c-format +msgid "%s: no archive map to update" +msgstr "%s: intet index at opdatere" + +#: arsup.c:86 +#, c-format +msgid "No entry %s in archive.\n" +msgstr "Ingen %s i arkivet.\n" + +#: arsup.c:117 +#, c-format +msgid "Can't open file %s\n" +msgstr "Kan ikke åbne fil %s\n" + +#: arsup.c:172 +#, c-format +msgid "%s: Can't open output archive %s\n" +msgstr "%s: Kan ikke åbne uddataarkivet %s\n" + +#: arsup.c:189 +#, c-format +msgid "%s: Can't open input archive %s\n" +msgstr "%s: Kan ikke åbne inddataarkivet %s\n" + +#: arsup.c:198 +#, c-format +msgid "%s: file %s is not an archive\n" +msgstr "%s: fil %s er ikke et arkiv\n" + +#: arsup.c:241 +#, c-format +msgid "%s: no output archive specified yet\n" +msgstr "%s: intet uddataarkiv angivet endnu\n" + +#: arsup.c:262 arsup.c:301 arsup.c:343 arsup.c:364 arsup.c:430 +#, c-format +msgid "%s: no open output archive\n" +msgstr "%s: intet åbent uddataarkiv\n" + +#: arsup.c:273 arsup.c:385 arsup.c:411 +#, c-format +msgid "%s: can't open file %s\n" +msgstr "%s: kan ikke åbne fil %s\n" + +# module file er detsamme som member +#: arsup.c:328 arsup.c:407 arsup.c:489 +#, c-format +msgid "%s: can't find module file %s\n" +msgstr "%s: kan ikke finde medlem %s\n" + +#: arsup.c:439 +#, c-format +msgid "Current open archive is %s\n" +msgstr "Det aktuelle åbne arkiv er %s\n" + +# BUGG: dubbelt blanksteg +#: arsup.c:464 +#, fuzzy, c-format +msgid "%s: no open archive\n" +msgstr "%s: intet åbent arkiv\n" + +#: binemul.c:39 +#, fuzzy, c-format +msgid " No emulation specific options\n" +msgstr " Generelle flag:\n" + +#. Macros for common output. +#: binemul.h:42 +#, fuzzy, c-format +msgid " emulation options: \n" +msgstr " Generelle flag:\n" + +#: bucomm.c:106 +#, c-format +msgid "can't set BFD default target to `%s': %s" +msgstr "kan ikke sætte BFD's standardmål til \"%s\": %s" + +#: bucomm.c:118 +#, c-format +msgid "%s: Matching formats:" +msgstr "%s: Passende format:" + +#: bucomm.c:135 +msgid "Supported targets:" +msgstr "Mål som håndteres:" + +#: bucomm.c:137 +#, c-format +msgid "%s: supported targets:" +msgstr "%s: mål som håndteres:" + +#: bucomm.c:153 +msgid "Supported architectures:" +msgstr "Arkitekturer som håndteres:" + +#: bucomm.c:155 +#, c-format +msgid "%s: supported architectures:" +msgstr "%s: arkitekturer som håndteres:" + +#: bucomm.c:262 +#, c-format +msgid "%s: bad number: %s" +msgstr "%s: fejlagtigt tal: %s" + +#: coffdump.c:107 +#, c-format +msgid "#lines %d " +msgstr "#linjer %d " + +#: coffdump.c:471 sysdump.c:767 +#, fuzzy, c-format +msgid "Usage: %s [option(s)] in-file\n" +msgstr "Brug: %s inddatafil(er)\n" + +#: coffdump.c:472 +#, fuzzy +msgid " Print a human readable interpretation of a SYSROFF object file\n" +msgstr "%s: Skriv en menneskeligt læsbar tolkning af en SYSROFF-objektfil\n" + +#: coffdump.c:473 +msgid "" +" The options are:\n" +" -h --help Display this information\n" +" -v --version Display the program's version\n" +"\n" +msgstr "" + +#: coffdump.c:541 srconv.c:2052 sysdump.c:831 +msgid "no input file specified" +msgstr "ingen inddatafil gavs" + +#: debug.c:653 +msgid "debug_add_to_current_namespace: no current file" +msgstr "debug_add_to_current_namespace: ingen aktuel fil" + +#: debug.c:736 +msgid "debug_start_source: no debug_set_filename call" +msgstr "debug_start_source: intet kald til debug_set_filename" + +#: debug.c:795 +msgid "debug_record_function: no debug_set_filename call" +msgstr "debug_record_function: intet kald til debug_set_filename" + +#: debug.c:851 +msgid "debug_record_parameter: no current function" +msgstr "debug_record_parameter: ingen aktuel funktion" + +#: debug.c:885 +msgid "debug_end_function: no current function" +msgstr "debug_end_function: ingen aktuel funktion" + +#: debug.c:891 +msgid "debug_end_function: some blocks were not closed" +msgstr "debug_end_function: nogen blokke afsluttedes ikke" + +#: debug.c:921 +msgid "debug_start_block: no current block" +msgstr "debug_start_block: ingen aktuel blok" + +#: debug.c:959 +msgid "debug_end_block: no current block" +msgstr "debug_end_block: ingen aktuel blok" + +#: debug.c:966 +msgid "debug_end_block: attempt to close top level block" +msgstr "debug_end_block: forsøg gjordes på at afslutte øverste blok" + +#: debug.c:992 +msgid "debug_record_line: no current unit" +msgstr "debug_record_line: ingen aktuel kompileringsenhed" + +#. FIXME +#: debug.c:1046 +msgid "debug_start_common_block: not implemented" +msgstr "debug_start_common_block: ikke implementeret" + +#. FIXME +#: debug.c:1058 +msgid "debug_end_common_block: not implemented" +msgstr "debug_end_common_block: ikke implementeret" + +# BUGG: Kolon mangler antagligen +#. FIXME. +#: debug.c:1152 +#, fuzzy +msgid "debug_record_label: not implemented" +msgstr "debug_record_label: ikke implementeret" + +#: debug.c:1178 +msgid "debug_record_variable: no current file" +msgstr "debug_record_variable: ingen aktuel fil" + +#: debug.c:1194 +msgid "debug_record_variable: no current block" +msgstr "debug_record_variable: ingen aktuel blok" + +#: debug.c:1763 +msgid "debug_make_undefined_type: unsupported kind" +msgstr "debug_make_undefined_type: slagsen kan ikke håndteres" + +#: debug.c:1964 +msgid "debug_name_type: no current file" +msgstr "debug_name_type: ingen aktuel fil" + +#: debug.c:2012 +msgid "debug_tag_type: no current file" +msgstr "debug_tag_type: ingen aktuel fil" + +#: debug.c:2020 +msgid "debug_tag_type: extra tag attempted" +msgstr "debug_tag_type: forsøg gjordes på at sætte et ekstra mærke" + +#: debug.c:2059 +#, c-format +msgid "Warning: changing type size from %d to %d\n" +msgstr "Advarsel: ændrer datatypens størrelse fra %d til %d\n" + +#: debug.c:2083 +msgid "debug_find_named_type: no current compilation unit" +msgstr "debug_find_named_type: ingen aktuel kompileringsenhed" + +#: debug.c:2190 +#, c-format +msgid "debug_get_real_type: circular debug information for %s\n" +msgstr "debug_get_real_type: %s har cirkulær fejlsøgningsinformation\n" + +#: debug.c:2650 +msgid "debug_write_type: illegal type encountered" +msgstr "debug_write_type: mødte en ugyldig type" + +#: dlltool.c:735 dlltool.c:760 dlltool.c:786 +#, c-format +msgid "Internal error: Unknown machine type: %d" +msgstr "Intern fejl: Ukendt maskintype: %d" + +#: dlltool.c:823 +#, c-format +msgid "Can't open def file: %s" +msgstr "Kan ikke åbne def-fil: %s" + +#: dlltool.c:828 +#, c-format +msgid "Processing def file: %s" +msgstr "Behandler def-fil: %s" + +#: dlltool.c:832 +msgid "Processed def file" +msgstr "Def-filen er behandlet" + +#: dlltool.c:858 +#, c-format +msgid "Syntax error in def file %s:%d" +msgstr "Syntaktisk fejl i def-fil %s:%d" + +#: dlltool.c:897 +#, c-format +msgid "NAME: %s base: %x" +msgstr "NAME: %s bas: %x" + +#: dlltool.c:900 dlltool.c:919 +msgid "Can't have LIBRARY and NAME" +msgstr "Kan ikke have både LIBRARY og NAME" + +#: dlltool.c:916 +#, c-format +msgid "LIBRARY: %s base: %x" +msgstr "LIBRARY: %s bas: %x" + +#: dlltool.c:1174 resrc.c:271 +#, c-format +msgid "wait: %s" +msgstr "wait: %s" + +#: dlltool.c:1179 dllwrap.c:430 resrc.c:276 +#, c-format +msgid "subprocess got fatal signal %d" +msgstr "subprocessen fik fatalt signal %d" + +#: dlltool.c:1185 dllwrap.c:437 resrc.c:283 +#, c-format +msgid "%s exited with status %d" +msgstr "%s afsluttede med status %d" + +#: dlltool.c:1217 +#, c-format +msgid "Sucking in info from %s section in %s" +msgstr "Suger ind info fra sektion %s i %s" + +#: dlltool.c:1341 +#, c-format +msgid "Excluding symbol: %s" +msgstr "Undtager symbol: %s" + +#: dlltool.c:1436 dlltool.c:1447 nm.c:959 nm.c:970 objdump.c:386 objdump.c:401 +#, c-format +msgid "%s: no symbols" +msgstr "%s: ingen symboler" + +#. FIXME: we ought to read in and block out the base relocations +#: dlltool.c:1474 +#, c-format +msgid "Done reading %s" +msgstr "Færdig med at læse %s" + +#: dlltool.c:1485 +#, c-format +msgid "Unable to open object file: %s" +msgstr "Kan ikke åbne objektfil: %s" + +#: dlltool.c:1488 +#, c-format +msgid "Scanning object file %s" +msgstr "Aflæser objektfil %s" + +#: dlltool.c:1503 +#, c-format +msgid "Cannot produce mcore-elf dll from archive file: %s" +msgstr "Kan ikke producere en mcore-elf-dll fra arkivfil: %s" + +#: dlltool.c:1595 +msgid "Adding exports to output file" +msgstr "Tilføjer eksportering til uddatafilen" + +#: dlltool.c:1640 +msgid "Added exports to output file" +msgstr "Tilføjede eksportering til uddatafilen" + +#: dlltool.c:1764 +#, c-format +msgid "Generating export file: %s" +msgstr "Genererer eksportfil: %s" + +#: dlltool.c:1769 +#, c-format +msgid "Unable to open temporary assembler file: %s" +msgstr "Kan ikke åbne temporær assemblerfil: %s" + +#: dlltool.c:1772 +#, c-format +msgid "Opened temporary file: %s" +msgstr "Åbnede temporær fil: %s" + +#: dlltool.c:1996 +msgid "Generated exports file" +msgstr "Genererede eksportfil" + +#: dlltool.c:2258 +#, c-format +msgid "bfd_open failed open stub file: %s" +msgstr "bfd_open mislykkedes at åbne stubfil: %s" + +#: dlltool.c:2261 +#, c-format +msgid "Creating stub file: %s" +msgstr "Opretter stubfil: %s" + +#: dlltool.c:2650 +#, c-format +msgid "failed to open temporary head file: %s" +msgstr "mislykkedes at åbne temporær hovedfil: %s" + +#: dlltool.c:2709 +#, c-format +msgid "failed to open temporary tail file: %s" +msgstr "mislykkedes at åbne temporær halefil: %s" + +#: dlltool.c:2777 +#, c-format +msgid "Can't open .lib file: %s" +msgstr "Kan ikke åbne .lib-fil: %s" + +#: dlltool.c:2780 +#, c-format +msgid "Creating library file: %s" +msgstr "Opretter biblioteksfil: %s" + +#: dlltool.c:2839 +#, c-format +msgid "cannot delete %s: %s" +msgstr "kan ikke slette %s: %s" + +#: dlltool.c:2843 +msgid "Created lib file" +msgstr "Oprettede biblioteksfilen" + +#: dlltool.c:2948 +#, c-format +msgid "Warning, ignoring duplicate EXPORT %s %d,%d" +msgstr "Advarsel, ignorerer duplikeret EXPORT %s %d,%d" + +#: dlltool.c:2954 +#, c-format +msgid "Error, duplicate EXPORT with oridinals: %s" +msgstr "Fejl, duplikeret EXPORT med ordningstal: %s" + +#: dlltool.c:3081 +msgid "Processing definitions" +msgstr "Behandler definitioner" + +#: dlltool.c:3119 +msgid "Processed definitions" +msgstr "Definitionerne er behandlede" + +# BUGG: Kolon fattas +#. xgetext:c-format +#: dlltool.c:3130 dllwrap.c:495 +#, fuzzy, c-format +msgid "Usage %s \n" +msgstr "Brug: %s \n" + +#. xgetext:c-format +#: dlltool.c:3132 +#, c-format +msgid " -m --machine Create as DLL for . [default: %s]\n" +msgstr " -m --machine Opret som DLL for . [forvalgt: %s]\n" + +#: dlltool.c:3133 +msgid " possible : arm[_interwork], i386, mcore[-elf]{-le|-be}, ppc, thumb\n" +msgstr " mulige : arm[_interwork], i386, mcore[-elf]{-le|-be}, ppc, thumb\n" + +#: dlltool.c:3134 +msgid " -e --output-exp Generate an export file.\n" +msgstr " -e --output-exp Generer en eksportfil.\n" + +#: dlltool.c:3135 +msgid " -l --output-lib Generate an interface library.\n" +msgstr " -l --output-lib Generere et grænsesnitsbibliotek.\n" + +#: dlltool.c:3136 +msgid " -a --add-indirect Add dll indirects to export file.\n" +msgstr " -a --add-indirect Tilføj inddirekte dll til eksportfilen.\n" + +#: dlltool.c:3137 +msgid " -D --dllname Name of input dll to put into interface lib.\n" +msgstr " -D --dllname Navn på inddata-dll at indsætte i grænsesnitsbiblioteket.\n" + +#: dlltool.c:3138 +msgid " -d --input-def Name of .def file to be read in.\n" +msgstr " -d --input-def Navn på .def-fil at læse ind.\n" + +#: dlltool.c:3139 +msgid " -z --output-def Name of .def file to be created.\n" +msgstr " -z --output-def Navn på .def-fil at oprette.\n" + +#: dlltool.c:3140 +msgid " --export-all-symbols Export all symbols to .def\n" +msgstr " --export-all-symbols Eksportér alle symboler til .def\n" + +# Føljende streng har den beskrivende delen indenteret to tegn +# extra i den engelska texten til at to flag er for langa. I den +# svenska oversættelsen er de indenterede tre tegn extra til at +# den ena flaget blev yderligere et tegn for lang. +#: dlltool.c:3141 +msgid " --no-export-all-symbols Only export listed symbols\n" +msgstr " --no-export-all-symbols Exportér kun listede symboler\n" + +# Føljende streng har den beskrivende delen indenteret to tegn +# extra i den engelska texten til at to flag er for langa. I den +# svenska oversættelsen er de indenterede tre tegn extra til at +# den ena flaget blev yderligere et tegn for lang. +#: dlltool.c:3142 +msgid " --exclude-symbols Don't export \n" +msgstr " --exclude-symbols Eksportér ikke symboler i \n" + +#: dlltool.c:3143 +msgid " --no-default-excludes Clear default exclude symbols\n" +msgstr "" + +#: dlltool.c:3144 +msgid " -b --base-file Read linker generated base file.\n" +msgstr " -b --base-file Læs den lænker-genererede basefil.\n" + +#: dlltool.c:3145 +msgid " -x --no-idata4 Don't generate idata$4 section.\n" +msgstr " -x --no-idata4 Generér ingen idata$4-sektion.\n" + +#: dlltool.c:3146 +msgid " -c --no-idata5 Don't generate idata$5 section.\n" +msgstr " -c --no-idata5 Generér ingen idata$5-sektion.\n" + +#: dlltool.c:3147 +msgid " -U --add-underscore Add underscores to symbols in interface library.\n" +msgstr " -U --add-underscore Sæt dit understreg på symboler i grænsesnitsbiblioteket.\n" + +#: dlltool.c:3148 +msgid " -k --kill-at Kill @ from exported names.\n" +msgstr " -k --kill-at Fjern @ fra eksporterede navne.\n" + +#: dlltool.c:3149 +msgid " -A --add-stdcall-alias Add aliases without @.\n" +msgstr " -A --add-stdcall-alias Tilføj aliaser uden @.\n" + +#: dlltool.c:3150 +msgid " -S --as Use for assembler.\n" +msgstr " -S --as Brug som assembler.\n" + +#: dlltool.c:3151 +msgid " -f --as-flags Pass to the assembler.\n" +msgstr " -f --as-flags Send til assembleren.\n" + +#: dlltool.c:3152 +msgid " -C --compat-implib Create backward compatible import library.\n" +msgstr " -C --compat-implib Opret bagudkompatibelt importbibliotek.\n" + +#: dlltool.c:3153 +msgid " -n --no-delete Keep temp files (repeat for extra preservation).\n" +msgstr " -n --no-delete Behold temp.-filer (repetér for øget antal).\n" + +#: dlltool.c:3154 +msgid " -v --verbose Be verbose.\n" +msgstr " -v --verbose Beskriv udførligt.\n" + +#: dlltool.c:3155 +msgid " -V --version Display the program version.\n" +msgstr " -V --version Vis versionsinformation om programmet.\n" + +#: dlltool.c:3156 +msgid " -h --help Display this information.\n" +msgstr " -h --help Vis denne information.\n" + +#: dlltool.c:3158 +msgid " -M --mcore-elf Process mcore-elf object files into .\n" +msgstr " -M --mcore-elf Behandl mcore-elf-objektfiler til .\n" + +#: dlltool.c:3159 +msgid " -L --linker Use as the linker.\n" +msgstr " -L --linker Brug som lænker.\n" + +# Justeringen bliver fejl hær for flaget er for lang. +#: dlltool.c:3160 +msgid " -F --linker-flags Pass to the linker.\n" +msgstr " -F --linker-flags Send til lænkeren.\n" + +#: dlltool.c:3310 +#, c-format +msgid "Unable to open base-file: %s" +msgstr "Kan ikke åbne basefilen: %s" + +#: dlltool.c:3339 +#, c-format +msgid "Machine '%s' not supported" +msgstr "Maskine \"%s\" håndteres ikke" + +#: dlltool.c:3442 dllwrap.c:214 +#, c-format +msgid "Tried file: %s" +msgstr "Prøvede fil: %s" + +#: dlltool.c:3449 dllwrap.c:221 +#, c-format +msgid "Using file: %s" +msgstr "Bruger fil: %s" + +#: dllwrap.c:308 +#, c-format +msgid "Keeping temporary base file %s" +msgstr "Beholder temporær basefil %s" + +#: dllwrap.c:310 +#, c-format +msgid "Deleting temporary base file %s" +msgstr "Fjerner temporær basefil %s" + +#: dllwrap.c:324 +#, c-format +msgid "Keeping temporary exp file %s" +msgstr "Beholder temporær eksportfil %s" + +#: dllwrap.c:326 +#, c-format +msgid "Deleting temporary exp file %s" +msgstr "Fjerner temporær eksportfil %s" + +#: dllwrap.c:339 +#, c-format +msgid "Keeping temporary def file %s" +msgstr "Beholder temporær def-fil %s" + +#: dllwrap.c:341 +#, c-format +msgid "Deleting temporary def file %s" +msgstr "Fjerner temporær def-fil %s" + +#: dllwrap.c:496 +msgid " Generic options:\n" +msgstr " Generelle flag:\n" + +#: dllwrap.c:497 +msgid " --quiet, -q Work quietly\n" +msgstr " --quiet, -q Arbejd stille\n" + +#: dllwrap.c:498 +msgid " --verbose, -v Verbose\n" +msgstr " --verbose, -v Udførlig\n" + +#: dllwrap.c:499 +msgid " --version Print dllwrap version\n" +msgstr " --version Vis versionsinformation for dllwrap\n" + +#: dllwrap.c:500 +msgid " --implib Synonym for --output-lib\n" +msgstr " --implib Synonym for --output-lib\n" + +#: dllwrap.c:501 +#, c-format +msgid " Options for %s:\n" +msgstr " Flag for %s:\n" + +#: dllwrap.c:502 +msgid " --driver-name Defaults to \"gcc\"\n" +msgstr " --driver-name Forvalgt til \"gcc\"\n" + +#: dllwrap.c:503 +msgid " --driver-flags Override default ld flags\n" +msgstr " --driver-flags Forbigå forvalgte flag for ld\n" + +#: dllwrap.c:504 +msgid " --dlltool-name Defaults to \"dlltool\"\n" +msgstr " --dlltool-name Forvalgt til \"dlltool\"\n" + +#: dllwrap.c:505 +msgid " --entry Specify alternate DLL entry point\n" +msgstr " --entry Giv alternativ indgangspunkt i DLL'en\n" + +#: dllwrap.c:506 +msgid " --image-base Specify image base address\n" +msgstr " --image-base Giv billedets baseadresse\n" + +#: dllwrap.c:507 +msgid " --target i386-cygwin32 or i386-mingw32\n" +msgstr " --target i386-cygwin32 eller i386-mingw32\n" + +#: dllwrap.c:508 +msgid " --dry-run Show what needs to be run\n" +msgstr " --dry-run Gør intet andet end at vise hvad som bliver køret\n" + +#: dllwrap.c:509 +msgid " --mno-cygwin Create Mingw DLL\n" +msgstr " --mno-cygwin Opret Mingw-DLL\n" + +#: dllwrap.c:510 +msgid " Options passed to DLLTOOL:\n" +msgstr " Flag som sendes til DLLTOOL:\n" + +#: dllwrap.c:511 +msgid " --machine \n" +msgstr " --machine \n" + +#: dllwrap.c:512 +msgid " --output-exp Generate export file.\n" +msgstr " --output-exp Generér exportfil.\n" + +#: dllwrap.c:513 +msgid " --output-lib Generate input library.\n" +msgstr " --output-lib Generér inddatabibliotek.\n" + +#: dllwrap.c:514 +msgid " --add-indirect Add dll indirects to export file.\n" +msgstr " --add-indirect Tilføj indirekte dll til eksportfilen.\n" + +#: dllwrap.c:515 +msgid " --dllname Name of input dll to put into output lib.\n" +msgstr " --dllname Navn på inddata-dll som skal indsættes i uddatabiblioteket.\n" + +#: dllwrap.c:516 +msgid " --def Name input .def file\n" +msgstr " --def Navngiv .def-inddatafilen\n" + +#: dllwrap.c:517 +msgid " --output-def Name output .def file\n" +msgstr " --output-def Navngiv .def-uddatafilen\n" + +#: dllwrap.c:518 +msgid " --export-all-symbols Export all symbols to .def\n" +msgstr " --export-all-symbols Exportér alle symboler til .def\n" + +#: dllwrap.c:519 +msgid " --no-export-all-symbols Only export .drectve symbols\n" +msgstr " --no-export-all-symbols Exportér kun .drectve-symboler\n" + +#: dllwrap.c:520 +msgid " --exclude-symbols Exclude from .def\n" +msgstr " --exclude-symbols Undtag symbolerne i fra .def\n" + +#: dllwrap.c:521 +msgid " --no-default-excludes Zap default exclude symbols\n" +msgstr " --no-default-excludes Bortse fra forvalgte undtagne symboler\n" + +#: dllwrap.c:522 +msgid " --base-file Read linker generated base file\n" +msgstr " --base-file Læs lænkergenereret basefil\n" + +#: dllwrap.c:523 +msgid " --no-idata4 Don't generate idata$4 section\n" +msgstr " --no-idata4 Generér ingen idata$4-sektion\n" + +#: dllwrap.c:524 +msgid " --no-idata5 Don't generate idata$5 section\n" +msgstr " --no-idata5 Generér ingen idata$5-sektion\n" + +#: dllwrap.c:525 +msgid " -U Add underscores to .lib\n" +msgstr " -U Sæt understregninger i .lib\n" + +#: dllwrap.c:526 +msgid " -k Kill @ from exported names\n" +msgstr " -k Fjern @ fra eksporterede navne\n" + +#: dllwrap.c:527 +msgid " --add-stdcall-alias Add aliases without @\n" +msgstr " --add-stdcall-alias Tilføj aliaser uden @\n" + +#: dllwrap.c:528 +msgid " --as Use for assembler\n" +msgstr " --as Brug som assembler\n" + +#: dllwrap.c:529 +msgid " --nodelete Keep temp files.\n" +msgstr " --nodelete Behold temporære filer.\n" + +#: dllwrap.c:530 +msgid " Rest are passed unmodified to the language driver\n" +msgstr " Øvrige flag sendes uændrede til programeringsprogsenheden\n" + +#: dllwrap.c:802 +msgid "Must provide at least one of -o or --dllname options" +msgstr "Angiv mindst et af flagene -o eller --dllname" + +#: dllwrap.c:830 +msgid "" +"no export definition file provided.\n" +"Creating one, but that may not be what you want" +msgstr "" +"ingen eksport-definitionsfil angaves.\n" +"Opretter én, men det er måske ikke hvad du ønsker" + +# Indenteringen er øged til at oversættelsen skal få plads fremfor +# kolonet på alle 4 strenge. +#: dllwrap.c:992 +#, c-format +msgid "DLLTOOL name : %s\n" +msgstr "DLLVERKTYG navn : %s\n" + +# Indenteringen er øged til at oversættelsen skal få plads fremfor +# kolonet på alle 4 strenge. +#: dllwrap.c:993 +#, c-format +msgid "DLLTOOL options : %s\n" +msgstr "DLLTOOL flag: %s\n" + +# Indenteringen er øged til at oversættelsen skal få plads fremfor +# kolonet på alle 4 strenge. +#: dllwrap.c:994 +#, c-format +msgid "DRIVER name : %s\n" +msgstr "ENHED navn : %s\n" + +# Indenteringen er øged til at oversættelsen skal få plads fremfor +# kolonet på alle 4 strenge. +#: dllwrap.c:995 +#, c-format +msgid "DRIVER options : %s\n" +msgstr "ENHED flag : %s\n" + +#: emul_aix.c:52 +#, fuzzy, c-format +msgid " [-g] - 32 bit small archive\n" +msgstr " x[o] - hente fil(er) fra arkivet\n" + +#: emul_aix.c:53 +#, fuzzy +msgid " [-X32] - ignores 64 bit objects\n" +msgstr " [-X32_64] - (ignoreret)\n" + +#: emul_aix.c:54 +#, fuzzy +msgid " [-X64] - ignores 32 bit objects\n" +msgstr " [-X32_64] - (ignoreret)\n" + +#: emul_aix.c:55 +msgid " [-X32_64] - accepts 32 and 64 bit objects\n" +msgstr "" + +#: ieee.c:317 +msgid "unexpected end of debugging information" +msgstr "uventet slut på fejlsøgningsinformationen" + +#: ieee.c:412 +msgid "invalid number" +msgstr "ugyldigt tal" + +#: ieee.c:471 +msgid "invalid string length" +msgstr "ugyldig strenglængde" + +#: ieee.c:528 ieee.c:569 +msgid "expression stack overflow" +msgstr "overløb i udtryksstakken" + +#: ieee.c:548 +msgid "unsupported IEEE expression operator" +msgstr "IEEE-udtryksoperator som ikke understøttes" + +#: ieee.c:563 +msgid "unknown section" +msgstr "ukendt sektion" + +#: ieee.c:584 +msgid "expression stack underflow" +msgstr "underløb i udtryksstakken" + +#: ieee.c:598 +msgid "expression stack mismatch" +msgstr "fejlbalanceret udtryksstak" + +#: ieee.c:637 +msgid "unknown builtin type" +msgstr "ukendt indbygget type" + +#: ieee.c:782 +msgid "BCD float type not supported" +msgstr "flydendetalstype BCD understøttes ikke" + +#: ieee.c:928 +msgid "unexpected number" +msgstr "uventet tal" + +#: ieee.c:935 +msgid "unexpected record type" +msgstr "uventet posttype" + +#: ieee.c:968 +msgid "blocks left on stack at end" +msgstr "block stadig på stakken ved slutningen" + +#: ieee.c:1233 +msgid "unknown BB type" +msgstr "ukendt BB-type" + +#: ieee.c:1242 +msgid "stack overflow" +msgstr "overløb i stakken" + +#: ieee.c:1267 +msgid "stack underflow" +msgstr "underløb i stakken" + +#: ieee.c:1381 ieee.c:1453 ieee.c:2152 +msgid "illegal variable index" +msgstr "utilladt variabelindex" + +#: ieee.c:1431 +msgid "illegal type index" +msgstr "utilladt typeindex" + +#: ieee.c:1441 ieee.c:1478 +msgid "unknown TY code" +msgstr "ukendt TY-kode" + +#: ieee.c:1460 +msgid "undefined variable in TY" +msgstr "udefineret variabel i TY" + +#. Pascal file name. FIXME. +#: ieee.c:1871 +msgid "Pascal file name not supported" +msgstr "Pascal-filnavn understøttes ikke" + +# BUGG: qualif>i inddatafil [uddatafil]\n" + +#: nlmconv.c:1108 +msgid " Convert an object file into a NetWare Loadable Module\n" +msgstr "Konvertér en objektfil til et indlæsningsbart NetWare-modul\n" + +#: nlmconv.c:1109 +msgid "" +" The options are:\n" +" -I --input-target= Set the input binary file format\n" +" -O --output-target= Set the output binary file format\n" +" -T --header-file= Read for NLM header information\n" +" -l --linker= Use for any linking\n" +" -d --debug Display on stderr the linker command line\n" +" -h --help Display this information\n" +" -v --version Display the program's version\n" +msgstr "" + +#: nlmconv.c:1151 +#, c-format +msgid "support not compiled in for %s" +msgstr "ikke kompileret med understøttelse for %s" + +#: nlmconv.c:1191 +msgid "make section" +msgstr "opret sektion" + +#: nlmconv.c:1205 +msgid "set section size" +msgstr "sæt sektionsstørrelse" + +#: nlmconv.c:1211 +msgid "set section alignment" +msgstr "" + +#: nlmconv.c:1215 +msgid "set section flags" +msgstr "sæt sektionsflag" + +#: nlmconv.c:1226 +msgid "set .nlmsections size" +msgstr "sæt .nlmsektions størrelse" + +#: nlmconv.c:1314 nlmconv.c:1322 nlmconv.c:1331 nlmconv.c:1336 +msgid "set .nlmsection contents" +msgstr "sæt .nlmsektions indhold" + +#: nlmconv.c:1837 +msgid "stub section sizes" +msgstr "sektionsstørrelser for stub" + +#: nlmconv.c:1886 +msgid "writing stub" +msgstr "skriver stub" + +#: nlmconv.c:1975 +#, c-format +msgid "unresolved PC relative reloc against %s" +msgstr "uløst PC-relativ relokalisering mod %s" + +#: nlmconv.c:2039 +#, c-format +msgid "overflow when adjusting relocation against %s" +msgstr "overløb ved justeringen af relokalisering mod %s" + +#: nlmconv.c:2156 +#, c-format +msgid "%s: execution of %s failed: " +msgstr "%s: udførsel af %s mislykkedes: " + +#: nlmconv.c:2171 +#, c-format +msgid "Execution of %s failed" +msgstr "Eksekvering af %s mislykkedes" + +#: nm.c:246 size.c:85 strings.c:650 +#, fuzzy, c-format +msgid "Usage: %s [option(s)] [file(s)]\n" +msgstr "Brug: %s inddatafil(er)\n" + +#: nm.c:247 +#, fuzzy +msgid " List symbols in [file(s)] (a.out by default).\n" +msgstr "List symboler i FILerne (eller a.out).\n" + +#: nm.c:248 +#, fuzzy +msgid "" +" The options are:\n" +" -a, --debug-syms Display debugger-only symbols\n" +" -A, --print-file-name Print name of the input file before every symbol\n" +" -B Same as --format=bsd\n" +" -C, --demangle[=STYLE] Decode low-level symbol names into user-level names\n" +" The STYLE, if specified, can be `auto' (the default),\n" +" `gnu', 'lucid', 'arm', 'hp', 'edg' or 'gnu-new-abi'\n" +" --no-demangle Do not demangle low-level symbol names\n" +" -D, --dynamic Display dynamic symbols instead of normal symbols\n" +" --defined-only Display only defined symbols\n" +" -e (ignored)\n" +" -f, --format=FORMAT Use the output format FORMAT. FORMAT can be `bsd',\n" +" `sysv' or `posix'. The default is `bsd'\n" +" -g, --extern-only Display only external symbols\n" +" -l, --line-numbers Use debugging information to find a filename and\n" +" line number for each symbol\n" +" -n, --numeric-sort Sort symbols numerically by address\n" +" -o Same as -A\n" +" -p, --no-sort Do not sort the symbols\n" +" -P, --portability Same as --format=posix\n" +" -r, --reverse-sort Reverse the sense of the sort\n" +" -S, --print-size Print size of defined symbols\n" +" -s, --print-armap Include index for symbols from archive members\n" +" --size-sort Sort symbols by size\n" +" -t, --radix=RADIX Use RADIX for printing symbol values\n" +" --target=BFDNAME Specify the target object format as BFDNAME\n" +" -u, --undefined-only Display only undefined symbols\n" +" -X 32_64 (ignored)\n" +" -h, --help Display this information\n" +" -V, --version Display this program's version number\n" +"\n" +msgstr "" +"\n" +" -a, --debug-syms Vis kun fejlsøgningssymboler\n" +" -A, --print-file-name Skriv navnet på inddatafilen for hvert symbol\n" +" -B Samma som --format=bsd\n" +" -C, --demangle[=STIL] Avkoda lavniveausymbolnavn til brugerniveaunavn\n" +" STIL kan være \"auto\" (det forvalgte), \"gnu\",\n" +" \"lucid\", \"arm\", \"hp\", \"edg\" eller \"gnu-new-abi\"\n" +" --no-demangle Avkoda ikke lavniveausymbolnavn\n" +" -D, --dynamic Vis dynamiske symboler i stedet for normale symboler\n" +" --defined-only Vis kun definerede symboler\n" +" -e (ignoreres)\n" +" -f, --format=FORMAT Brug FORMAT som uddataformat. FORMAT kan vara\n" +" \"bsd\", \"sysv\" eller \"posix\". Forvalet er \"bsd\"\n" +" -g, --extern-only Vis kun externe symboler\n" +" -h, --help Vis denne hjælpen\n" +" -l, --line-numbers Brug fejlsøgningsinformationen til at slå op\n" +" filnavn og linjenummer for hvert symbol\n" +" -n, --numeric-sort Sortere symboler numerisk efter adress\n" +" -o Samma som -A\n" +" -p, --no-sort Sortere ikke symbolerna\n" +" -P, --portability Samma som --format=posix\n" +" -r, --reverse-sort Sortere åt andre hållet\n" +" -s, --print-armap Ta med index for symboler i arkivmedlemmer\n" +" --size-sort Sortere symboler efter størrelse\n" +" -t, --radix=BAS Skriv tal i talbasen BAS\n" +" --target=BFD-NAVN Specificere målobjektets format som BFD-NAVN\n" +" -u, --undefined-only Vis kun udefinerede symboler\n" +" -V, --version Vis programmets versionsinformation\n" +" -X 32_64 (ignoreres)\n" +"\n" + +#: nm.c:281 objdump.c:217 +#, c-format +msgid "Report bugs to %s.\n" +msgstr "" +"Rapportér fejl til %s.\n" +"Rapportér fejl i oversættelsen til dansk@klid.dk.\n" + +#: nm.c:314 +#, c-format +msgid "%s: invalid radix" +msgstr "%s: ugyldig talbase" + +#: nm.c:339 +#, c-format +msgid "%s: invalid output format" +msgstr "%s: ugyldigt uddataformat" + +#: nm.c:456 +msgid "Only -X 32_64 is supported" +msgstr "Kun -X 32_64 understøttes" + +#: nm.c:498 +#, c-format +msgid "data size %ld" +msgstr "datastørrelse %ld" + +#: nm.c:523 readelf.c:5306 readelf.c:5342 +#, c-format +msgid ": %d" +msgstr ": %d" + +#: nm.c:525 readelf.c:5308 readelf.c:5354 +#, c-format +msgid ": %d" +msgstr ": %d" + +#: nm.c:527 readelf.c:5310 readelf.c:5357 +#, c-format +msgid ": %d" +msgstr ": %d" + +#: nm.c:1339 +#, c-format +msgid "" +"\n" +"\n" +"Undefined symbols from %s:\n" +"\n" +msgstr "" +"\n" +"\n" +"Udefinerede symboler fra %s:\n" +"\n" + +#: nm.c:1341 +#, c-format +msgid "" +"\n" +"\n" +"Symbols from %s:\n" +"\n" +msgstr "" +"\n" +"\n" +"Symboler fra %s:\n" +"\n" + +#: nm.c:1343 nm.c:1401 +msgid "" +"Name Value Class Type Size Line Section\n" +"\n" +msgstr "" +"Navn Værdi Klasse Type Størr. Linje Sektion\n" +"\n" + +#: nm.c:1346 nm.c:1404 +msgid "" +"Name Value Class Type Size Line Section\n" +"\n" +msgstr "" +"Navn Værdi Klasse Type Størr. Linje Sektion\n" +"\n" + +#: nm.c:1397 +#, c-format +msgid "" +"\n" +"\n" +"Undefined symbols from %s[%s]:\n" +"\n" +msgstr "" +"\n" +"\n" +"Udefinerede symboler fra %s[%s]:\n" +"\n" + +#: nm.c:1399 +#, c-format +msgid "" +"\n" +"\n" +"Symbols from %s[%s]:\n" +"\n" +msgstr "" +"\n" +"\n" +"Symboler fra %s[%s]:\n" +"\n" + +#: nm.c:1614 +msgid "" +"\n" +"Archive index:\n" +msgstr "" +"\n" +"Arkivindex:\n" + +#: objcopy.c:363 srconv.c:1952 +#, fuzzy, c-format +msgid "Usage: %s [option(s)] in-file [out-file]\n" +msgstr "Brug: %s inddatafil [uddatafil]\n" + +#: objcopy.c:364 +msgid " Copies a binary file, possibly transforming it in the process\n" +msgstr "" + +#: objcopy.c:365 objcopy.c:435 +msgid " The options are:\n" +msgstr " Flagene er:\n" + +#: objcopy.c:366 +#, fuzzy +msgid "" +" -I --input-target Assume input file is in format \n" +" -O --output-target Create an output file in format \n" +" -B --binary-architecture Set arch of output file, when input is binary\n" +" -F --target Set both input and output format to \n" +" --debugging Convert debugging information, if possible\n" +" -p --preserve-dates Copy modified/access timestamps to the output\n" +" -j --only-section Only copy section into the output\n" +" -R --remove-section Remove section from the output\n" +" -S --strip-all Remove all symbol and relocation information\n" +" -g --strip-debug Remove all debugging symbols\n" +" --strip-unneeded Remove all symbols not needed by relocations\n" +" -N --strip-symbol Do not copy symbol \n" +" -K --keep-symbol Only copy symbol \n" +" -L --localize-symbol Force symbol to be marked as a local\n" +" -G --keep-global-symbol Localize all symbols except \n" +" -W --weaken-symbol Force symbol to be marked as a weak\n" +" --weaken Force all global symbols to be marked as weak\n" +" -x --discard-all Remove all non-global symbols\n" +" -X --discard-locals Remove any compiler-generated symbols\n" +" -i --interleave Only copy one out of every bytes\n" +" -b --byte Select byte in every interleaved block\n" +" --gap-fill Fill gaps between sections with \n" +" --pad-to Pad the last section up to address \n" +" --set-start Set the start address to \n" +" {--change-start|--adjust-start} \n" +" Add to the start address\n" +" {--change-addresses|--adjust-vma} \n" +" Add to LMA, VMA and start addresses\n" +" {--change-section-address|--adjust-section-vma} {=|+|-}\n" +" Change LMA and VMA of section by \n" +" --change-section-lma {=|+|-}\n" +" Change the LMA of section by \n" +" --change-section-vma {=|+|-}\n" +" Change the VMA of section by \n" +" {--[no-]change-warnings|--[no-]adjust-warnings}\n" +" Warn if a named section does not exist\n" +" --set-section-flags =\n" +" Set section 's properties to \n" +" --add-section = Add section found in to output\n" +" --rename-section =[,] Rename section to \n" +" --change-leading-char Force output format's leading character style\n" +" --remove-leading-char Remove leading character from global symbols\n" +" --redefine-sym = Redefine symbol name to \n" +" --srec-len Restrict the length of generated Srecords\n" +" --srec-forceS3 Restrict the type of generated Srecords to S3\n" +" --strip-symbols -N for all symbols listed in \n" +" --keep-symbols -K for all symbols listed in \n" +" --localize-symbols -L for all symbols listed in \n" +" --keep-global-symbols -G for all symbols listed in \n" +" --weaken-symbols -W for all symbols listed in \n" +" --alt-machine-code Use alternate machine code for output\n" +" -v --verbose List all object files modified\n" +" -V --version Display this program's version number\n" +" -h --help Display this output\n" +msgstr "" +" -I --input-target Antag inddatafilens format er \n" +" -O --output-target Opret uddatafilen i formatet \n" +" -B --binary-architecture Vælg arkitektur for udfil når inddata er binår\n" +" -F --target Sætt både in- og udformatet til \n" +" --debugging Konvertere fejlsøgningsinfo, om muligt\n" +" -p --preserve-dates Kopiér ændrings/adgangtider til uddatan\n" +" -j --only-section Kopiér kun sektion til uddatan\n" +" -R --remove-section Fjern sektion fra uddatan\n" +" -S --strip-all Fjern all symbol- og relokaliseringsinfo\n" +" -g --strip-debug Fjern alle fejlsøgningssymboler\n" +" --strip-unneeded Fjern symboler onødiga for relokalisering\n" +" -N --strip-symbol Kopiér ikke symbol \n" +" -K --keep-symbol Kopiér kun symbol \n" +" -L --localize-symbol Markere symbol som lokal\n" +" -G --keep-global-symbol Gør alle symboler lokale, forutom \n" +" -W --weaken-symbol Markere symbol som vek\n" +" --weaken Markere alle globale symboler som veka\n" +" -x --discard-all Fjern alle ikke-globale symboler\n" +" -X --discard-locals Fjern alle oversættergenererede symboler\n" +" -i --interleave Kopiér kun en af hvert byte\n" +" -b --byte Vælg ud 'e byten i hvert intervall\n" +" --gap-fill Fyll luckor mellem sektionerne med \n" +" --pad-to Fyll ud efter sidste sektionen frem til \n" +" --set-start Sætt startadressen til \n" +" {--change-start|--adjust-start} <økn>\n" +" Tilføj <økn> til startadressen\n" +" {--change-addresses|--adjust-vma} <økn>\n" +" Tilføj <økn> til LMA, VMA og startedr.\n" +" {--change-section-address|--adjust-section-vma} {=|+|-}\n" +" Ændra LMA og VMA på sektion med \n" +" --change-section-lma {=|+|-}\n" +" Ændra LMA på sektion med \n" +" --change-section-vma {=|+|-}\n" +" Ændra VMA på sektion med \n" +" {--[no-]change-warnings|--[no-]adjust-warnings}\n" +" Advar (inte/[no-]) om en sektion ikke findes\n" +" --set-section-flags =\n" +" Sætt sektion s attribut til \n" +" --add-section = Tilføj sektion i til uddatan\n" +" --rename-section =[,] Skift navn på sektion til \n" +" --change-leading-char Ændra til udformatets type af inledningstegn\n" +" --remove-leading-char Fjern inledningstegn fra globale symboler\n" +" --redefine-sym = Definere om ssymbolet med navn til \n" +" --srec-len Begrænsa længden på genererede S-poster\n" +" --srec-forceS3 Begrænsa typen af genererede S-poster til S3\n" +" --strip-symbols -N for alle symboler som listes i \n" +" --keep-symbols -K for alle symboler som listes i \n" +" --localize-symbols -L for alle symboler som listes i \n" +" --keep-global-symbols -G for alle symboler som listes i \n" +" --weaken-symbols -W for alle symboler som listes i \n" +" --alt-machine-code Brug alternativ maskinkode for uddata\n" +" -v --verbose Lista alle forændrede objektfiler\n" +" -V --version Vis programmets versionsinformation\n" +" -h --help Vis denne hjælp\n" + +#: objcopy.c:433 +#, fuzzy, c-format +msgid "Usage: %s in-file(s)\n" +msgstr "Brug: %s inddatafil(er)\n" + +#: objcopy.c:434 +msgid " Removes symbols and sections from files\n" +msgstr "" + +#: objcopy.c:436 +#, fuzzy +msgid "" +" -I --input-target= Assume input file is in format \n" +" -O --output-target= Create an output file in format \n" +" -F --target= Set both input and output format to \n" +" -p --preserve-dates Copy modified/access timestamps to the output\n" +" -R --remove-section= Remove section from the output\n" +" -s --strip-all Remove all symbol and relocation information\n" +" -g -S -d --strip-debug Remove all debugging symbols\n" +" --strip-unneeded Remove all symbols not needed by relocations\n" +" -N --strip-symbol= Do not copy symbol \n" +" -K --keep-symbol= Only copy symbol \n" +" -x --discard-all Remove all non-global symbols\n" +" -X --discard-locals Remove any compiler-generated symbols\n" +" -v --verbose List all object files modified\n" +" -V --version Display this program's version number\n" +" -h --help Display this output\n" +" -o Place stripped output into \n" +msgstr "" +" -I --input-target Antag inddatafilens format er \n" +" -O --output-target Opret uddatafilen i formatet \n" +" -F --target Sætt både in- og udformatet til \n" +" -p --preserve-dates Kopiér ændrings/adgangtider til uddatan\n" +" -R --remove-section Fjern sektion fra uddatan\n" +" -s --strip-all Fjern all symbol- og relokaliseringsinfo\n" +" -g -S --strip-debug Fjern alle fejlsøgningssymboler\n" +" --strip-unneeded Fjern symboler onødiga for relokaliseringen\n" +" -N --strip-symbol Kopiér ikke symbol \n" +" -K --keep-symbol Kopiér kun symbol \n" +" -x --discard-all Fjern alle ikke-globale symboler\n" +" -X --discard-locals Fjern alle oversættergenererede symboler\n" +" -v --verbose Lista alle forændrede objektfiler\n" +" -V --version Vis programmets versionsinformation\n" +" -h --help Vis denne hjælp\n" +" -o gem den udrensade uddatan i \n" + +#: objcopy.c:506 +#, c-format +msgid "unrecognized section flag `%s'" +msgstr "ukendt sektionsflag \"%s\"" + +#: objcopy.c:507 +#, c-format +msgid "supported flags: %s" +msgstr "flag som håndteres: %s" + +#: objcopy.c:584 objcopy.c:2243 +#, c-format +msgid "cannot stat: %s: %s" +msgstr "kan ikke tage status: %s: %s" + +#: objcopy.c:591 objcopy.c:2261 +#, c-format +msgid "cannot open: %s: %s" +msgstr "kan ikke åbne: %s: %s" + +#: objcopy.c:594 objcopy.c:2265 +#, c-format +msgid "%s: fread failed" +msgstr "%s: fread mislykkedes" + +#: objcopy.c:667 +#, c-format +msgid "Ignoring rubbish found on line %d of %s" +msgstr "Ignorerer snavs fundet på linje %d i %s" + +#: objcopy.c:888 +#, c-format +msgid "%s: Multiple redefinition of symbol \"%s\"" +msgstr "%s: Flere omdefineringer af symbol \"%s\"" + +#: objcopy.c:893 +#, c-format +msgid "%s: Symbol \"%s\" is target of more than one redefinition" +msgstr "%s: Symbol \"%s\" er mål for mere end en omdefinering" + +#: objcopy.c:945 +msgid "Unable to change endianness of input file(s)" +msgstr "Kan ikke ændre endian-type på inddatafilerne" + +#: objcopy.c:953 +#, c-format +msgid "copy from %s(%s) to %s(%s)\n" +msgstr "kopierer fra %s(%s) til %s(%s)\n" + +#: objcopy.c:977 +#, c-format +msgid "Warning: Output file cannot represent architecture %s" +msgstr "Advarsel: Uddatafilen kan ikke repræsentere arkitektur %s" + +#: objcopy.c:1004 +#, c-format +msgid "can't create section `%s': %s" +msgstr "kan ikke oprette sektion \"%s\": %s" + +#: objcopy.c:1090 +#, c-format +msgid "Can't fill gap after %s: %s" +msgstr "Kan ikke fylde hullet efter %s: %s" + +#: objcopy.c:1115 +#, c-format +msgid "Can't add padding to %s: %s" +msgstr "Kan ikke fylde ud efter %s: %s" + +#: objcopy.c:1254 +#, c-format +msgid "%s: error copying private BFD data: %s" +msgstr "%s: fejl ved kopiering af privat BFD-data: %s" + +#: objcopy.c:1267 +msgid "unknown alternate machine code, ignored" +msgstr "ukendt alternativ maskinkode, ignoreret" + +#: objcopy.c:1300 objcopy.c:1330 +#, c-format +msgid "cannot mkdir %s for archive copying (error: %s)" +msgstr "kan ikke oprette katalog %s for arkivkopiering (fejl: %s)" + +#: objcopy.c:1497 +#, c-format +msgid "Multiple renames of section %s" +msgstr "Flere navneskift på sektion %s" + +#: objcopy.c:1581 +msgid "making" +msgstr "fremstilling" + +#: objcopy.c:1590 +msgid "size" +msgstr "størrelse" + +#: objcopy.c:1604 +msgid "vma" +msgstr "vma" + +#: objcopy.c:1630 +msgid "alignment" +msgstr "justering" + +#: objcopy.c:1638 +msgid "flags" +msgstr "flag" + +#: objcopy.c:1655 +msgid "private data" +msgstr "privat data" + +#: objcopy.c:1663 +#, c-format +msgid "%s: section `%s': error in %s: %s" +msgstr "%s: sektion \"%s\": fejl på %s: %s" + +#: objcopy.c:1946 +#, c-format +msgid "%s: can't create debugging section: %s" +msgstr "%s: kan ikke oprette fejlsøgningssektion: %s" + +#: objcopy.c:1961 +#, c-format +msgid "%s: can't set debugging section contents: %s" +msgstr "%s: kan ikke sætte indeholdet i fejlsøgningssektionen: %s" + +#: objcopy.c:1970 +#, c-format +msgid "%s: don't know how to write debugging information for %s" +msgstr "%s: véd ikke hvordan man skriver fejlsøgningsinformation for %s" + +#: objcopy.c:2078 +#, c-format +msgid "%s: cannot stat: %s" +msgstr "%s: kan ikke tage status: %s" + +#: objcopy.c:2129 +msgid "byte number must be non-negative" +msgstr "byte-nr må ikke være negativt" + +#: objcopy.c:2139 +msgid "interleave must be positive" +msgstr "intervalstørrelsen skal være positiv" + +#: objcopy.c:2159 objcopy.c:2167 +#, c-format +msgid "%s both copied and removed" +msgstr "%s både kopieret og fjernet" + +#: objcopy.c:2240 objcopy.c:2310 objcopy.c:2410 objcopy.c:2437 objcopy.c:2461 +#: objcopy.c:2465 objcopy.c:2485 +#, c-format +msgid "bad format for %s" +msgstr "fejlagtigt format på %s" + +#: objcopy.c:2379 +#, c-format +msgid "Warning: truncating gap-fill from 0x%s to 0x%x" +msgstr "Advarsel: afkorter udfyldningsværdien fra 0x%s til 0x%x" + +#: objcopy.c:2531 +msgid "alternate machine code index must be positive" +msgstr "index for alternativ maskinkode skal være positivt" + +#: objcopy.c:2550 +msgid "byte number must be less than interleave" +msgstr "byte-nr skal være mindre end antal byte i intervallet" + +#: objcopy.c:2577 +#, c-format +msgid "architecture %s unknown" +msgstr "arkitektur %s er ukendt" + +#: objcopy.c:2581 +msgid "Warning: input target 'binary' required for binary architecture parameter." +msgstr "Advarsel: inddata skal have formatet 'binary' for binærarkitektursparametre." + +#: objcopy.c:2582 +#, c-format +msgid " Argument %s ignored" +msgstr " Argument %s ignoreres" + +#: objcopy.c:2588 +#, c-format +msgid "Cannot stat: %s: %s" +msgstr "Kan ikke tage status: %s: %s" + +#: objcopy.c:2628 objcopy.c:2642 +#, c-format +msgid "%s %s%c0x%s never used" +msgstr "%s %s%c0x%s bruges aldrig" + +#: objdump.c:165 +#, fuzzy, c-format +msgid "Usage: %s \n" +msgstr "Brug: %s inddatafil(er)\n" + +#: objdump.c:166 +#, fuzzy +msgid " Display information from object .\n" +msgstr "Vis information fra en objektFIL.\n" + +#: objdump.c:167 +msgid " At least one of the following switches must be given:\n" +msgstr "Mindst et af følgende flag skal angives:\n" + +#: objdump.c:168 +#, fuzzy +msgid "" +" -a, --archive-headers Display archive header information\n" +" -f, --file-headers Display the contents of the overall file header\n" +" -p, --private-headers Display object format specific file header contents\n" +" -h, --[section-]headers Display the contents of the section headers\n" +" -x, --all-headers Display the contents of all headers\n" +" -d, --disassemble Display assembler contents of executable sections\n" +" -D, --disassemble-all Display assembler contents of all sections\n" +" -S, --source Intermix source code with disassembly\n" +" -s, --full-contents Display the full contents of all sections requested\n" +" -g, --debugging Display debug information in object file\n" +" -G, --stabs Display (in raw form) any STABS info in the file\n" +" -t, --syms Display the contents of the symbol table(s)\n" +" -T, --dynamic-syms Display the contents of the dynamic symbol table\n" +" -r, --reloc Display the relocation entries in the file\n" +" -R, --dynamic-reloc Display the dynamic relocation entries in the file\n" +" -v, --version Display this program's version number\n" +" -i, --info List object formats and architectures supported\n" +" -H, --help Display this information\n" +msgstr "" +" -a, --archive-headers Vis information fra arkivhoveden\n" +" -f, --file-headers Vis indeholdet i det overgripende filhovedet\n" +" -p, --private-headers Vis indeholdet i objektformatspecifikke filhoveden\n" +" -h, --[section-]headers Vis indeholdet i sektionshoveden\n" +" -x, --all-headers Vis indeholdet i alle hoveden\n" +" -d, --disassemble Vis disassemblering af exekverbara sektioner\n" +" -D, --disassemble-all Vis disassemblering af alle sektioner\n" +" -S, --source Varva kildekode med disassemblering\n" +" -s, --full-contents Vis hele indeholdet i alle udvalgte sektioner\n" +" -g, --debugging Vis fejlsøgningsinformation fra objektfilen\n" +" -G, --stabs Vis (ubehandlet) eventuell STABS-info fra filen\n" +" -t, --syms Vis indeholdet i symboltabellen(erna)\n" +" -T, --dynamic-syms Vis indeholdet i tabellen med dynamiske symboler\n" +" -r, --reloc Vis relokaliseringsposterne i filen\n" +" -R, --dynamic-reloc Vis de dynamiske relokaliseringsposterne i filen\n" +" -V, --version Vis programmets versionsinformation\n" +" -i, --info Lista de objektformat og arkitekturer som håndteres\n" +" -H, --help Vis denne hjælp\n" + +#: objdump.c:190 +msgid "" +"\n" +" The following switches are optional:\n" +msgstr "" +"\n" +" Føljende flag er frivillige:\n" + +#: objdump.c:191 +msgid "" +" -b, --target=BFDNAME Specify the target object format as BFDNAME\n" +" -m, --architecture=MACHINE Specify the target architecture as MACHINE\n" +" -j, --section=NAME Only display information for section NAME\n" +" -M, --disassembler-options=OPT Pass text OPT on to the disassembler\n" +" -EB --endian=big Assume big endian format when disassembling\n" +" -EL --endian=little Assume little endian format when disassembling\n" +" --file-start-context Include context from start of file (with -S)\n" +" -l, --line-numbers Include line numbers and filenames in output\n" +" -C, --demangle[=STYLE] Decode mangled/processed symbol names\n" +" The STYLE, if specified, can be `auto', 'gnu',\n" +" 'lucid', 'arm', 'hp', 'edg', or 'gnu-new-abi'\n" +" -w, --wide Format output for more than 80 columns\n" +" -z, --disassemble-zeroes Do not skip blocks of zeroes when disassembling\n" +" --start-address=ADDR Only process data whoes address is >= ADDR\n" +" --stop-address=ADDR Only process data whoes address is <= ADDR\n" +" --prefix-addresses Print complete address alongside disassembly\n" +" --[no-]show-raw-insn Display hex alongside symbolic disassembly\n" +" --adjust-vma=OFFSET Add OFFSET to all displayed section addresses\n" +"\n" +msgstr "" +" -b, --target=BFDNAVN Specificér at målobjektets format er BFDNAVN\n" +" -m, --architecture=MASKINE Specificér at målarkitekturen er MASKINE\n" +" -j, --section=NAVN Vis kun information om sektion NAVN\n" +" -M, --disassembler-options=FLG Videresend FLG til disassemblereren\n" +" -EB --endian=big Antag big endian-format ved disassemblering\n" +" -EL --endian=little Antag little endian-format ved disassemblering\n" +" --file-start-context Medtag omgivelsen i begyndelsen af filen (med -S)\n" +" -l, --line-numbers Medtag linjenummre og filnavne i uddata\n" +" -C, --demangle[=STIL] Afkod kodede symbolnavne\n" +" STIL, hvis givet, kan være: \"auto\", \"gnu\",\n" +" \"lucid\", \"arm\", \"hp\", \"edg\", \"gnu-new-abi\"\n" +" -w, --wide Tilpas uddata til mere end 80 kolonner\n" +" -z, --disassemble-zeroes Hop ikke over blokke af nuller ved\n" +" disassemblering\n" +" --start-address=ADR Behandl kun data på adresser >= ADR\n" +" --stop-address=ADR Behandl kun data på adresser <= ADR\n" +" --prefix-addresses Vis fuldstændige adresser sammen med disassemblering.\n" +" --[no-]show-raw-insn Vis hex.-kode sammen med disassemblering\n" +" --adjust-vma=OFFSET Tilføj OFFSET til alle viste sektionsadresser\n" +"\n" + +#: objdump.c:358 +msgid "Sections:\n" +msgstr "Sektioner:\n" + +#: objdump.c:361 objdump.c:365 +msgid "Idx Name Size VMA LMA File off Algn" +msgstr "Idx Navn Størrelse VMA LMA Filoffs Just" + +#: objdump.c:367 +msgid "Idx Name Size VMA LMA File off Algn" +msgstr "Idx Navn Størrelse VMA LMA Filoffs Just" + +#: objdump.c:371 +msgid " Flags" +msgstr " Flag" + +#: objdump.c:419 +#, c-format +msgid "%s: not a dynamic object" +msgstr "%s: ikke et dynamisk objekt" + +#: objdump.c:433 +#, c-format +msgid "%s: No dynamic symbols" +msgstr "%s: Ingen dynamiske symboler" + +#: objdump.c:1114 +msgid "Out of virtual memory" +msgstr "Slut på virtuel hukommelse" + +#: objdump.c:1543 +#, c-format +msgid "Can't use supplied machine %s" +msgstr "Kan ikke bruge den opgivne maskine %s" + +#: objdump.c:1561 +#, c-format +msgid "Can't disassemble for architecture %s\n" +msgstr "Kan ikke disassemblere for arkitektur %s\n" + +#: objdump.c:1643 +#, c-format +msgid "Disassembly of section %s:\n" +msgstr "Disassemblering af sektion %s:\n" + +#: objdump.c:1818 +#, c-format +msgid "" +"No %s section present\n" +"\n" +msgstr "" +"Der findes ingen %s-sektion\n" +"\n" + +#: objdump.c:1825 +#, c-format +msgid "%s has no %s section" +msgstr "%s har ingen %s-sektion" + +#: objdump.c:1839 +#, c-format +msgid "Reading %s section of %s failed: %s" +msgstr "Læsning af %s-sektionen i %s mislykkedes: %s" + +#: objdump.c:1851 +#, c-format +msgid "Reading %s section of %s failed: %s\n" +msgstr "Læsning af %s-sektionen i %s mislykkedes: %s\n" + +#: objdump.c:1894 +#, c-format +msgid "" +"Contents of %s section:\n" +"\n" +msgstr "" +"Indhold i %s-sektionen:\n" +"\n" + +#: objdump.c:1994 +#, c-format +msgid "architecture: %s, " +msgstr "arkitektur: %s, " + +#: objdump.c:1997 +#, c-format +msgid "flags 0x%08x:\n" +msgstr "flag 0x%08x:\n" + +#: objdump.c:2010 +msgid "" +"\n" +"start address 0x" +msgstr "" +"\n" +"startadresse 0x" + +#: objdump.c:2042 +#, c-format +msgid "" +"\n" +"%s: file format %s\n" +msgstr "" +"\n" +"%s: filformat %s\n" + +#: objdump.c:2084 +#, c-format +msgid "%s: printing debugging information failed" +msgstr "%s: udskrift af fejlsøgningsinformationen mislykkedes" + +#: objdump.c:2161 +#, c-format +msgid "In archive %s:\n" +msgstr "I arkiv %s:\n" + +#: objdump.c:2213 +#, c-format +msgid "Contents of section %s:\n" +msgstr "Indhold i %s-sektionen:\n" + +#: objdump.c:2718 +#, c-format +msgid "BFD header file version %s\n" +msgstr "BFD-hovedfil version %s\n" + +#: objdump.c:2807 +msgid "unrecognized -E option" +msgstr "ukendt -E-flag" + +#: objdump.c:2818 +#, c-format +msgid "unrecognized --endian type `%s'" +msgstr "ukendt --endian-type \"%s\"" + +#: rdcoff.c:204 +#, c-format +msgid "parse_coff_type: Bad type code 0x%x" +msgstr "parse_coff_type: Fejlagtig typekode 0x%x" + +#: rdcoff.c:422 rdcoff.c:530 rdcoff.c:729 +#, c-format +msgid "bfd_coff_get_syment failed: %s" +msgstr "bfd_coff_get_syment mislykkedes: %s" + +#: rdcoff.c:438 rdcoff.c:749 +#, c-format +msgid "bfd_coff_get_auxent failed: %s" +msgstr "bfd_coff_get_auxent mislykkedes: %s" + +#: rdcoff.c:816 +#, c-format +msgid "%ld: .bf without preceding function" +msgstr "%ld: .bf mangler indledende funktion" + +#: rdcoff.c:866 +#, c-format +msgid "%ld: unexpected .ef\n" +msgstr "%ld: uventet .ef\n" + +#: rddbg.c:87 +#, c-format +msgid "%s: no recognized debugging information" +msgstr "%s: ingen kendt fejlsøgningsinformation" + +#: rddbg.c:410 +msgid "Last stabs entries before error:\n" +msgstr "De sidste stabs-poster inden fejlen:\n" + +#: readelf.c:328 +#, c-format +msgid "%s: Error: " +msgstr "%s: Fejl: " + +#: readelf.c:339 +#, c-format +msgid "%s: Warning: " +msgstr "%s: Advarsel: " + +#: readelf.c:361 +#, c-format +msgid "Unable to seek to %x for %s\n" +msgstr "Kan ikke opsøge %2$s på %1$x\n" + +#: readelf.c:372 +#, c-format +msgid "Out of memory allocating %d bytes for %s\n" +msgstr "Slut på hukommelse ved allokering af %d byte for %s\n" + +#: readelf.c:380 +#, c-format +msgid "Unable to read in %d bytes of %s\n" +msgstr "Kan ikke indlæse %d byte af %s\n" + +#: readelf.c:433 readelf.c:591 +#, c-format +msgid "Unhandled data length: %d\n" +msgstr "Størrelse på data som ikke kan behandles: %d\n" + +#: readelf.c:675 +msgid "Don't know about relocations on this machine architecture\n" +msgstr "Ved ikke hvordan man relokaliserer på denne maskinarkitektur\n" + +#: readelf.c:697 readelf.c:726 readelf.c:772 readelf.c:799 +msgid "relocs" +msgstr "relokaliseringer" + +#: readelf.c:708 readelf.c:737 readelf.c:782 readelf.c:809 +msgid "out of memory parsing relocs" +msgstr "slut på hukommelse ved tolkning af relokaliseringer" + +#: readelf.c:861 +#, fuzzy +msgid " Offset Info Type Sym. Value Symbol's Name + Addend\n" +msgstr " Offset Info Type Symbolværdi Symbolnavn + Tillæg\n" + +#: readelf.c:863 +#, fuzzy +msgid " Offset Info Type Sym.Value Sym. Name + Addend\n" +msgstr " Offset Info Type Symbolværdi Symbolnavn Tillægg\n" + +#: readelf.c:868 +#, fuzzy +msgid " Offset Info Type Sym. Value Symbol's Name\n" +msgstr " Offset Info Type Symbolværdi Symbolnavn\n" + +#: readelf.c:870 +#, fuzzy +msgid " Offset Info Type Sym.Value Sym. Name\n" +msgstr " Offset Info Type Symbolværdi Symbolnavn\n" + +#: readelf.c:878 +#, fuzzy +msgid " Offset Info Type Symbol's Value Symbol's Name + Addend\n" +msgstr " Offset Info Type Symbolværdi Symbolnavn\n" + +#: readelf.c:880 +#, fuzzy +msgid " Offset Info Type Sym. Value Sym. Name + Addend\n" +msgstr " Offset Info Type Symbolværdi Symbolnavn Tillægg\n" + +#: readelf.c:885 +#, fuzzy +msgid " Offset Info Type Symbol's Value Symbol's Name\n" +msgstr " Offset Info Type Symbolværdi Symbolnavn\n" + +#: readelf.c:887 +#, fuzzy +msgid " Offset Info Type Sym. Value Sym. Name\n" +msgstr " Offset Info Type Symbolværdi Symbolnavn\n" + +#: readelf.c:1134 readelf.c:1136 readelf.c:1184 readelf.c:1186 readelf.c:1195 +#: readelf.c:1197 +#, fuzzy, c-format +msgid "unrecognized: %-7lx" +msgstr "ukendt: %-7lx" + +#: readelf.c:1158 +#, c-format +msgid "" +msgstr "" + +#: readelf.c:1423 +#, c-format +msgid "Processor Specific: %lx" +msgstr "processorspecifik: %lx" + +#: readelf.c:1442 +#, c-format +msgid "Operating System specific: %lx" +msgstr "Operativsystemsspecifik: %lx" + +#: readelf.c:1445 readelf.c:2086 +#, c-format +msgid ": %lx" +msgstr ": %lx" + +#: readelf.c:1459 +msgid "NONE (None)" +msgstr "NONE (ingen)" + +#: readelf.c:1460 +msgid "REL (Relocatable file)" +msgstr "REL (relokaliseringsbar fil)" + +#: readelf.c:1461 +msgid "EXEC (Executable file)" +msgstr "EXEC (exekverbar fil)" + +#: readelf.c:1462 +msgid "DYN (Shared object file)" +msgstr "DYN (delt objektfil)" + +#: readelf.c:1463 +msgid "CORE (Core file)" +msgstr "CORE (hukommelsesfil)" + +#: readelf.c:1467 +#, c-format +msgid "Processor Specific: (%x)" +msgstr "processorspecifik: (%x)" + +#: readelf.c:1469 +#, c-format +msgid "OS Specific: (%x)" +msgstr "OS-specifikt: (%x)" + +#: readelf.c:1471 readelf.c:1573 readelf.c:2238 +#, c-format +msgid ": %x" +msgstr ": %x" + +#: readelf.c:1484 +msgid "None" +msgstr "Ingen" + +#: readelf.c:2278 +#, fuzzy +msgid "Usage: readelf elf-file(s)\n" +msgstr "Brug: readelf {flag} elf-fil(er)\n" + +#: readelf.c:2279 +msgid " Display information about the contents of ELF format files\n" +msgstr "" + +#: readelf.c:2280 +msgid "" +" Options are:\n" +" -a --all Equivalent to: -h -l -S -s -r -d -V -A -I\n" +" -h --file-header Display the ELF file header\n" +" -l --program-headers Display the program headers\n" +" --segments An alias for --program-headers\n" +" -S --section-headers Display the sections' header\n" +" --sections An alias for --section-headers\n" +" -e --headers Equivalent to: -h -l -S\n" +" -s --syms Display the symbol table\n" +" --symbols An alias for --syms\n" +" -n --notes Display the core notes (if present)\n" +" -r --relocs Display the relocations (if present)\n" +" -u --unwind Display the unwind info (if present)\n" +" -d --dynamic Display the dynamic segment (if present)\n" +" -V --version-info Display the version sections (if present)\n" +" -A --arch-specific Display architecture specific information (if any).\n" +" -D --use-dynamic Use the dynamic section info when displaying symbols\n" +" -x --hex-dump= Dump the contents of section \n" +" -w --debug-dump[=line,=info,=abbrev,=pubnames,=ranges,=macro,=frames,=str,=loc]\n" +" Display the contents of DWARF2 debug sections\n" +msgstr "" + +#: readelf.c:2301 +#, fuzzy +msgid "" +" -i --instruction-dump=\n" +" Disassemble the contents of section \n" +msgstr " Disassemblere indeholdet i sektion \n" + +#: readelf.c:2305 +msgid "" +" -I --histogram Display histogram of bucket list lengths\n" +" -W --wide Allow output width to exceed 80 characters\n" +" -H --help Display this information\n" +" -v --version Display the version number of readelf\n" +msgstr "" + +#: readelf.c:2327 +msgid "Out of memory allocating dump request table." +msgstr "Slut på hukommelse ved allokering af tabel for ønskede udskrifter." + +#: readelf.c:2491 +#, c-format +msgid "Unrecognized debug option '%s'\n" +msgstr "Ukendt fejlsøgningsargument \"%s\"\n" + +#: readelf.c:2519 +#, c-format +msgid "Invalid option '-%c'\n" +msgstr "Ugyldigt flag \"-%c\"\n" + +#: readelf.c:2532 +msgid "Nothing to do.\n" +msgstr "Intet at gøre.\n" + +#: readelf.c:2545 readelf.c:2562 readelf.c:4867 +msgid "none" +msgstr "ingen" + +#: readelf.c:2549 readelf.c:2566 readelf.c:2594 +#, c-format +msgid "" +msgstr "" + +#: readelf.c:2563 +msgid "2's complement, little endian" +msgstr "2-komplement, little endian" + +#: readelf.c:2564 +msgid "2's complement, big endian" +msgstr "2-komplement, big endian" + +#: readelf.c:2591 +msgid "Standalone App" +msgstr "Selvstændig app." + +#: readelf.c:2609 +msgid "Not an ELF file - it has the wrong magic bytes at the start\n" +msgstr "Ikke en ELF-fil - den har forkerte magiske byte i begyndelsen\n" + +#: readelf.c:2617 +msgid "ELF Header:\n" +msgstr "ELF-hoved:\n" + +#: readelf.c:2618 +msgid " Magic: " +msgstr " Magi: " + +#: readelf.c:2622 +#, c-format +msgid " Class: %s\n" +msgstr " Klasse: %s\n" + +#: readelf.c:2624 +#, c-format +msgid " Data: %s\n" +msgstr " Data: %s\n" + +#: readelf.c:2626 +#, c-format +msgid " Version: %d %s\n" +msgstr " Version: %d %s\n" + +#: readelf.c:2633 +#, c-format +msgid " OS/ABI: %s\n" +msgstr " OS/ABI: %s\n" + +#: readelf.c:2635 +#, c-format +msgid " ABI Version: %d\n" +msgstr " ABI-version: %d\n" + +#: readelf.c:2637 +#, c-format +msgid " Type: %s\n" +msgstr " Type: %s\n" + +#: readelf.c:2639 +#, c-format +msgid " Machine: %s\n" +msgstr " Maskine: %s\n" + +#: readelf.c:2641 +#, c-format +msgid " Version: 0x%lx\n" +msgstr " Version: 0x%lx\n" + +#: readelf.c:2644 +msgid " Entry point address: " +msgstr " Indgangsodresse: " + +#: readelf.c:2646 +msgid "" +"\n" +" Start of program headers: " +msgstr "" +"\n" +" Start for programhoveder: " + +#: readelf.c:2648 +msgid "" +" (bytes into file)\n" +" Start of section headers: " +msgstr "" +" (byte in i filen)\n" +" Start for sektionshoveder: " + +#: readelf.c:2650 +msgid " (bytes into file)\n" +msgstr " (byte inde i filen)\n" + +#: readelf.c:2652 +#, c-format +msgid " Flags: 0x%lx%s\n" +msgstr " Flag: 0x%lx%s\n" + +#: readelf.c:2655 +#, c-format +msgid " Size of this header: %ld (bytes)\n" +msgstr " Dette hoveds størrelse: %ld (byte)\n" + +#: readelf.c:2657 +#, c-format +msgid " Size of program headers: %ld (bytes)\n" +msgstr " Programhovedernes størrelse: %ld (byte)\n" + +#: readelf.c:2659 +#, c-format +msgid " Number of program headers: %ld\n" +msgstr " Antal programhoveder: %ld\n" + +#: readelf.c:2661 +#, c-format +msgid " Size of section headers: %ld (bytes)\n" +msgstr " Sektionshovedernes størrelse: %ld (byte)\n" + +#: readelf.c:2663 +#, c-format +msgid " Number of section headers: %ld" +msgstr " Antal sektionshoveder: %ld" + +#: readelf.c:2668 +#, c-format +msgid " Section header string table index: %ld" +msgstr " Sektionshovedets strengtabelsndx: %ld" + +#: readelf.c:2702 readelf.c:2738 +msgid "program headers" +msgstr "programhoveder" + +#: readelf.c:2772 +msgid "" +"\n" +"There are no program headers in this file.\n" +msgstr "" +"\n" +"Der findes ingen programhoveder i denne fil.\n" + +#: readelf.c:2778 +#, c-format +msgid "" +"\n" +"Elf file type is %s\n" +msgstr "" +"\n" +"Elf-filtype er %s\n" + +#: readelf.c:2779 +msgid "Entry point " +msgstr "Indgangspunkt " + +#: readelf.c:2781 +#, c-format +msgid "" +"\n" +"There are %d program headers, starting at offset " +msgstr "" +"\n" +"Der findes %d programhoveder, med begyndelse på offset " + +#: readelf.c:2792 readelf.c:3019 readelf.c:3065 readelf.c:3128 readelf.c:3195 +#: readelf.c:4229 readelf.c:4272 readelf.c:4461 readelf.c:5414 readelf.c:5428 +#: readelf.c:9659 readelf.c:9699 +msgid "Out of memory\n" +msgstr "Slut på hukommelse\n" + +# BUGG: plural-s +#: readelf.c:2810 readelf.c:2812 +#, fuzzy +msgid "" +"\n" +"Program Headers:\n" +msgstr "" +"\n" +"Programhoved%0.s:\n" + +#: readelf.c:2816 +msgid " Type Offset VirtAddr PhysAddr FileSiz MemSiz Flg Align\n" +msgstr " Type Offset VirtAdr FysAdr FilSt HukommelseSt Flg Just\n" + +#: readelf.c:2819 +msgid " Type Offset VirtAddr PhysAddr FileSiz MemSiz Flg Align\n" +msgstr " Type Offset VirtAdr FysAdr FilStrl HukommelseSt Flg Just\n" + +#: readelf.c:2823 +msgid " Type Offset VirtAddr PhysAddr\n" +msgstr " Type Offset VirtAdr FysAdr\n" + +#: readelf.c:2825 +msgid " FileSiz MemSiz Flags Align\n" +msgstr " FilStrl HukommelseStrl Flag Just\n" + +#: readelf.c:2925 +msgid "more than one dynamic segment\n" +msgstr "mere end et dynamisk segment\n" + +#: readelf.c:2933 +msgid "Unable to find program interpreter name\n" +msgstr "Kan ikke finde navnet på programtolken\n" + +#: readelf.c:2940 +#, c-format +msgid "" +"\n" +" [Requesting program interpreter: %s]" +msgstr "" +"\n" +" [Anmoder programtolkere: %s]" + +#: readelf.c:2958 +msgid "" +"\n" +" Section to Segment mapping:\n" +msgstr "" +"\n" +" Sektion til segment-afbildning:\n" + +#: readelf.c:2959 +msgid " Segment Sections...\n" +msgstr " Segmentsektioner...\n" + +#: readelf.c:3010 readelf.c:3056 +msgid "section headers" +msgstr "sektionshoveder" + +#: readelf.c:3104 readelf.c:3171 +msgid "symbols" +msgstr "symboler" + +#: readelf.c:3115 readelf.c:3182 +msgid "symtab shndx" +msgstr "symtab shndx" + +#: readelf.c:3284 +msgid "" +"\n" +"There are no sections in this file.\n" +msgstr "" +"\n" +"Der findes ingen sektioner i denne fil.\n" + +#: readelf.c:3290 +#, c-format +msgid "There are %d section headers, starting at offset 0x%lx:\n" +msgstr "Der findes %d sektionshoveder, med begyndelse på offset 0x%lx:\n" + +#: readelf.c:3307 readelf.c:3621 readelf.c:3968 readelf.c:5565 +msgid "string table" +msgstr "strengtabel" + +#: readelf.c:3328 +msgid "File contains multiple dynamic symbol tables\n" +msgstr "Filen indeholder flere tabeller med dynamiske symboler\n" + +#: readelf.c:3340 +msgid "File contains multiple dynamic string tables\n" +msgstr "Filen indeholder flere dynamiske strengtabeller\n" + +#: readelf.c:3346 +msgid "dynamic strings" +msgstr "dynamiske strenge" + +#: readelf.c:3352 +msgid "File contains multiple symtab shndx tables\n" +msgstr "Filen indeholder flere symtab-shndx-tabeller\n" + +# BUGG: plural-s +#: readelf.c:3390 +#, fuzzy +msgid "" +"\n" +"Section Headers:\n" +msgstr "" +"\n" +"Sektionshoved%0.s:\n" + +# BUGG: plural-s +#: readelf.c:3392 +#, fuzzy +msgid "" +"\n" +"Section Header:\n" +msgstr "" +"\n" +"Sektionshoved%0.s:\n" + +#: readelf.c:3396 +msgid " [Nr] Name Type Addr Off Size ES Flg Lk Inf Al\n" +msgstr " [Nr] Navn Type Adr Off Strl PS Flg Lk Inf Ju\n" + +#: readelf.c:3399 +msgid " [Nr] Name Type Address Off Size ES Flg Lk Inf Al\n" +msgstr " [Nr] Navn Type Adresse Off Strl PS Flg Lk Inf Ju\n" + +#: readelf.c:3402 +msgid " [Nr] Name Type Address Offset\n" +msgstr " [Nr] Navn Type Adresse Offset\n" + +#: readelf.c:3403 +msgid " Size EntSize Flags Link Info Align\n" +msgstr " Størrelse Poststørrelse Flag Lænk Info Just\n" + +#: readelf.c:3498 +msgid "" +"Key to Flags:\n" +" W (write), A (alloc), X (execute), M (merge), S (strings)\n" +" I (info), L (link order), G (group), x (unknown)\n" +" O (extra OS processing required) o (OS specific), p (processor specific)\n" +msgstr "" +"Nøgle til flagna:\n" +" W (skriv), A (allokér), X (eksekvér), M (flet), S (strenge)\n" +" I (info), L (lænkerorden), G (gruppe), x (ukendt)\n" +" O (ekstra OS-behandling kræves) o (OS-specifik), p (processor-specifik)\n" + +#: readelf.c:3559 +#, c-format +msgid "" +"\n" +"Relocation section at offset 0x%lx contains %ld bytes:\n" +msgstr "" +"\n" +"Relokaliseringssektionen på offset 0x%lx indeholder %ld byte:\n" + +#: readelf.c:3566 +msgid "" +"\n" +"There are no dynamic relocations in this file.\n" +msgstr "" +"\n" +"Der findes ingen dynamiske relokaliseringer i denne fil.\n" + +#: readelf.c:3593 +msgid "" +"\n" +"Relocation section " +msgstr "" +"\n" +"Relokaliseringssektion " + +#: readelf.c:3598 readelf.c:4031 readelf.c:4045 +#, c-format +msgid "'%s'" +msgstr "" + +#: readelf.c:3600 readelf.c:4047 +#, c-format +msgid " at offset 0x%lx contains %lu entries:\n" +msgstr " på offset 0x%lx indeholder %lu poster:\n" + +#: readelf.c:3638 +msgid "" +"\n" +"There are no relocations in this file.\n" +msgstr "" +"\n" +"Der findes ingen relokaliseringer i denne fil.\n" + +#: readelf.c:3834 +msgid "unwind table" +msgstr "tilbagerulningstabel" + +#: readelf.c:3885 readelf.c:3897 readelf.c:7890 readelf.c:7901 +#, c-format +msgid "Skipping unexpected symbol type %u\n" +msgstr "Hopper over uventet symboltype %u\n" + +#: readelf.c:3905 +#, c-format +msgid "Skipping unexpected relocation type %s\n" +msgstr "Hopper over uventet relokaliseringstype %s\n" + +#: readelf.c:3950 readelf.c:3975 +msgid "" +"\n" +"There are no unwind sections in this file.\n" +msgstr "" +"\n" +"Der findes ingen tilbagerulningssektioner i denne fil.\n" + +# BUGG: Fortsættelsen er ikke markeret for oversættning i koden og indeholder '-citattegn. +#: readelf.c:4026 +msgid "" +"\n" +"Could not find unwind info section for " +msgstr "" +"\n" +"Kunne ikke finde tilbagerulningssektion til " + +#: readelf.c:4038 +msgid "unwind info" +msgstr "tilbagerulningsinfo" + +#: readelf.c:4040 +msgid "" +"\n" +"Unwind section " +msgstr "" +"\n" +"Tilbagerulningssektion " + +#: readelf.c:4213 readelf.c:4256 +msgid "dynamic segment" +msgstr "dynamisk segment" + +#: readelf.c:4334 +msgid "" +"\n" +"There is no dynamic segment in this file.\n" +msgstr "" +"\n" +"Der findes intet dynamisk segment i denne fil.\n" + +#: readelf.c:4368 +msgid "Unable to seek to end of file!" +msgstr "Kan ikke søge til slutningen af filen!" + +#: readelf.c:4379 +msgid "Unable to determine the number of symbols to load\n" +msgstr "Kan ikke bestemme hvor mange symboler som skal læses ind\n" + +#: readelf.c:4409 +msgid "Unable to seek to end of file\n" +msgstr "Kan ikke søge til slutningen af filen\n" + +#: readelf.c:4415 +msgid "Unable to determine the length of the dynamic string table\n" +msgstr "Kan ikke bestemme længden på den dynamiske strengtabel\n" + +#: readelf.c:4420 +msgid "dynamic string table" +msgstr "dynamisk strengtabel" + +#: readelf.c:4454 +msgid "symbol information" +msgstr "symbolinformation" + +#: readelf.c:4478 +#, c-format +msgid "" +"\n" +"Dynamic segment at offset 0x%x contains %ld entries:\n" +msgstr "" +"\n" +"Dynamisk segment på offset 0x%x indeholder %ld poster:\n" + +#: readelf.c:4481 +msgid " Tag Type Name/Value\n" +msgstr " Mærke Type Navn/Værdi\n" + +#: readelf.c:4517 +msgid "Auxiliary library" +msgstr "Eksternt bibliotek" + +#: readelf.c:4521 +msgid "Filter library" +msgstr "Filterbibliotek" + +#: readelf.c:4525 +msgid "Configuration file" +msgstr "Konfigurationsfil" + +#: readelf.c:4529 +msgid "Dependency audit library" +msgstr "Afhængighedskontrolsbibliotek" + +#: readelf.c:4533 +msgid "Audit library" +msgstr "Kontrolsbibliotek" + +#: readelf.c:4551 readelf.c:4577 readelf.c:4603 +msgid "Flags:" +msgstr "Flag:" + +#: readelf.c:4553 readelf.c:4579 readelf.c:4605 +msgid " None\n" +msgstr " Ingen\n" + +#: readelf.c:4724 +#, c-format +msgid "Shared library: [%s]" +msgstr "Delt bibliotek: [%s]" + +#: readelf.c:4727 +msgid " program interpreter" +msgstr " Programfortolker" + +#: readelf.c:4731 +#, c-format +msgid "Library soname: [%s]" +msgstr "Bibliotekets so-navn: [%s]" + +#: readelf.c:4735 +#, c-format +msgid "Library rpath: [%s]" +msgstr "Bibliotekets rpath: [%s]" + +#: readelf.c:4739 +#, c-format +msgid "Library runpath: [%s]" +msgstr "Bibliotekets runpath: [%s]" + +#: readelf.c:4802 +#, c-format +msgid "Not needed object: [%s]\n" +msgstr "Unødvendigt objekt: [%s]\n" + +#: readelf.c:4913 +#, c-format +msgid "" +"\n" +"Version definition section '%s' contains %ld entries:\n" +msgstr "" +"\n" +"Versiondefinitionssektion \"%s\" indeholder %ld poster:\n" + +#: readelf.c:4916 +msgid " Addr: 0x" +msgstr " Adr: 0x" + +#: readelf.c:4918 readelf.c:5113 +#, c-format +msgid " Offset: %#08lx Link: %lx (%s)\n" +msgstr " Offset: %#08lx Lænk: %lx (%s)\n" + +#: readelf.c:4925 +msgid "version definition section" +msgstr "versiondefinitionssektion" + +#: readelf.c:4951 +#, c-format +msgid " %#06x: Rev: %d Flags: %s" +msgstr " %#06x: Rev: %d Flag: %s" + +#: readelf.c:4954 +#, c-format +msgid " Index: %d Cnt: %d " +msgstr " Index: %d Ant: %d " + +#: readelf.c:4965 +#, c-format +msgid "Name: %s\n" +msgstr "Navn: %s\n" + +#: readelf.c:4967 +#, c-format +msgid "Name index: %ld\n" +msgstr "Navnindex: %ld\n" + +#: readelf.c:4982 +#, c-format +msgid " %#06x: Parent %d: %s\n" +msgstr " %#06x: Forældrer %d: %s\n" + +#: readelf.c:4985 +#, c-format +msgid " %#06x: Parent %d, name index: %ld\n" +msgstr " %#06x: Forældrer %d, navneindex: %ld\n" + +#: readelf.c:5004 +#, c-format +msgid "" +"\n" +"Version needs section '%s' contains %ld entries:\n" +msgstr "" +"\n" +"Versionbehovssektion \"%s\" indeholder %ld poster:\n" + +#: readelf.c:5007 +msgid " Addr: 0x" +msgstr " Adr: 0x" + +#: readelf.c:5009 +#, c-format +msgid " Offset: %#08lx Link to section: %ld (%s)\n" +msgstr " Offset: %#08lx Lænk til sektion: %ld (%s)\n" + +#: readelf.c:5015 +msgid "version need section" +msgstr "versionsbehovssektion" + +#: readelf.c:5037 +#, c-format +msgid " %#06x: Version: %d" +msgstr " %#06x: Version: %d" + +#: readelf.c:5040 +#, c-format +msgid " File: %s" +msgstr " Fil: %s" + +#: readelf.c:5042 +#, c-format +msgid " File: %lx" +msgstr " Fil: %lx" + +#: readelf.c:5044 +#, c-format +msgid " Cnt: %d\n" +msgstr " Ant: %d\n" + +#: readelf.c:5062 +#, c-format +msgid " %#06x: Name: %s" +msgstr " %#06x: Navn: %s" + +#: readelf.c:5065 +#, c-format +msgid " %#06x: Name index: %lx" +msgstr " %#06x: Navneindex: %lx" + +#: readelf.c:5068 +#, c-format +msgid " Flags: %s Version: %d\n" +msgstr " Flag: %s Version: %d\n" + +#: readelf.c:5104 +msgid "version string table" +msgstr "versionsstrengtabel" + +#: readelf.c:5108 +#, c-format +msgid "" +"\n" +"Version symbols section '%s' contains %d entries:\n" +msgstr "" +"\n" +"Versionsymbolssektion \"%s\" indeholder %d poster:\n" + +#: readelf.c:5111 +msgid " Addr: " +msgstr " Adr: " + +#: readelf.c:5121 +msgid "version symbol data" +msgstr "versionsymbolsdata" + +#: readelf.c:5148 +msgid " 0 (*local*) " +msgstr " 0 (*lokal*) " + +#: readelf.c:5152 +msgid " 1 (*global*) " +msgstr " 1 (*global*) " + +#: readelf.c:5187 readelf.c:5622 +msgid "version need" +msgstr "versionsbehov" + +#: readelf.c:5197 +msgid "version need aux (2)" +msgstr "ydre versionsbehov (2)" + +#: readelf.c:5238 readelf.c:5684 +msgid "version def" +msgstr "versionsdef." + +#: readelf.c:5257 readelf.c:5699 +msgid "version def aux" +msgstr "ydre versionsdef." + +#: readelf.c:5288 +msgid "" +"\n" +"No version information found in this file.\n" +msgstr "" +"\n" +"Der fandtes ingen versionsinformation i denne fil.\n" + +#: readelf.c:5420 +msgid "Unable to read in dynamic data\n" +msgstr "Kan ikke indlæse de dynamiske data\n" + +#: readelf.c:5462 +msgid "Unable to seek to start of dynamic information" +msgstr "Kan ikke søge til begyndelsen af den dynamiske information" + +#: readelf.c:5468 +msgid "Failed to read in number of buckets\n" +msgstr "Mislykkedes at indlæse antal spande\n" + +#: readelf.c:5474 +msgid "Failed to read in number of chains\n" +msgstr "Mislykkedes at indlæse antalet kæder\n" + +#: readelf.c:5494 +msgid "" +"\n" +"Symbol table for image:\n" +msgstr "" +"\n" +"Symboltabel for filbilleder:\n" + +#: readelf.c:5496 +msgid " Num Buc: Value Size Type Bind Vis Ndx Name\n" +msgstr " Nr Spa: Værdi Strl Type Bind Synl Idx Navn\n" + +#: readelf.c:5498 +msgid " Num Buc: Value Size Type Bind Vis Ndx Name\n" +msgstr " Nr Spa: Værdi Strl Type Bind Synl Idx Navn\n" + +#: readelf.c:5543 +#, c-format +msgid "" +"\n" +"Symbol table '%s' contains %lu entries:\n" +msgstr "" +"\n" +"Symboltabel \"%s\" indeholder %lu poster:\n" + +#: readelf.c:5547 +msgid " Num: Value Size Type Bind Vis Ndx Name\n" +msgstr " Nr: Værdi Strl Type Bind Synl Idx Navn\n" + +#: readelf.c:5549 +msgid " Num: Value Size Type Bind Vis Ndx Name\n" +msgstr " Nr: Værdi Strl Type Bind Synl Idx Navn\n" + +#: readelf.c:5595 +msgid "version data" +msgstr "versionsdata" + +#: readelf.c:5635 +msgid "version need aux (3)" +msgstr "ydre versionsbehov (3)" + +#: readelf.c:5660 +msgid "bad dynamic symbol" +msgstr "fejlagtigt dynamisk symbol" + +#: readelf.c:5722 +msgid "" +"\n" +"Dynamic symbol information is not available for displaying symbols.\n" +msgstr "" +"\n" +"Informationen om dynamiske symboler er ikke tilgænglig til at vise symboler.\n" + +#: readelf.c:5734 +#, c-format +msgid "" +"\n" +"Histogram for bucket list length (total of %d buckets):\n" +msgstr "" +"\n" +"Histogram over spandenes listelængde (totalt %d spande):\n" + +#: readelf.c:5736 +#, c-format +msgid " Length Number %% of total Coverage\n" +msgstr " Længde Nummer %% af alle Dækning\n" + +#: readelf.c:5741 readelf.c:5760 readelf.c:9146 readelf.c:9338 +msgid "Out of memory" +msgstr "Slut på hukommelse" + +#: readelf.c:5809 +#, c-format +msgid "" +"\n" +"Dynamic info segment at offset 0x%lx contains %d entries:\n" +msgstr "" +"\n" +"Dynamisk info-segment på offset 0x%lx indeholder %d poster:\n" + +#: readelf.c:5812 +msgid " Num: Name BoundTo Flags\n" +msgstr " Nr: Navn Bind til Flag\n" + +#: readelf.c:5864 +#, c-format +msgid "" +"\n" +"Assembly dump of section %s\n" +msgstr "" +"\n" +"Disassembleringsudskrift af sektion %s\n" + +#: readelf.c:5887 +#, c-format +msgid "" +"\n" +"Section '%s' has no data to dump.\n" +msgstr "" +"\n" +"Sektion \"%s\" har ingen data at skrive ud.\n" + +#: readelf.c:5892 +#, c-format +msgid "" +"\n" +"Hex dump of section '%s':\n" +msgstr "" +"\n" +"Hex.udskrift af sektion \"%s\":\n" + +#: readelf.c:5897 +msgid "section data" +msgstr "sektionsdata" + +#: readelf.c:6046 +msgid "badly formed extended line op encountered!\n" +msgstr "fejlagtigt udformet udvidet linje-op mødtes!\n" + +#: readelf.c:6053 +#, c-format +msgid " Extended opcode %d: " +msgstr " Udvidet op-kode %d: " + +#: readelf.c:6058 +msgid "" +"End of Sequence\n" +"\n" +msgstr "" +"Slut på sekvensen\n" +"\n" + +#: readelf.c:6064 +#, c-format +msgid "set Address to 0x%lx\n" +msgstr "sæt Adresse til 0x%lx\n" + +#: readelf.c:6069 +msgid " define new File Table entry\n" +msgstr " definer ny filtabelspost\n" + +#: readelf.c:6070 readelf.c:6199 +msgid " Entry\tDir\tTime\tSize\tName\n" +msgstr " Post\tKatalog\tTid\tStrl.\tNavn\n" + +#: readelf.c:6072 +#, c-format +msgid " %d\t" +msgstr " %d\t" + +#: readelf.c:6075 readelf.c:6077 readelf.c:6079 readelf.c:6211 readelf.c:6213 +#: readelf.c:6215 +#, c-format +msgid "%lu\t" +msgstr "%lu\t" + +#: readelf.c:6080 +#, c-format +msgid "" +"%s\n" +"\n" +msgstr "" +"%s\n" +"\n" + +#: readelf.c:6084 +#, c-format +msgid "UNKNOWN: length %d\n" +msgstr "UKENDT: længde %d\n" + +#: readelf.c:6110 +#, c-format +msgid "" +"\n" +"Dump of debug contents of section %s:\n" +"\n" +msgstr "" +"\n" +"Udskrift af fejlsøgningsindhold i sektion %s:\n" +"\n" + +#: readelf.c:6122 +msgid "64-bit DWARF line info is not supported yet.\n" +msgstr "64-bit DWARF-linjeinformation understøttes ikke endnu.\n" + +#: readelf.c:6129 +msgid "The line info appears to be corrupt - the section is too small\n" +msgstr "Linjeinformationen virker være i stykker - sektionen er for lille\n" + +#: readelf.c:6137 +msgid "Only DWARF version 2 line info is currently supported.\n" +msgstr "Kun DWARF version 2's linjeinfo understøttes i øjeblikket.\n" + +#: readelf.c:6152 +#, c-format +msgid " Length: %ld\n" +msgstr " længde: %ld\n" + +#: readelf.c:6153 +#, c-format +msgid " DWARF Version: %d\n" +msgstr " DWARF version: %d\n" + +#: readelf.c:6154 +#, c-format +msgid " Prologue Length: %d\n" +msgstr " prologlængde: %d\n" + +#: readelf.c:6155 +#, c-format +msgid " Minimum Instruction Length: %d\n" +msgstr " min.-instruktionslængde: %d\n" + +# BUGG: Ska det ikke være `' på engelska? +#: readelf.c:6156 +#, c-format +msgid " Initial value of 'is_stmt': %d\n" +msgstr " initialværdi på \"is_stmt\": %d\n" + +#: readelf.c:6157 +#, c-format +msgid " Line Base: %d\n" +msgstr " linjebase: %d\n" + +#: readelf.c:6158 +#, c-format +msgid " Line Range: %d\n" +msgstr " linjeområde: %d\n" + +#: readelf.c:6159 +#, c-format +msgid " Opcode Base: %d\n" +msgstr " op-kodebase: %d\n" + +#: readelf.c:6168 +msgid "" +"\n" +" Opcodes:\n" +msgstr "" +"\n" +" Op-koder:\n" + +#: readelf.c:6171 +#, c-format +msgid " Opcode %d has %d args\n" +msgstr " Op-kode %d har %d argumenter\n" + +#: readelf.c:6177 +msgid "" +"\n" +" The Directory Table is empty.\n" +msgstr "" +"\n" +" Katalogtabellen er tom.\n" + +#: readelf.c:6180 +msgid "" +"\n" +" The Directory Table:\n" +msgstr "" +"\n" +" Katalogtabellen:\n" + +#: readelf.c:6184 +#, c-format +msgid " %s\n" +msgstr " %s\n" + +#: readelf.c:6195 +msgid "" +"\n" +" The File Name Table is empty.\n" +msgstr "" +"\n" +" Filnavnstabellen er tom.\n" + +#: readelf.c:6198 +msgid "" +"\n" +" The File Name Table:\n" +msgstr "" +"\n" +" Filnavnstabellen:\n" + +#: readelf.c:6206 +#, c-format +msgid " %d\t" +msgstr " %d\t" + +#: readelf.c:6217 +#, c-format +msgid "%s\n" +msgstr "%s\n" + +#. Now display the statements. +#: readelf.c:6225 +msgid "" +"\n" +" Line Number Statements:\n" +msgstr "" +"\n" +" Linjenummersætninger:\n" + +#: readelf.c:6241 +#, c-format +msgid " Special opcode %d: advance Address by %d to 0x%lx" +msgstr " Særlig op-kode %d: øg adressen med %d til 0x%lx" + +#: readelf.c:6245 +#, c-format +msgid " and Line by %d to %d\n" +msgstr " og linjenumret med %d til %d\n" + +#: readelf.c:6256 +msgid " Copy\n" +msgstr " Kopiér\n" + +#: readelf.c:6263 +#, c-format +msgid " Advance PC by %d to %lx\n" +msgstr " Øg PC med %d til %lx\n" + +#: readelf.c:6271 +#, c-format +msgid " Advance Line by %d to %d\n" +msgstr " Øg linjenumret med %d til %d\n" + +#: readelf.c:6278 +#, c-format +msgid " Set File Name to entry %d in the File Name Table\n" +msgstr " Sæt filnavnet til post %d i filnavnstabellen\n" + +#: readelf.c:6286 +#, c-format +msgid " Set column to %d\n" +msgstr " Sæt kolonnen til %d\n" + +#: readelf.c:6293 +#, c-format +msgid " Set is_stmt to %d\n" +msgstr " Sæt is_stmt til %d\n" + +#: readelf.c:6298 +msgid " Set basic block\n" +msgstr " Sæt baseblokken\n" + +#: readelf.c:6306 +#, c-format +msgid " Advance PC by constant %d to 0x%lx\n" +msgstr " Øg PC med konstant %d til 0x%lx\n" + +#: readelf.c:6314 +#, c-format +msgid " Advance PC by fixed size amount %d to 0x%lx\n" +msgstr " Øg PC med fastlængdeantal %d til 0x%lx\n" + +#: readelf.c:6319 +msgid " Set prologue_end to true\n" +msgstr " Sæt prologue_end til sand\n" + +#: readelf.c:6323 +msgid " Set epilogue_begin to true\n" +msgstr " Sæt epilogue_begin til sand\n" + +#: readelf.c:6329 +#, c-format +msgid " Set ISA to %d\n" +msgstr " Sæt ISA til %d\n" + +#: readelf.c:6333 +#, c-format +msgid " Unknown opcode %d with operands: " +msgstr " Ukendt op-kode %d med operand: " + +#: readelf.c:6365 readelf.c:6827 readelf.c:6899 +#, c-format +msgid "" +"Contents of the %s section:\n" +"\n" +msgstr "" +"%s-sektionens indhold:\n" +"\n" + +#: readelf.c:6384 +msgid "64-bit DWARF pubnames are not supported yet.\n" +msgstr "64-bit DWARF-offentlige navne understøttes ikke endnu.\n" + +#: readelf.c:6394 +msgid "Only DWARF 2 pubnames are currently supported\n" +msgstr "Kun DWARF 2 pub.-navn understøttes i øjeblikket\n" + +#: readelf.c:6401 +#, c-format +msgid " Length: %ld\n" +msgstr " længde: %ld\n" + +#: readelf.c:6403 +#, c-format +msgid " Version: %d\n" +msgstr " version: %d\n" + +#: readelf.c:6405 +#, c-format +msgid " Offset into .debug_info section: %ld\n" +msgstr " offset i .debug_info-sektionen: %ld\n" + +#: readelf.c:6407 +#, c-format +msgid " Size of area in .debug_info section: %ld\n" +msgstr " strl. på omr. i .debug_info-sekt.: %ld\n" + +#: readelf.c:6410 +msgid "" +"\n" +" Offset\tName\n" +msgstr "" +"\n" +" Offset\tNavn\n" + +#: readelf.c:6501 +#, c-format +msgid "Unknown TAG value: %lx" +msgstr "Ukendt TAG-værdi: %lx" + +#: readelf.c:6612 +#, c-format +msgid "Unknown AT value: %lx" +msgstr "Ukendt AT-værdi: %lx" + +#: readelf.c:6649 +#, c-format +msgid "Unknown FORM value: %lx" +msgstr "Ukendt FORM-værdi: %lx" + +#: readelf.c:6848 +#, c-format +msgid " DW_MACINFO_start_file - lineno: %d filenum: %d\n" +msgstr " DW_MACINFO_start_file - linje: %d filnr: %d\n" + +#: readelf.c:6853 +msgid " DW_MACINFO_end_file\n" +msgstr " DW_MACINFO_end_file\n" + +#: readelf.c:6861 +#, c-format +msgid " DW_MACINFO_define - lineno : %d macro : %s\n" +msgstr " DW_MACINFO_define - linje : %d makro : %s\n" + +#: readelf.c:6869 +#, c-format +msgid " DW_MACINFO_undef - lineno : %d macro : %s\n" +msgstr " DW_MACINFO_undef - linje : %d makro : %s\n" + +#: readelf.c:6880 +#, c-format +msgid " DW_MACINFO_vendor_ext - constant : %d string : %s\n" +msgstr " DW_MACINFO_vendor_ext - konstant : %d streng : %s\n" + +#: readelf.c:6908 +msgid " Number TAG\n" +msgstr " Nummer TAG\n" + +#: readelf.c:6914 +#, c-format +msgid " %ld %s [%s]\n" +msgstr " %ld %s [%s]\n" + +#: readelf.c:6917 +msgid "has children" +msgstr "har børn" + +#: readelf.c:6917 +msgid "no children" +msgstr "ingen børn" + +#: readelf.c:6921 +#, c-format +msgid " %-18s %s\n" +msgstr " %-18s %s\n" + +#: readelf.c:6942 +#, c-format +msgid " %lu byte block: " +msgstr " %lu byte-blok: " + +#: readelf.c:7265 +msgid "(User defined location op)" +msgstr "(brugerdefineret plads-op)" + +#: readelf.c:7267 +msgid "(Unknown location op)" +msgstr "(ukendt plads-op)" + +#: readelf.c:7305 +#, fuzzy +msgid "debug_loc section data" +msgstr "fejlsøgningssektionsdata" + +#: readelf.c:7336 +#, fuzzy +msgid "" +"\n" +"The .debug_loc section is empty.\n" +msgstr "" +"\n" +".debug_str-sektionen er tom.\n" + +#: readelf.c:7339 +#, fuzzy +msgid "" +"Contents of the .debug_loc section:\n" +"\n" +msgstr "" +"Indhold i .debug_str-sektionen:\n" +"\n" + +#: readelf.c:7340 +msgid "" +"\n" +" Offset Begin End Expression\n" +msgstr "" + +#: readelf.c:7412 +msgid "debug_str section data" +msgstr "debug_str sektionsdata" + +#: readelf.c:7431 +msgid "" +msgstr "" + +#: readelf.c:7434 +msgid "" +msgstr "" + +#: readelf.c:7454 +msgid "" +"\n" +"The .debug_str section is empty.\n" +msgstr "" +"\n" +".debug_str-sektionen er tom.\n" + +#: readelf.c:7458 +msgid "" +"Contents of the .debug_str section:\n" +"\n" +msgstr "" +"Indhold i .debug_str-sektionen:\n" +"\n" + +#: readelf.c:7629 +#, c-format +msgid " (indirect string, offset: 0x%lx): " +msgstr " (indirekte streng, offset: 0x%lx): " + +#: readelf.c:7638 +#, fuzzy, c-format +msgid "Unrecognized form: %d\n" +msgstr "Ukendt formular: %d\n" + +#: readelf.c:7651 +msgid "(not inlined)" +msgstr "(ikke inlined)" + +#: readelf.c:7652 +msgid "(inlined)" +msgstr "(inlined)" + +#: readelf.c:7653 +msgid "(declared as inline but ignored)" +msgstr "(deklareret som inline men ignoreret)" + +#: readelf.c:7654 +msgid "(declared as inline and inlined)" +msgstr "(deklareret som inline og inlined)" + +#: readelf.c:7655 +#, c-format +msgid " (Unknown inline attribute value: %lx)" +msgstr " (ukendt inlineattributværdi: %lx)" + +#: readelf.c:7826 readelf.c:8029 +#, c-format +msgid "" +"The section %s contains:\n" +"\n" +msgstr "" +"Sektion %s indeholder:\n" +"\n" + +#: readelf.c:7850 +msgid "64-bit DWARF debug info is not supported yet.\n" +msgstr "64-bit DWARF-fejlsøgningsinfo understøttes ikke endnu.\n" + +#: readelf.c:7919 +#, c-format +msgid " Compilation Unit @ %lx:\n" +msgstr " Kompileringsenhed @ %lx:\n" + +#: readelf.c:7920 +#, c-format +msgid " Length: %ld\n" +msgstr " længd: %ld\n" + +#: readelf.c:7921 +#, c-format +msgid " Version: %d\n" +msgstr " version: %d\n" + +#: readelf.c:7922 +#, c-format +msgid " Abbrev Offset: %ld\n" +msgstr " fork.-offset: %ld\n" + +#: readelf.c:7923 +#, c-format +msgid " Pointer Size: %d\n" +msgstr " pekarstørrelse: %d\n" + +#: readelf.c:7927 +msgid "Only version 2 DWARF debug information is currently supported.\n" +msgstr "Kun version 2 af DWARF fejlsøgningsinformation understøttes i øjeblikket.\n" + +#: readelf.c:7948 +msgid "Unable to locate .debug_abbrev section!\n" +msgstr "Kan ikke finde nogen .debug_abbrev-sektion!\n" + +#: readelf.c:7954 +msgid "debug_abbrev section data" +msgstr "debug_abbrev sektionsdata" + +#: readelf.c:7991 +#, c-format +msgid "Unable to locate entry %lu in the abbreviation table\n" +msgstr "Kan ikke finde post %lu i forkortelsestabellen\n" + +#: readelf.c:7996 +#, c-format +msgid " <%d><%lx>: Abbrev Number: %lu (%s)\n" +msgstr " <%d><%lx>: Fork.-nummer: %lu (%s)\n" + +#: readelf.c:8050 +msgid "64-bit DWARF aranges are not supported yet.\n" +msgstr "64-bit DWARF-a-interval understøttes ikke endnu.\n" + +#: readelf.c:8056 +msgid "Only DWARF 2 aranges are currently supported.\n" +msgstr "Kun DWARF2's a-interval understøttes i øjeblikket.\n" + +#: readelf.c:8060 +#, c-format +msgid " Length: %ld\n" +msgstr " længde: %ld\n" + +#: readelf.c:8061 +#, c-format +msgid " Version: %d\n" +msgstr " version: %d\n" + +#: readelf.c:8062 +#, c-format +msgid " Offset into .debug_info: %lx\n" +msgstr " offset i .debug_info: %lx\n" + +#: readelf.c:8063 +#, c-format +msgid " Pointer Size: %d\n" +msgstr " pegerstørrelse: %d\n" + +#: readelf.c:8064 +#, c-format +msgid " Segment Size: %d\n" +msgstr " segmentstørrelse: %d\n" + +#: readelf.c:8066 +msgid "" +"\n" +" Address Length\n" +msgstr "" +"\n" +" adresselængde\n" + +#: readelf.c:8248 +#, c-format +msgid "The section %s contains:\n" +msgstr "Sektion %s indeholder:\n" + +#: readelf.c:8271 +msgid "64-bit DWARF format frames are not supported yet.\n" +msgstr "64-bit DWARF-formatskabeloner understøttes ikke endnu.\n" + +#: readelf.c:8820 +#, c-format +msgid "Displaying the debug contents of section %s is not yet supported.\n" +msgstr "Visning af fejlsøgningsindeholdet i sektion %s understøttes ikke endnu.\n" + +#: readelf.c:8886 +#, c-format +msgid "" +"\n" +"Section '%s' has no debugging data.\n" +msgstr "" +"\n" +"Sektion \"%s\" indeholder ingen fejlsøgningsdata.\n" + +#: readelf.c:8891 readelf.c:8953 +msgid "debug section data" +msgstr "fejlsøgningssektionsdata" + +#: readelf.c:8907 +#, c-format +msgid "Unrecognized debug section: %s\n" +msgstr "Ukendt fejlsøgningssektion: %s\n" + +#: readelf.c:8981 +msgid "Some sections were not dumped because they do not exist!\n" +msgstr "Nogen sektioner blev ikke skrevet ud da de ikke eksisterer!\n" + +#: readelf.c:9054 readelf.c:9418 +msgid "liblist" +msgstr "biblioteksliste" + +#: readelf.c:9139 +msgid "options" +msgstr "flag" + +#: readelf.c:9170 +#, c-format +msgid "" +"\n" +"Section '%s' contains %d entries:\n" +msgstr "" +"\n" +"Sektion \"%s\" indeholder %d poster:\n" + +# BUGG: Fejl i originalet? +#: readelf.c:9331 +#, fuzzy +msgid "conflict list found without a dynamic symbol table" +msgstr "konfliktliste uden tabell" + +#: readelf.c:9349 readelf.c:9365 +msgid "conflict" +msgstr "konflikt" + +#: readelf.c:9375 +#, c-format +msgid "" +"\n" +"Section '.conflict' contains %ld entries:\n" +msgstr "" +"\n" +"Sektion \".conflict\" indeholder %ld poster:\n" + +#: readelf.c:9377 +msgid " Num: Index Value Name" +msgstr " Num: Index Værdi Navn" + +#: readelf.c:9426 +#, fuzzy +msgid "liblist string table" +msgstr "strengtabel" + +#: readelf.c:9435 +#, fuzzy, c-format +msgid "" +"\n" +"Library list section '%s' contains %lu entries:\n" +msgstr "" +"\n" +"Versionbehovssektion \"%s\" indeholder %ld poster:\n" + +#: readelf.c:9484 +msgid "NT_PRSTATUS (prstatus structure)" +msgstr "NT_PRSTATUS (prstatus-struktur)" + +#: readelf.c:9485 +msgid "NT_FPREGSET (floating point registers)" +msgstr "NT_FPREGSET (flydendetalsregister)" + +#: readelf.c:9486 +msgid "NT_PRPSINFO (prpsinfo structure)" +msgstr "NT_PRPSINFO (prpsinfo-struktur)" + +#: readelf.c:9487 +msgid "NT_TASKSTRUCT (task structure)" +msgstr "NT_TASKSTRUCT (task-struktur)" + +#: readelf.c:9488 +msgid "NT_PRXFPREG (user_xfpregs structure)" +msgstr "NT_PRXFPREG (user_xfpregs-struktur)" + +#: readelf.c:9489 +msgid "NT_PSTATUS (pstatus structure)" +msgstr "NT_PSTATUS (pstatus-struktur)" + +#: readelf.c:9490 +msgid "NT_FPREGS (floating point registers)" +msgstr "NT_FPREGS (flydendetalsregister)" + +#: readelf.c:9491 +msgid "NT_PSINFO (psinfo structure)" +msgstr "NT_PSINFO (psinfo-struktur)" + +#: readelf.c:9492 +msgid "NT_LWPSTATUS (lwpstatus_t structure)" +msgstr "NT_LWPSTATUS (lwpstatus_t-struktur)" + +#: readelf.c:9493 +msgid "NT_LWPSINFO (lwpsinfo_t structure)" +msgstr "NT_LWPSINFO (lwpsinfo_t-struktur)" + +# BUGG: Stavfejl i originalet (str>uc Set the binary file format\n" +" -h --help Display this information\n" +" -v --version Display the program's version\n" +"\n" +msgstr "" + +#: size.c:160 +#, c-format +msgid "invalid argument to --format: %s" +msgstr "ugyldigt argument til --format: %s" + +#: size.c:187 +#, c-format +msgid "Invalid radix: %s\n" +msgstr "Ugyldig talbase: %s\n" + +#: srconv.c:1953 +#, fuzzy +msgid "Convert a COFF object file into a SYSROFF object file\n" +msgstr "%s: Konverterer en COFF-objektfil til en SYSROFF-objektfil\n" + +#: srconv.c:1954 +msgid "" +" The options are:\n" +" -q --quick (Obsolete - ignoerd)\n" +" -n --noprescan Do not perform a scan to convert commons into defs\n" +" -d --debug Display information about what is being done\n" +" -h --help Display this information\n" +" -v --version Print the program's version number\n" +msgstr "" + +#: srconv.c:2099 +#, c-format +msgid "unable to open output file %s" +msgstr "kan ikke åbne uddatafil %s" + +#: stabs.c:343 stabs.c:1759 +msgid "numeric overflow" +msgstr "numerisk overløb" + +# FIXME +#: stabs.c:354 +#, c-format +msgid "Bad stab: %s\n" +msgstr "Fejlagtig stab: %s\n" + +#: stabs.c:364 +#, c-format +msgid "Warning: %s: %s\n" +msgstr "Advarsel: %s: %s\n" + +#: stabs.c:485 +msgid "N_LBRAC not within function\n" +msgstr "N_LBRAC ikke inde i funktion\n" + +#: stabs.c:524 +msgid "Too many N_RBRACs\n" +msgstr "For mange N_RBRAC's\n" + +#: stabs.c:769 +msgid "unknown C++ encoded name" +msgstr "ukendt C++-kodet navn" + +#. Complain and keep going, so compilers can invent new +#. cross-reference types. +#: stabs.c:1296 +msgid "unrecognized cross reference type" +msgstr "ukendt krydsreferencetype" + +#. Does this actually ever happen? Is that why we are worrying +#. about dealing with it rather than just calling error_type? +#: stabs.c:1851 +msgid "missing index type" +msgstr "manglende indextype" + +#: stabs.c:2178 +msgid "unknown virtual character for baseclass" +msgstr "ukendt virtuelt tegn for baseklasse" + +# FIXME +#: stabs.c:2196 +msgid "unknown visibility character for baseclass" +msgstr "ukendt synlighedskarakter for baseklasse" + +#: stabs.c:2388 +msgid "unnamed $vb type" +msgstr "$vb-type uden navn" + +#: stabs.c:2394 +msgid "unrecognized C++ abbreviation" +msgstr "ukendt C++-forkortelse" + +# FIXME +#: stabs.c:2474 +msgid "unknown visibility character for field" +msgstr "ukendt synlighedskarakter for felt" + +#: stabs.c:2730 +msgid "const/volatile indicator missing" +msgstr "const/volatile-indikator mangler" + +#: stabs.c:2970 +#, c-format +msgid "No mangling for \"%s\"\n" +msgstr "Ingen kodning af \"%s\"\n" + +#: stabs.c:3283 +msgid "Undefined N_EXCL" +msgstr "Udefineret N_EXCL" + +#: stabs.c:3371 +#, c-format +msgid "Type file number %d out of range\n" +msgstr "Typens filnummer %d udenfor sit interval\n" + +#: stabs.c:3376 +#, c-format +msgid "Type index number %d out of range\n" +msgstr "Typens indexnummer %d udenfor sit interval\n" + +#: stabs.c:3463 +#, c-format +msgid "Unrecognized XCOFF type %d\n" +msgstr "Ukendt XCOFF-type %d\n" + +#: stabs.c:3762 +#, c-format +msgid "bad mangled name `%s'\n" +msgstr "fejlagtigt kodet navn \"%s\"\n" + +#: stabs.c:3858 +msgid "no argument types in mangled string\n" +msgstr "ingen argumenttype i kodet streng\n" + +#: strings.c:200 +#, c-format +msgid "invalid number %s" +msgstr "ugyldigt tal %s" + +#: strings.c:640 +#, c-format +msgid "invalid integer argument %s" +msgstr "ugyldigt heltalsargument %s" + +#: strings.c:651 +msgid " Display printable strings in [file(s)] (stdin by default)\n" +msgstr "" + +#: strings.c:652 +msgid "" +" The options are:\n" +" -a - --all Scan the entire file, not just the data section\n" +" -f --print-file-name Print the name of the file before each string\n" +" -n --bytes=[number] Locate & print any NUL-terminated sequence of at\n" +" - least [number] characters (default 4).\n" +" -t --radix={o,x,d} Print the location of the string in base 8, 10 or 16\n" +" -o An alias for --radix=o\n" +" -T --target= Specify the binary file format\n" +" -e --encoding={s,b,l,B,L} Select character size and endianness:\n" +" s = 8-bit, {b,l} = 16-bit, {B,L} = 32-bit\n" +" -h --help Display this information\n" +" -v --version Print the program's version number\n" +msgstr "" + +#: sysdump.c:768 +#, fuzzy +msgid "Print a human readable interpretation of a SYSROFF object file\n" +msgstr "%s: Skriv en menneskeligt læsbar tolkning af en SYSROFF-objektfil\n" + +#: sysdump.c:769 +msgid "" +" The options are:\n" +" -h --help Display this information\n" +" -v --version Print the program's version number\n" +msgstr "" + +#: sysdump.c:836 +#, c-format +msgid "cannot open input file %s" +msgstr "kan ikke åbne inddatafil %s" + +#: version.c:35 +#, fuzzy +msgid "Copyright 2002 Free Software Foundation, Inc.\n" +msgstr "Copyright 2001 Free Software Foundation, Inc.\n" + +#: version.c:36 +msgid "" +"This program is free software; you may redistribute it under the terms of\n" +"the GNU General Public License. This program has absolutely no warranty.\n" +msgstr "" +"Dette program er frit programmel; du kan distribuere det videre under betingelserne\n" +"i GNU General Public License. Dette program har ingen som helst garantier.\n" + +#: windres.c:239 +#, c-format +msgid "can't open %s `%s': %s" +msgstr "kan ikke åbne %s \"%s\": %s" + +#: windres.c:418 +msgid ": expected to be a directory\n" +msgstr ": forventedes være et katalog\n" + +#: windres.c:430 +msgid ": expected to be a leaf\n" +msgstr ": forventedes være et blad\n" + +#: windres.c:439 +#, c-format +msgid "%s: warning: " +msgstr "%s: advarsel: " + +#: windres.c:441 +msgid ": duplicate value\n" +msgstr ": dublet af værdi\n" + +#: windres.c:602 +#, c-format +msgid "unknown format type `%s'" +msgstr "ukendt formattype \"%s\"" + +#: windres.c:603 +#, c-format +msgid "%s: supported formats:" +msgstr "%s: format som håndteres:" + +#. Otherwise, we give up. +#: windres.c:688 +#, c-format +msgid "can not determine type of file `%s'; use the -I option" +msgstr "kan ikke bestemme \"%s\"'s filtype; brug flag -I" + +#: windres.c:702 +#, fuzzy, c-format +msgid "Usage: %s [option(s)] [input-file] [output-file]\n" +msgstr "Brug: %s [flag] [in-fil] [ut-fil]\n" + +#: windres.c:704 +#, fuzzy +msgid "" +" The options are:\n" +" -i --input= Name input file\n" +" -o --output= Name output file\n" +" -I --input-format= Specify input format\n" +" -O --output-format= Specify output format\n" +" -F --target= Specify COFF target\n" +" --preprocessor= Program to use to preprocess rc file\n" +" --include-dir= Include directory when preprocessing rc file\n" +" -D --define [=] Define SYM when preprocessing rc file\n" +" -v --verbose Verbose - tells you what it's doing\n" +" --language= Set language when reading rc file\n" +" --use-temp-file Use a temporary file instead of popen to read\n" +" the preprocessor output\n" +" --no-use-temp-file Use popen (default)\n" +msgstr "" +"Flag:\n" +" -i FIL, --input FIL Navnge inddatafilen\n" +" -o FIL, --output FIL Navnge uddatafilen\n" +" -I FORMAT, --input-format FORMAT\n" +" Specificere inddataformatet\n" +" -O FORMAT, --output-format FORMAT\n" +" Specificere uddataformatet\n" +" -F MÅL, --target MÅL Specificere COFF-målet\n" +" --preprocessor PROGRAM Program at bruge som preprocessor på rc-filen\n" +" --include-dir KATALOG Inkludere katalog når rc-filen preprocessas\n" +" -DSYM[=VÆRDE], --define SYM[=VÆRDE]\n" +" Definere SYM når rc-filen preporocessas\n" +" -v Utforlig - beretter vad den gør\n" +" --language SPROG Sætt sproget når rc-filen læses\n" +" --use-temp-file Brug en tem.fil i stedet for popen ved læsning\n" +" af uddata fra preprocessorn\n" +" --no-use-temp-file Brug popen (forval)\n" + +#: windres.c:719 +msgid " --yydebug Turn on parser debugging\n" +msgstr " --yydebug Aktivér tolkens fejlsøgning\n" + +#: windres.c:722 +msgid "" +" -h --help Print this help message\n" +" -V --version Print version information\n" +msgstr "" +" -h --help Vis denne hjælpetekst\n" +" -V --version Vis versionsinformation\n" + +#: windres.c:725 +msgid "" +"FORMAT is one of rc, res, or coff, and is deduced from the file name\n" +"extension if not specified. A single file name is an input file.\n" +"No input-file is stdin, default rc. No output-file is stdout, default rc.\n" +msgstr "" +"FORMAT er én af rc, res eller coff, og afledes fra filnavnsendelsen\n" +"hvis det ikke specificeres. Et enketl filnavn er en inddatafil. Ingen\n" +"inddatafil betyder standard-ind, med format rc. Ingen uddatafil betyder\n" +"standard-ud, med format rc.\n" + +#: windres.c:988 +msgid "no resources" +msgstr "ingen resurser" + +#: wrstabs.c:366 wrstabs.c:2026 +#, c-format +msgid "string_hash_lookup failed: %s" +msgstr "string_hash_lookup mislykkedes: %s" + +#: wrstabs.c:666 +#, c-format +msgid "stab_int_type: bad size %u" +msgstr "stab_int_type: fejlagtig størrelse %u" + +#: wrstabs.c:1466 +#, c-format +msgid "%s: warning: unknown size for field `%s' in struct" +msgstr "%s: advarsel: ukendt størrelsen på felt \"%s\" i strukturen" diff -Nurpa binutils-2.13/binutils/po/sv.gmo binutils-2.13.1/binutils/po/sv.gmo --- binutils-2.13/binutils/po/sv.gmo 2002-08-06 09:31:37.000000000 -0400 +++ binutils-2.13.1/binutils/po/sv.gmo 2002-11-07 17:40:00.000000000 -0500 @@ -14,25 +14,24 @@ Ä Ä)Ä!8Ä"ZÄ} ¤Ó ¯Ó½ÓÐÓ/êÓ1Ô!LÔ'nÔ'–Ô/¾Ô2îÔ7!Õ+YÕ …Õ1¦Õ"ØÕ"ûÕ+Ö'JÖ&rÖ#™Ö)½Ö.çÖ×#-×Q×*qל׺×Ô×ã×÷× Ø !Ø/Ø@Ø ZØdØy؉؞خØÈØâØ&ýØ&$Ù KÙ!lَ١٧ٶپÙÒÙäÙ óÙÚ ÚÚ 1Ú>Ú XÚ)eÚÚ¤Ú·Ú(ÎÚ4÷Ú,Û-HÛvÛ Û±ÛÍÛÜÛîÛÜ ÜÜ 8ÜEÜ LÜ XÜ fÜtÜ}ÜÜÜ°ÜÅÜÜÜëÜ -Ý Ý/Ý$BÝ gÝsÝ‹ÝS¦Ý úÝÞ Þ8Þ OÞ+\ÞˆÞÞ“Þ²ÞÃÞËÞ-èÞ#ß :ßGß$Wß|ß ƒß ßß°ß Æß Òßßß ïßüß à$à;àQàgà}àà à²àÁàÆàáàðà#á!$á FáSáqá„ážá±áÐáïáââ â)+âUâsâˆââ·âÐâ'ïâ)ã.Aã&pã—ã·ãÕãçãþã)ä&Fämä.‡ä(¶ä.ßäå")åLå]åmå†åå'­åÕåêåæ!æ'1æ*Yæ&„æ«æ¼æÐæðæç%çCç%`ç†ç£ç!Ãçåç'è,è>èPè$lè‘è­è Âè Îè Ûè èèôèé4é Téaévé‹é éµéÉéÚéîéòé'ûé&#ê5Jê €ê'¡ê4Éê2þê 1ë6>ëuì‹ì"¥ì&Èì!ïìí#í€5í&¶ó*Ýóô ô#(ôLôgô{ô—ô"¬ôÏôæô õô(õ0,õ0]õ>Žõ9ÍõPöXö köuö8•ö2Îö1÷3÷G÷?`÷$ ÷,Å÷0ò÷,#øPø*eøø®ø3Íø8ù,:ù.gù'–ù8¾ù0÷ù(ú7Cú2{ú2®úáúDñúJ6û1û4³û;èûD$üRiü¼üBØüBý?^ýOžýCîý 2þV@þk—þÿ -ÿD"ÿ2gÿ9šÿ5Ôÿ2 -R=6<Ç-J2>}D¼>/@3p¤*»Dæ?+8k8¤2Ý2.C4r/§;×#?76wE®Uô?J8ŠKÃ=6MX„EÝG#Ak=­;ë3' B[ 9ž =Ø A -?X -G˜ -Kà -0, =] 9› Õ è û  @) 8j £ ¹ Ï ç %ù  9 W k q "w fš 8O:QŠ-ÜÙ -yäJ^".©"BØ"]#By#ɼ#m†(Kô-0@.2q.(¤..Í.Qü.MN/Rœ/Mï/@=0]~0 Ü0(ý0 &101P1$j1+1(»1 ä1î1 - -2"2(82a2%2§2 -¼2 Ç2 Ñ2-Û2 3%3;3 R3+s3#Ÿ3 Ã3"ä3"4(*4 S4"_4B‚4:Å4!5"5)15([5(„5+­5 Ù5.ú5!)6K6"h6‹6œ6'¯6"×6ú6"7?=7(}7¦7½71Ý78#868 O8p8ˆ8+§80Ó8090595f95œ9>Ò9[:Im:(·:à:*;++;+W;ƒ;£;3Á;Cõ;Q9<Y‹<>å<0$=*U=4€=Cµ=8ù=+2>+^><Š>=Ç>#?*)?T?*s?:ž?:Ù?I@+^@,Š@·@É@8Ý@#A#:A^AeAnA)…A¯A+ÅA(ñA3B*NByB7€B?¸BSøBLC\C({C'¤C ÌCÙC òC -ÿC" -D-D?DDDHDMD iDsD’D­DÅDâD$÷D$E$AE<fE@£E äEîEF(#FLF?hF2¨F ÛFéF'ÿF)'GQGlG8‡GÀGÝG:øG,3H#`H„H¢H#¹HÝH÷H -I(I?I!\I%~I¤I¼IÎI ìI. JnX%­X ÓXàX úXY1YEYaY~YÔYrZ%†Z¬ZÅZàZ(ùZ"[<[0Z[‹[ œ[©[Æ[!å[#\+\K\#k\\«\É\(ç\]N-]|] Œ]–]²]Ï]ä]û]*^?^4E^z^^¡^³^2É^.ü^7+_Gc_«_Ä_™á_ {c‰c/˜c>Ècdd/dMdgdd˜dµdËdâdùde'.e(VeFeHÆef $f0f*Ff!qf;“fÏf&áfg#g5g=Ug“g«g:Ägwÿg–whi #i1i)Ai+ki—i.¨i<×i8j'Mj,uj/¢jÒjîj( k4k%Qkwk!–k!¸k6Úkl+$lPldlzll­lÍlëlÿl'm/;m'km!“mÀµm©vn^ oñoüqp'nq–q³q$Ïq+ôq* rKrZr6kr<¢r#ßr)s-s8>s3wsJ«s7ös6.t,et ’t -Ÿt2ªtÝtôtu6uPuiu€u›u!®u.Ðu$ÿu$$v,Ivvv7–vÎv3ív!wAw-\wŠw%¥w#Ëwïwx),x.Vx…x6œxÓxïxy!y*yDydy!y £y­y)´yÞyõyþyz&z1@z<rz$¯z*Ôz*ÿz/*{6Z{<‘{3Î{"|:%|&`|2‡|.º|+é|(}&>},e}7’}Ê}6á}!~+:~#f~ Š~«~º~Î~â~ ù~ ;CSe{ŽªÆ,ã,€=€[€y€‹€“€¤€µ€Ñ€ð€  %/?H a&n•¬¿.×5‚%<‚,b‚‚#§‚Ë‚ ç‚ô‚ƒƒ(ƒ;ƒ Vƒ dƒ qƒ{ƒ‹ƒ -œƒ§ƒ¸ƒʃ݃òƒ „„4„J„[„!r„ ”„ž„·„UÌ„"…2…G…a… {…)‰…³… ¹…Å…ã…÷….ÿ…2.†%a† ‡†“†$¢†dž ؆ -â†í†‡ ‡ ‡,‡<‡N‡a‡|‡–‡°‡ȇä‡ù‡ˆ ˆ-ˆ"5ˆXˆlˆ%ˆ%§ˆ ͈#Úˆþˆ‰+‰!@‰b‰‚‰›‰­‰ ¶‰Éâ‰þ‰Š.ŠIŠcŠ(}Š/¦Š,ÖŠ"‹&‹A‹ Z‹f‹v‹,‹)½‹ç‹-þ‹',Œ2TŒ‡Œ%žŒ ÄŒ ÒŒߌôŒ %;Mg |#Š%®!Ôö ŽŽ-Ž=ŽSŽiŽ}Ž›Ž¹ŽÏŽåŽ&ÿŽ&7H$]‚˜°Æ Þ ëø 0% Vd|”ª¿Òèü‘- ‘,7‘5d‘#š‘-¾‘7ì‘C$’h’LÌpÁæÔkð#Mÿ²Â÷’ú]2¢r¹Dzzf4«„sl­ÿÉ'•RY~oim£;nV2Bó«¨výހݾáFEh1Ö/au¢[µ2a µµMCøoÌ0e샔»S¬.â˱BÅ’G5tJ~¨)¸É ÙUš(bùCTm¤Î +Ý Ý/Ý$BÝ gÝsÝ‹ÝS¦Ý úÝÞ Þ8Þ OÞ+\ÞˆÞÞ“Þ²ÞÃÞËÞ-èÞ#ß :ßGß$Wß|ß ƒß ßß°ß Æß Òßßß ïßüß à$à;àQàgà}àà à²àÁàÆàáàðà#á!$á FáSáqá„ážá±áÐáïáââ â)+âUâsâˆââ·âÐâ'ïâ)ã.Aã&pã—ã·ãÕãçãþã)ä&Fämä.‡ä(¶ä.ßäå")åLå]åmå†åå'­åÕåêåæ!æ'1æ*Yæ&„æ«æ¼æÐæðæç%çCç%`ç†ç£ç!Ãçåç'è,è>èPè$lè‘è­è Âè Îè Ûè èèôèé4é Téaévé‹é éµéÉéÚéîéòé'ûé&#ê5Jê €ê'¡ê4Éê2þê 1ë.>ëmìƒì"ì&Àì!çì ííy-í&§ó,Îóûó ô#ô@ô[ôoô‹ô" ôÃôÚô éô(÷ô0 õ0Qõ>‚õ9ÁõPûõLö _ö'iö8‘ö2Êö1ýö/÷C÷?\÷$œ÷,Á÷0î÷,øLø*aøŒøªø3Éø8ýø,6ù.cù'’ù8ºù0óù$ú7?ú2wú2ªúÝúDíúJ2û1}û4¯û;äûI üRjü½üBÙüBý?_ýBŸýCâý &þV4þk‹þ÷þþþDÿ4[ÿ9ÿ5Êÿ2R36†<½-úJ(@sD´>ù183jž*µAà?"8b8›2Ô2.:4i/ž;Î$ +?/8oE¨Uî?D8„K½= 7GYEÙG@g=¨;æ3" BV 9™ =Ó A +?S +G“ +KÛ +,' =T 9’ Ì ß ò  @ 8a š ° Æ Þ %ð  0 N b h "n f‘ 8ø O1Q-ÓÙyÛJU". "BÏ"]#Bp#ɳ#a}(Hß-0(.2Y.(Œ..µ.Qä.M6/R„/M×/@%0]f0 Ä0(å0 1181$R1+w1(£1 Ì1Ö1 +ò1"ý1( 2I2%i22 +¤2 ¯2 ¹2-Ã2ñ2 3#3 :3+[3#‡3 «3"Ì3"ï3(4 ;4"G4Bj4:­4!è4 +5)5(C5(l5+•5 Á5.â5!636"P6s6„6'—6"¿6â6"7?%7(e7Ž7¥71Å7÷7 88!78Y8q8+‘80½80î8094P95…9A»9[ý9IY:(£:Ì:*ì:+;+C;o;;3­;Cá;Q%<Yw<>Ñ<0=*A=4l=C¡=8å=+>+J><v>=³>ñ>+?=?*\?:‡?:Â?Iý?+G@,s@ @²@8Æ@#ÿ@)#AMATA]A'tAœA/²A&âA1 B*;BfB9mB?§BSçB;CKC(jC'“C »CÈC áC +îC"ùCD.D3D7D^X%X ÃXÐX êX Y!Y5YQYnYÓYaZ%uZ›Z´ZÏZ(èZ[+[-I[w[ ˆ[•[²[!Ñ[#ó[\7\#W\{\—\ µ\(Ö\ÿ\N]k] {]…]¡]¾]Ø]ï]*^3^49^n^„^•^§^2½^1ð^7"_GZ_¢_»_…Ø_ ^clc/{c>«cêcdd0dNdhddœd²dÉdàdød'e(=eJfeL±eþe f"f*8f!cf;…fÁf&×fþfg+g=Kg‰g¡g:ºgwõg–mhi i'i+7i-ci‘i.¢i<Ñi8j'Gj,oj/œjÌjèj(k!.kPkpk!k!±k6Ók +l+lIl]lslˆl¦lÆläløl' m/4m'dm ŒmÀ­m¯nn^oë}oüip%fqŒq¨q$Äq)éq*r>rMr6^r<•r&Òr)ùr#s84s3msJ¡s7ìs>$t4ct ˜t +¥t2°tãtút u4uTumu„uŸu!²u.Ôu$v$(v,Mvzv:šv!Õv8÷v0wPw-kw™w%´w#Úwþwx);x.ex”x6¬xãxÿxy1y:yTyty!‘y ³y½y)Äyîyzzz6z1Pz<‚z%¿z*åz*{/;{6k{<¢{3ß{"|:6|&q|2˜|.Ë|+ú|(&}'O},w}7¤}Ü}6ó}!*~+L~$x~ ~¾~Í~á~õ~  -NVfxŽ¡½Ù,ö,#€P€n€Œ€ž€¦€·€È€ä€ & 8BR[ t%§¾Ñ.é5‚%N‚1t‚¦‚#¾‚â‚ þ‚ ƒƒ/ƒ?ƒRƒ mƒ {ƒ ˆƒ’ƒ¢ƒ +³ƒ¾ƒσáƒôƒ „ „-„K„a„r„!‰„ «„µ„΄Wè„@…P…g…… —…)¥…Ï… Õ…á…ÿ…†.†2J†%}† £†¯†$¾†ã† ô† +þ† ‡‡ /‡ ;‡H‡X‡j‡}‡š‡´‡Ò‡ê‡ˆˆ0ˆ AˆOˆ"WˆzˆŽˆ%£ˆ%Ɉ ïˆ#üˆ ‰4‰M‰"b‰…‰¥‰¾‰Љ Ù‰ 扊#Š:ŠSŠnŠˆŠ(¢Š/ËŠ,ûŠ!(‹J‹e‹ ~‹Š‹š‹,´‹)á‹ Œ-"Œ'PŒ2xŒ«Œ%ÂŒ èŒ öŒ ,%9_q‹  #®#ÒöŽ (Ž5ŽMŽ]ŽsŽ‰ŽŽ»ŽÙŽïŽ&FWh$…ªÄÜò + $70Q ‚¨ÀÖëþ‘(‘,‘-5‘,c‘5‘%Æ‘-ì‘7’CR’–’LÌpÁæÔkð#Mÿ²Â÷’ú]2¢r¹Dzzf4«„sl­ÿÉ'•RY~oim£;nV2Bó«¨výހݾáFEh1Ö/au¢[µ2a µµMCøoÌ0e샔»S¬.â˱BÅ’G5tJ~¨)¸É ÙUš(bùCTm¤Î ÍÆ×;@NˆEñq4O1¤`äÐá R$mp&›p[©ïÕ!‰DôÀ…Ê«^b“ã0þ&d‹uÈç®8­7”¯¤‘X"A,yV8 ž:Qߣa7œZêŸè$Ð5#ìä¥Ëláy;\AÏ 'PåÔ·½˜¾MŒX‚Ï[kÛ¶´=Gj%|`nžÁsÝïçÔ·ØE<)s Q´ÙUH€6qÚ‡k›úzæ³â¹'ñ-{§÷ªÍ¯Q<û×ü”3Ñ¿0+Wé¿ÛÀ³9Y¹Žò† 몺Kê@ €ÅÎÖlÚí$j*_ô^‰ Ãüe}-„¢ QÕMÈ6nbø<¶=ßv1ãxH²5ýe%=f–ò ¬îªä‰Üiß^.!Z4‡ž9·ùD?Syt_¸ „ô>ü¾({¦9ÅIœŸ!‚ùéÃÌT•èš­òå)–. ‚™¼Ž*"HÄ“Š{@$qJÉ¿/6íÂõ½r_°;àˆ3GûpÞ+,%ìkoÑ.›Wt@ú]WxwYÂKV['SÒh+ÄŒÀ&»/P¬J™LŸoÖà¡}ó²Äqx+—ð=¡õ —AŽ3÷j0ŠXFw}g¥S±LE1j#“Ù¯Ç2,å9" ¶ÈÐCY°`†(†g¼yCþ\Š|ZsâgWïg~ÓdPx¡¦}Ác7?XÝ?Ú]ö5ʈRr\a:ÆÓ6iõØ^ðÊ m Aef»íûÜê‹ö™c–l{h FÏ‹Tº©ÇѱNO @@ -681,9 +680,9 @@ the GNU General Public License. This pr no childrenno entry %s in archive no entry %s in archive %s!no export definition file provided. Creating one, but that may not be what you wantno input fileno input file specifiedno name for output fileno operation specifiedno resourcesno type information for C++ method functionnonenotesnull terminated unicode stringnumeric overflowoptionsout of memory parsing relocsoverflow when adjusting relocation against %sparse_coff_type: Bad type code 0x%xprivate dataprogram headersreference parameter is not a pointerrelocsresource IDresource dataresource data sizeresource type unknownrpc sectionsection datasection headersset .bss vmaset .data sizeset .nlmsection contentsset .nlmsections flagsset .nlmsections sizeset Address to 0x%lx -set section alignmentset section flagsset section sizeset start addressshared sectionsizestab_int_type: bad size %ustack overflowstack underflowstat failed on bitmap file `%s': %sstat returns negative size for %sstring tablestring_hash_lookup failed: %sstringtable stringstringtable string lengthstub section sizessubprocess got fatal signal %dsupport not compiled in for %ssupported flags: %ssymbol informationsymbolssymtab shndxtwo different operation options specifiedunable to open output file %sundefined C++ objectundefined C++ vtableundefined variable in ATNundefined variable in TYunexpected dialog signature %dunexpected end of debugging informationunexpected fixed version info version %luunexpected fixed version information length %dunexpected fixed version signature %luunexpected group cursor type %dunexpected group icon type %dunexpected numberunexpected record typeunexpected string in C++ miscunexpected stringfileinfo value length %dunexpected varfileinfo value length %dunexpected version stringunexpected version string length %d != %d + %dunexpected version string length %d < %dunexpected version stringtable value length %dunexpected version type %dunexpected version value length %dunknown ATN typeunknown BB typeunknown C++ encoded nameunknown C++ visibilityunknown TY codeunknown alternate machine code, ignoredunknown builtin typeunknown demangling style `%s'unknown format type `%s'unknown sectionunknown virtual character for baseclassunknown visibility character for baseclassunknown visibility character for fieldunnamed $vb typeunrecognised: %-7lxunrecognized --endian type `%s'unrecognized -E optionunrecognized C++ abbreviationunrecognized C++ default typeunrecognized C++ misc recordunrecognized C++ object overhead specunrecognized C++ object specunrecognized C++ reference typeunrecognized cross reference typeunrecognized section flag `%s'unresolved PC relative reloc against %sunsupported ATN11unsupported ATN12unsupported C++ object typeunsupported IEEE expression operatorunsupported menu version %dunsupported qualiferunwind infounwind tableversion dataversion defversion def auxversion definition sectionversion length %d does not match resource length %luversion needversion need aux (2)version need aux (3)version need sectionversion string tableversion symbol dataversion var infoversion varfileinfovmawait: %swarning: CHECK procedure %s not definedwarning: EXIT procedure %s not definedwarning: MAP and FULLMAP are not supported; try ld -Mwarning: No version number givenwarning: START procedure %s not definedwarning: input and output formats are not compatiblewarning: symbol %s imported but not in import listwriting stubProject-Id-Version: binutils 2.12-pre020121 +set section alignmentset section flagsset section sizeset start addressshared sectionsizestab_int_type: bad size %ustack overflowstack underflowstat failed on bitmap file `%s': %sstat returns negative size for %sstring tablestring_hash_lookup failed: %sstringtable stringstringtable string lengthstub section sizessubprocess got fatal signal %dsupport not compiled in for %ssupported flags: %ssymbol informationsymbolssymtab shndxtwo different operation options specifiedunable to open output file %sundefined C++ objectundefined C++ vtableundefined variable in ATNundefined variable in TYunexpected dialog signature %dunexpected end of debugging informationunexpected fixed version info version %luunexpected fixed version information length %dunexpected fixed version signature %luunexpected group cursor type %dunexpected group icon type %dunexpected numberunexpected record typeunexpected string in C++ miscunexpected stringfileinfo value length %dunexpected varfileinfo value length %dunexpected version stringunexpected version string length %d != %d + %dunexpected version string length %d < %dunexpected version stringtable value length %dunexpected version type %dunexpected version value length %dunknown ATN typeunknown BB typeunknown C++ encoded nameunknown C++ visibilityunknown TY codeunknown alternate machine code, ignoredunknown builtin typeunknown demangling style `%s'unknown format type `%s'unknown sectionunknown virtual character for baseclassunknown visibility character for baseclassunknown visibility character for fieldunnamed $vb typeunrecognised: %-7lxunrecognized --endian type `%s'unrecognized -E optionunrecognized C++ abbreviationunrecognized C++ default typeunrecognized C++ misc recordunrecognized C++ object overhead specunrecognized C++ object specunrecognized C++ reference typeunrecognized cross reference typeunrecognized section flag `%s'unresolved PC relative reloc against %sunsupported ATN11unsupported ATN12unsupported C++ object typeunsupported IEEE expression operatorunsupported menu version %dunsupported qualiferunwind infounwind tableversion dataversion defversion def auxversion definition sectionversion length %d does not match resource length %luversion needversion need aux (2)version need aux (3)version need sectionversion string tableversion symbol dataversion var infoversion varfileinfovmawait: %swarning: CHECK procedure %s not definedwarning: EXIT procedure %s not definedwarning: MAP and FULLMAP are not supported; try ld -Mwarning: No version number givenwarning: START procedure %s not definedwarning: input and output formats are not compatiblewarning: symbol %s imported but not in import listwriting stubProject-Id-Version: binutils 2.12.1 POT-Creation-Date: 2002-01-17 13:58+0000 -PO-Revision-Date: 2002-05-24 19:55+0200 +PO-Revision-Date: 2002-08-05 00:03+0200 Last-Translator: Tommy Pettersson Language-Team: Swedish MIME-Version: 1.0 @@ -735,16 +734,16 @@ Odefinierade symboler från %s[%s]: -s, --print-armap Ta med index för symboler i arkivmedlemmar --size-sort Sortera symboler efter storlek -t, --radix=BAS Skriv tal i talbasen BAS - --target=BFD-NAMN Specificera målobjektets format som BFD-NAMN + --target=BFD-NAMN Ange målobjektets format som BFD-NAMN -u, --undefined-only Visa endast odefinierade symboler -V, --version Visa programmets versionsinformation -X 32_64 (ignoreras) Start för programhuvuden: - Minst en av följande flaggor måste ges: + Minst en av följande flaggor måste anges: - Radnumersatser: + Radnummersatser: Op-koder: @@ -783,7 +782,7 @@ Elf-filtyp är %s Fil: %s -Hex.utskrift av sektion "%s": +Hexadecimal utskrift av sektion "%s": Histogram över hinkarnas listlängd (totalt %d hinkar): @@ -837,20 +836,20 @@ startadress 0x Visa programhuvudena Visa sektionernas huvud Visa innehållet i sektion - FilStrl MinneStrl Flagg Just + FilStorlek MinneStorlek Flagg Justering möjliga : arm[_interwork], i386, mcore[-elf]{-le|-be}, ppc, thumb %s -M [ Exportera inte symboler i --export-all-symbols Exportera alla symboler till .def - --no-default-excludes Låt bli att inte exportera vissa standardsymboler + --no-default-excludes Inga automatiskt undantagna symboler --no-export-all-symbols Exportera endast anvisade symboler %-18s %s Offset Info Typ Symbolvärde Symbolnamn Offset Info Typ Symbolvärde Symbolnamn Tillägg %d %ld %s [%s] --add-indirect Lägg till indirekta dll till exportfilen. - --add-stdcall-alias Tillför alias utan @ + --add-stdcall-alias Lägg till alias utan @ --as Använd som assemblerare --base-file Läs länkargenererad basfil --def Namnge .def-indatafilen @@ -859,14 +858,14 @@ startadress 0x --driver-flags Förbigå förvalda flaggor för ld --driver-name Förvald till "gcc" --dry-run Gör inget annat än att visa vad som måste köras - --entry Ge alternativ ingångspunkt i DLL:en + --entry Ange alternativ ingångspunkt i DLL:en --exclude-symbols Undanta symbolerna i från .def --export-all-symbols Exportera alla symboler till .def - --image-base Ge bildens basadress + --image-base Ange bildens basadress --implib Synonym för --output-lib --machine --mno-cygwin Skapa Mingw-DLL - --no-default-excludes Bortse från förvalt undantagna symboler + --no-default-excludes Inga automatiskt undantagna symboler --no-export-all-symbols Exportera endast .drectve-symboler --no-idata4 Generera ingen idata$4-sektion --no-idata5 Generera ingen idata$5-sektion @@ -876,20 +875,20 @@ startadress 0x --output-lib Generera indatabibliotek. --quiet, -q Arbeta under tystnad --target i386-cygwin32 eller i386-mingw32 - --verbose, -v Utförlig + --verbose, -v Mångordig --version Visa versionsinformation för dllwrap - -A --add-stdcall-alias Tillför alias utan @. + -A --add-stdcall-alias Lägg till alias utan @. -C --compat-implib Skapa bakåtkompatibelt importbibliotek. -D --dllname Namn på indata-dll att infoga i gränssnittsbiblioteket. -F --linker-flags Skicka till länkaren. -L --linker Använd som länkare. -M --mcore-elf Behandla mcore-elf-objektfiler till . -S --as Använd som assemblerare. - -U Sätt dit understreck i .lib - -U --add-underscore Sätt dit understreck på symboler i gränssnittsbiblioteket. + -U Lägg till understreck i .lib + -U --add-underscore Lägg till understreck på symboler i gränssnittsbiblioteket. -V --version Visa versionsinformation om programmet. -a --add-indirect Lägg till indirekta dll till exportfilen. - -b --base-file Läs den länkar-genererade basfilen. + -b --base-file Läs den länkargenererade basfilen. -c --no-idata5 Generera ingen idata$5-sektion. -d --input-def Namn på .def-fil att läsa in. -e --output-exp Generera en exportfil. @@ -900,7 +899,7 @@ startadress 0x -l --output-lib Generera ett gränssnittsbibliotek. -m --machine Skapa som DLL för . [förval: %s] -n --no-delete Behåll temp.-filer (repetera för ökat antal). - -v --verbose Beskriv utförligt. + -v --verbose Var mångordig. -x --no-idata4 Generera ingen idata$4-sektion. -z --output-def Namn på .def-fil att skapa. 0 (*lokal*) 1 (*global*) förk.-offset: %ld @@ -1011,8 +1010,8 @@ startadress 0x -V, --version Visa programmets versionsinformation -i, --info Lista de objektformat och arkitekturer som hanteras -H, --help Visa denna hjälp - -b, --target=BFDNAMN Specificera att målobjektets format är BFDNAMN - -m, --architecture=MASKIN Specificera att målarkitekturen är MASKIN + -b, --target=BFDNAMN Ange att målobjektets format är BFDNAMN + -m, --architecture=MASKIN Ange att målarkitekturen är MASKIN -j, --section=NAMN Visa endast information om sektion NAMN -M, --disassembler-options=FLG Skicka vidare FLG till disassembleraren -EB --endian=big Antag big endian-format vid disassemblering @@ -1020,7 +1019,7 @@ startadress 0x --file-start-context Ta med omgivningen i början av filen (med -S) -l, --line-numbers Ta med radnummer och filnamn i utdatan -C, --demangle[=STIL] Avkoda kodade symbolnamn - STIL, om givet, kan vara: "auto", "gnu", + STIL, om angivet, kan vara: "auto", "gnu", "lucid", "arm", "hp", "edg", "gnu-new-abi" -w, --wide Anpassa utdatan för mer än 80 kolumner -z, --disassemble-zeroes Hoppa inte över block av nollor vid @@ -1031,7 +1030,7 @@ startadress 0x --[no-]show-raw-insn Visa hex.-kod jämte disassemblering --adjust-vma=OFFSET Lägg till OFFSET till alla visade sektionsadresser - -d eller --dynamic Visa det dynamiska segmentet (om det finns) + -d eller --dynamic Visa det dynamiska segmentet (om det finns) -e eller --headers Samma som: -h -l -S -h eller --file-header Visa ELF-filens huvud -i eller --instruction-dump= @@ -1064,9 +1063,9 @@ startadress 0x längd: %ld längd: %ld radbas: %d - radomfång: %d + radintervall: %d Maskin: %s - Magi: min.-instruktionslängd: %d + Magi: minsta instruktionslängd: %d Nr Hin: Värde Strl Typ Bind Synl Idx Namn Nr Hin: Värde Strl Typ Bind Synl Idx Namn Num: Index Värde Namn Nummer TAGG @@ -1091,16 +1090,16 @@ startadress 0x Sätt ISA till %d Sätt basblocket Sätt kolumnen till %d - Sätt epilogue_begin till sann + Sätt epilogue_begin till sannt Sätt is_stmt till %d - Sätt prologue_end till sann + Sätt prologue_end till sannt storl. på omr. i .debug_info-sekt.: %ld Programhuvudenas storlek: %ld (byte) Sektionshuvudenas storlek: %ld (byte) Detta huvuds storlek: %ld (byte) - Särskilld op-kod %d: öka adressen med %d till 0x%lx Tagg Typ Namn/Värde - Typ Offset VirtAdr FysAdr - Typ Offset VirtAdr FysAdr FilStrl MinneSt Flg Just + Särskild op-kod %d: öka adressen med %d till 0x%lx Tagg Typ Namn/Värde + Typ Offset VirtAdress FysAdress + Typ Offset VirtAdress FysAdress FilStrl MinneSt Flg Just Typ Offset VirtAdr FysAdr FilSt MinneSt Flg Just Typ: %s Okänd op-kod %d med operand: version: %d @@ -1110,7 +1109,7 @@ startadress 0x [-X32_64] - (ignorerad) [N] - använd förekomst [nummer] av namn [Nr] Namn Typ Adress Offset - [Nr] Namn Typ Adr Off Strl PS Flg Lk Inf Ju + [Nr] Namn Typ Adress Off Strl PS Flg Lk Inf Ju [Nr] Namn Typ Adress Off Strl PS Flg Lk Inf Ju [P] - använd fullständiga sökvägen vid jämförelser [S] - skapa inget index över arkivet @@ -1122,8 +1121,8 @@ startadress 0x [o] - bevara ursprungliga datum [s] - skapa ett index över arkivet (jfr. ranlib) [u] - ersätt bara filer som är nyare än i arkivet - [v] - beskriv utförligt - d - radera fil(er) i arkivet + [v] - var mångordig + d - ta bort fil(er) i arkivet definiera ny filtabellspost m[ab] - flytta fil(er) i arkivet p - skriv ut fil(er) som påträffas i arkivet @@ -1133,15 +1132,15 @@ startadress 0x x[o] - hämta fil(er) från arkivet %lu byte-block: (byte in i filen) (byte in i filen) - Start för sektionshuvuden: (indirekt sträng, offset: 0x%lx): <%d><%lx>: Förk.-nummer: %lu (%s) - Adr: Adr: 0x Argument %s ignoreras DW_MACINFO_define - rad : %d makro : %s + Start för sektionshuvuden: (indirekt sträng, offset: 0x%lx): <%d><%lx>: Förkortningsnummer: %lu (%s) + Adr: Adr: 0x Argument %s ignoreras DW_MACINFO_define - rad: %d makro: %s DW_MACINFO_end_file - DW_MACINFO_start_file - rad: %d filnr: %d - DW_MACINFO_undef - rad : %d makro : %s - DW_MACINFO_vendor_ext - konstant : %d sträng : %s + DW_MACINFO_start_file - rad: %d filnummer: %d + DW_MACINFO_undef - rad: %d makro: %s + DW_MACINFO_vendor_ext - konstant: %d sträng: %s Längd Nummer %% av alla Täckning inga - Nr: Namn Bind till Flagg + Nr: Namn BundenTill Flaggor Offset Info Typ Symbolvärde Symbolnamn Offset Info Typ Symbolvärde Symbolnamn Tillägg Flaggorna är: @@ -1154,28 +1153,28 @@ startadress 0x %lu %s %s -%s %s%c0x%s användes aldrig%s %s: %s%s både kopierad och borttagen%s avslutade med status %d%s har ingen %s-sektion%s är inte ett giltigt arkiv%s är inte ett arkiv%s: %s: adress utanför begränsningen%s: Kan inte öppna indataarkivet %s -%s: Kan inte öppna utdataakrivet %s +%s %s%c0x%s användes aldrig%s %s: %s%s både kopierad och borttagen%s avslutade med status %d%s har ingen %s-sektion%s är inte ett giltigt arkiv%s är inte ett arkiv%s: %s: adress utanför begränsningen%s: Kan inte öppna indataarkiv %s +%s: Kan inte öppna utdataarkiv %s %s: Konverterar en COFF-objektfil till en SYSROFF-objektfil %s: Konvertera en objektfil till en inläsningsbar NetWare-modul %s: Fel: %s: Misslyckades läsa filhuvud %s: Passande format:%s: Flera omdefinieringar av symbol "%s"%s: Inga dynamiska symboler%s: Skriv en mänskligt läsbar tolkning av en SYSROFF-objektfil -%s: Symbol "%s" är mål för mer än en omdefiniering%s: Varning: %s: felaktigt tal: %s%s: kommer inte åt adresserna i arkivet%s: kan inte skapa felsökningssektion: %s%s: hittar inte medlem %s +%s: Symbol "%s" är mål för mer än en omdefiniering%s: Varning: %s: felaktigt tal: %s%s: kommer inte åt adresserna i arkivet%s: kan inte skapa felsökningssektion: %s%s: hittar inte modulfil %s %s: kan inte öppna fil %s %s: kan inte sätta innehållet i felsökningssektionen: %s%s: kan inte sätta tiden: %s%s: kan inte ta status: %s%s: vet inte hur man skriver felsökningsinformation för %s%s: fel vid kopiering av privat BFD-data: %s%s: exekvering av %s misslyckades: %s: fil %s är inte ett arkiv -%s: fread misslyckades%s: fseek till %lu misslyckades: %s%s: ogiltigt utdataformat%s: ogiltig talbas%s: inget index att uppdatera%s: inget öppet arkiv +%s: fread misslyckades%s: fseek till %lu misslyckades: %s%s: ogiltigt utdataformat%s: ogiltig talbas%s: inget arkivindex att uppdatera%s: inget öppet arkiv %s: inget öppet utdataarkiv -%s: inget utdataarkiv anvisat än -%s: ingen känd felsökningsinformation%s: ingen resurssektion%s: inga symboler%s: inte ett dynamiskt objekt%s: inte tillräckligt med rådata%s: visa felsökningsinformationen misslyckades%s: läsnin av %lu byte gav %lu%s: läsfel: %s%s: kan inte byta namn: %s%s: sektion "%s": fel på %s: %s%s: kopieringsfel: %s%s: arkitekturer som hanteras:%s: format som hanteras:%s: mål som hanteras:%s: oväntat filslut%s: varning: %s: varning: delade bibliotek kan inte ha oinitierad data%s: varning: okänd storleken på fält "%s" i strukturen%s:%d: %s -(okänd plats-op)(användardefinierad plats-op)(deklarerad som inlajn och inlajnad)(deklarerad som inlajn men ignorerad)(inlajnad)(inte inlajnad)2-komplement, big endian2-komplement, little endian64-bitars DWARF-a-intervall stöds inte än. +%s: inget utdataarkiv angivet än +%s: ingen känd felsökningsinformation%s: ingen resurssektion%s: inga symboler%s: inte ett dynamiskt objekt%s: inte tillräckligt med binärdata%s: visa felsökningsinformationen misslyckades%s: läsning av %lu byte gav %lu%s: läsfel: %s%s: kan inte byta namn: %s%s: sektion "%s": fel på %s: %s%s: kopieringsfel: %s%s: arkitekturer som hanteras:%s: format som hanteras:%s: mål som hanteras:%s: oväntat filslut%s: varning: %s: varning: delade bibliotek kan inte ha oinitierad data%s: varning: okänd storleken på fält "%s" i strukturen%s:%d: %s +(okänd plats-op)(användardefinierad plats-op)(deklarerad som inlajn och inlajnad)(deklarerad som inlajn men ignorerad)(inlajnad)(inte inlajnad)tvåkomplement, big endiantvåkomplement, little endian64-bitars DWARF-a-intervall stöds inte än. 64-bitars DWARF-felsökningsinfo stöds inte än. 64-bitars DWARF-formatmallar stöds inte än. 64-bitars DWARF-radinformation stöds inte än. -64-bitars DWARF-publika namn stöds inte än. +64-bitars publika DWARF-namn stöds inte än. : dublett av värdet : förväntades vara en katalog : förväntades vara ett löv -: %d: %d: %d: %lx: %xLa till exporter till utdatafilenLägger till exporter till utdatafilenövervakningsbibliotekyttre bibliotekflyttalstyp BCD stöds inteBFD-huvudfil version %s +: %d: %d: %d: %lx: %xLa till exporter till utdatafilenLägger till exporter till utdatafilenövervakningsbibliotekyttre bibliotekflyttalstyp BCD stöds inteBFD-huvudfil version %s Felaktig stab: %s odefinierad C++-basklassHittade inte C++-basklassen i behållarenHittade inte C++-datamedlemmen i behållarenC++-standardvärden inte inom en funktionC++-objektet har inga fältC++-referensen är ingen pekarehittade inte C++-referensenstatisk virtuell C++-metodCORE (minnesfil)Kan inte fylla ut efter %s: %sKan inte disassemblera för arkitektur %s Kan inte fylla luckan efter %s: %sKan inte ha både LIBRARY och NAMEKan inte öppna .lib-fil: %sKan inte öppna def-fil: %sKan inte öppna fil %s @@ -1191,8 +1190,8 @@ startadress 0x Skapade biblioteksfilenSkapar biblioteksfil: %sSkapar stubbfil: %sDet aktuella öppna arkivet är %s DLLVERKTYG namn : %s DLLVERKTYG flaggor: %s -ENHET namn : %s -ENHET flaggor : %s +DRIVRUTIN namn : %s +DRIVRUTIN flaggor : %s DYN (delad objektfil)Tar bort temporär basfil %sTar bort temporär def-fil %sTar bort temporär exportfil %sberoendövervakningsbibliotekDisassemblering av sektion %s: Visa information från en objektFIL. Visa felsökningsinnehållet i sektion %s stöds inte än. @@ -1201,9 +1200,9 @@ startadress 0x EXEC (exekverbar fil)Slut på sekvensen Ingångspunkt Fel, dubbel EXPORT med ordningstal: %sUndantar symbol: %sExekvering av %s misslyckadesFORMAT är någon av rc, res eller coff, och härleds från filnamnsändelsen -om det inte specificeras. Ett ensamt filnamn är en indatafil. Ingen -indatafil betyder standard-in, med format rc. Ingen utdatafil betyder -standard-ut, med format rc. +om det inte anges. Ett ensamt filnamn är en indatafil. Ingen indatafil +betyder standard in, med format rc. Ingen utdatafil betyder standard ut, +med format rc. Misslyckades läsa in antalet hinkar Misslyckades Läsa in antalet kedjor Filen innehåller flera dynamiska strängtabeller @@ -1220,17 +1219,17 @@ standard-ut, med format rc. Behåller temporär basfil %sBehåller temporär def-fil %sBehåller temporär exportfil %sNyckel till flaggorna: W (skriv), A (allokera), X (exekvera), M (förena), S (strängar) I (info), L (länkordning), G (grupp), x (okänd) - O (extra OS-bearbetning krävs) o (OS-specifik), p (processor-specifik) + O (extra OS-bearbetning krävs) o (OS-specifik), p (processorspecifik) LIBRARY: %s bas: %xDe sista stabs-posterna innan felet: bibliotekets rpath: [%s]bibliotekets runpath: [%s]biblioteks so-namn: [%s]Lista symboler i FILerna (eller a.out). -Maskin "%s" hanteras inteFlera namnbyten på sektion %sTillför minst en av flaggorna -o eller --dllnameNAME: %s bas: %xNONE (ingen)NT_FPREGS (flyttalsregister)NT_FPREGSET (flyttalsregister)NT_LWPSINFO (lwpsinfo_t-struktur)NT_LWPSTATUS (lwpstatus_t-struktur)NT_PRPSINFO (prpsinfo-struktur)NT_PRSTATUS (prstatus-struktur)NT_PRXFPREG (user_xfpregs-struktur)NT_PSINFO (psinfo-struktur)NT_PSTATUS (pstatus-struktur)NT_TASKSTRUCT (task-struktur)NT_WIN32PSTATUS (win32_pstatus-struktur)N_LBRAC inte inuti funktion +Maskin "%s" hanteras inteFlera namnbyten på sektion %sAnge minst en av flaggorna -o eller --dllnameNAME: %s bas: %xNONE (ingen)NT_FPREGS (flyttalsregister)NT_FPREGSET (flyttalsregister)NT_LWPSINFO (lwpsinfo_t-struktur)NT_LWPSTATUS (lwpstatus_t-struktur)NT_PRPSINFO (prpsinfo-struktur)NT_PRSTATUS (prstatus-struktur)NT_PRXFPREG (user_xfpregs-struktur)NT_PSINFO (psinfo-struktur)NT_PSTATUS (pstatus-struktur)NT_TASKSTRUCT (uppgiftsstruktur)NT_WIN32PSTATUS (win32_pstatus-struktur)N_LBRAC inte inuti funktion Namn Värde Klass Typ Storl. Rad Sektion Namnindex: %ld Namn: %s NetBSD processinfo-strukturDet finns ingen %s-sektion -Ingen %s i arkivet. +Ingen post %s i arkivet. Ingen kodning av "%s" Ingen medlem heter "%s" Det finns inga kommentarer i minnesfilen. @@ -1238,38 +1237,38 @@ standard-ut, med format rc. onödigt objekt: [%s] Inget att göra. OS-specifik: (%x)Endast -X 32_64 stödsEndast DWARF2:s a-intervall stöds för närvarande. -Endast DWARF 2 pub.-namn stöds för närvarande +Endast publika DWARF 2-namn stöds för närvarande Endast DWARF version 2:s radinfo stöds för närvarande. -Endast version 2 av DWARF felsökningsinformation stöds för närvarande. +Endast version 2 av DWARF-felsökningsinformation stöds för närvarande. Öppnade temporär fil: %soperativsystemsspecifik: %lxFlaggor: -i FIL, --input FIL Namnge indatafilen -o FIL, --output FIL Namnge utdatafilen -I FORMAT, --input-format FORMAT - Specificera indataformatet + Ange indataformatet -O FORMAT, --output-format FORMAT - Specificera utdataformatet - -F MÅL, --target MÅL Specificera COFF-målet + Ange utdataformatet + -F MÅL, --target MÅL Ange COFF-målet --preprocessor PROGRAM Program att använda som preprocessor på rc-filen --include-dir KATALOG Inkludera katalog när rc-filen preprocessas -DSYM[=VÄRDE], --define SYM[=VÄRDE] Definiera SYM när rc-filen preporocessas - -v Utförlig - berättar vad den gör + -v Mångordig - berättar vad den gör --language SPRÅK Sätt språket när rc-filen läses --use-temp-file Använd en tem.fil istället för popen vid läsning av utdata från preprocessorn --no-use-temp-file Använd popen (förval) Slut på minneSlut på minne Slut på minne vid allokering av %d byte för %s -Slut på minne vid allokering av tabell för önskade utskrifter.Slut på virtuellt minnePT_FIRSTMACH+%dPT_GETFPREGS (fpreg-struktur)PT_GETREGS (reg-struktur)Pascal-filnamn stöds inteDef-filen är bearbetadDefinitionerna är bearbetadeBearbetar def-fil: %sBearbetar definitionerprocessorspecifik: %lxprocessorspecifik: (%x)REL (omlokaliseringsbar fil)Läsa %s-sektionen i %s misslyckades: %sLäsa %s-sektionen i %s misslyckades: %s +Slut på minne vid allokering av tabell för önskade utskrifter.Slut på virtuellt minnePT_FIRSTMACH+%dPT_GETFPREGS (fpreg-struktur)PT_GETREGS (registerstruktur)Pascal-filnamn stöds inteDef-filen är behandladDefinitionerna är bearbetadeBehandlar def-fil: %sBearbetar definitionerprocessorspecifik: %lxprocessorspecifik: (%x)REL (omlokaliseringsbar fil)Läsa %s-sektionen i %s misslyckades: %sLäsa %s-sektionen i %s misslyckades: %s Rapportera fel till %s -Rapportera fel i översättningen till sv@li.org +Skicka synpunkter på översättningen till sv@li.org Rapportera fel till %s. -Rapportera fel i översättningen till sv@li.org. -Avläser objektfil %sSektioner: +Skicka synpunkter på översättningen till sv@li.org. +Genomsöker objektfil %sSektioner: delat bibliotek: [%s]Hoppar över oväntad omlokaliseringstyp %s Hoppar över oväntad symboltyp %u Några sektioner skrevs inte ut eftersom de inte existerar! -Självständig app.Suger åt mig info från sektion %s i %sArkitekturer som hanteras:Mål som hanteras:Syntaktiskt fel i def-fil %s:%dRadinformationen verkar vara trasig - sektionen är för liten +Självständigt programSuger åt mig info från sektion %s i %sArkitekturer som hanteras:Mål som hanteras:Syntaktiskt fel i def-fil %s:%dRadinformationen verkar vara trasig - sektionen är för liten Sektion %s innehåller: Sektion %s innehåller: @@ -1280,16 +1279,16 @@ datatyp och kan därför inte läsa 64-bita i GNU General Public License. Detta program har inga som helst garantier. För många N_RBRAC:s Provade "%s" -Provade fil: %sTyps filnummer %d utanför sitt intervall -Typs indexnummer %d utanför sitt intervall +Provade fil: %sTypens filnummer %d utanför sitt intervall +Typens indexnummer %d utanför sitt intervall OKÄND: längd %d Kan inte ändra endian-typ på indatafilen(erna)Kan inte fastställa längden på den dynamiska strängtabellen Kan inte fastställa hur många symboler som ska läsas in Kan inte hitta namnet på programtolken Kan inte hitta någon .debug_abbrev-sektion! Kan inte hitta post %lu i förkortningstabellen -Kan inte öppna basfilen: %sKan inte öppna objektfil: %sKan inte öppna temporär assemblerfil: %sKan inte läsa in %d byte %s -Kan inte läsa in den dynamiska datan +Kan inte öppna basfilen: %sKan inte öppna objektfil: %sKan inte öppna temporär assemblerfil: %sKan inte läsa in %d byte från %s +Kan inte läsa in dynamisk data Kan inte uppsöka %2$s på %1$x Kan inte uppsöka slutet av filen Kan inte uppsöka slutet av filen!Kan inte uppsöka början av den dynamiska informationenOdefinierad N_EXCLStorlek på data som inte kan behandlas: %d @@ -1300,43 +1299,43 @@ i GNU General Public License. Detta pro Användning: %s Användning: %s indatafil [utdatafil] Användning: %s indatafil(er) -Användning: %s FLAGGOR... FIL... +Användning: %s FLAGGA... FIL... Användning: %s [-A | --format=sysv | -B | --format=berkeley] [-o | --radix=8 | -d | --radix=10 | -h | --radix=16] [-V | --version] [--target=bfdnamn] [--help] [fil...] Användning: %s [-CfsHV] [-b bfd-namn] [--target=bfd-namn] [-e programfil] [--exe=programfil] [--demangle[=stil]] - [--basenames] [--functions] [adr adr ...] + [--basenames] [--functions] [adress adress ...] Användning: %s [-X32_64] [-]{dmpqrstx}[abcfilNoPsSuvV] [medlemsnamn] [nummer] arkivfil fil... -Användning: %s [-afov] [-n min-len] [-min-len] [-t {o,x,d}] [-e {s,b,l,B,L}] - [-] [--all] [--print-file-name] [--bytes=min-län] [--radix={o,x,d}] - [--target=bfdnamn] [--encoding {s,b,l,B,L}] [--help] [--version] fil... +Användning: %s [-afov] [-n min-längd] [-min-len] [-t {o,x,d}] [-e {s,b,l,B,L}] + [-] [--all] [--print-file-name] [--bytes=min-längd] [--radix={o,x,d}] + [--target=bfdnamn] [--encoding {s,b,l,B,L}] [--help] [--version] fil... Användning: %s [-dhV] [-I bfd-namn] [-O bfd-namn] [-T huvudfil] [-l länkare] [--input-target=bfd-namn] [--output-target=bfd-namn] [--header-file=fil] [--linker=länkare] [--debug] [--help] [--version] [indatafil [utdatafil]] -Användning: %s [-dhVq] in-fil [ut-fil] -Användning: %s [-hV] in-fil +Användning: %s [-dhVq] infil [utfil] +Användning: %s [-hV] infil Användning: %s [-vV] arkiv Användning: %s [FLAGGA]... [FIL]... -Användning: %s [flaggor] [in-fil] [ut-fil] +Användning: %s [flaggor] [infil] [utfil] Användning: readelf {flaggor} elf-fil(er) Använder "%s" Använder fil: %sAnvänder popen för att läsa utdata från preprocessorn Utnyttjar temporärfil "%s" till att läsa preprocessorutdata -"N":s argument måste vara positivt.Varning, ignorerar dubbel EXPORT %s %d,%dVarning: %s: %s +Argument till "N" måste vara positivt.Varning, ignorerar dubbel EXPORT %s %d,%dVarning: %s: %s Varning: Utdatafilen kan inte representera arkitektur %sVarning: ändrar datatypens storlek från %d till %d -Varning: indata måste ha formatet 'binary' för binärarkitektursparametrar.Varning: kortar av utfyllnadsvärdet från 0x%s till 0x%x"N" är bara meningsfull tillsammans med "x" eller "d"."u" är bara meningsfull tillsammans med "r".accelererarejämn gränsindex för alternativ maskinkod måste vara positivtarkitektur %s är okändarkitektur: %s, felaktig ATN65-postC++-fältets bit-position eller bit-storlek är felaktigfelaktig dynamisk symbolfelaktigt format på %sfelaktigt kodat namn "%s" +Varning: indata måste ha formatet "binary" för binärarkitektursparametern.Varning: kortar av utfyllnadsvärdet från 0x%s till 0x%x"N" är bara meningsfull tillsammans med flaggan "x" eller "d"."u" är bara meningsfull tillsammans med flaggan "r".accelererarejämn gränsindex för alternativ maskinkod måste vara positivtarkitektur %s är okändarkitektur: %s, felaktig ATN65-postC++-fältets bitposition eller bitstorlek är felaktigfelaktig dynamisk symbolfelaktigt format på %sfelaktigt kodat namn "%s" felaktig misc-postfelaktig typ på C++-metodfunktionfelaktigt utformad utökad rad-op påträffades! -bfd_coff_get_auxent misslyckades: %sbfd_coff_get_syment misslyckades: %sbfd_open misslyckades att öppna stubbfil: %sblock kvar på stacken på slutetbyte-nr måste vara mindre än antalet byte i intervalletbyte-nr får inte vara negativtkan inte fastställa "%s":s filtyp; använd flagga -Ikan inte skapa sektion "%s": %skan inte exekvera "%s": %skan inte ta fram BFD_RELOC_RVA-relokeringstypkan inte öppna %s "%s": %skan inte öppna "%s" för utmatning: %skan inte öppna temporärfil "%s": %skan inte anropa popen "%s": %skan inte läsa resurssektionenkan inte omdirigera standard-ut: "%s": %skan inte sätta BFD:s standardmål till "%s": %skan inte radera %s: %skan inte skapa katalog %s för arkivkopiering (fel: %s)kan inte öppna indatafil %skan inte öppna: %s: %skan inte ta status: %s: %skonfliktkonfliktlista utan tabellconst/volatile-indikator saknaskontrolldata kräver DIALOGEXkopierar från %s(%s) till %s(%s) -skapar %smarkörmarkörfil "%s" innehåller inte markördataanpassningsbar sektiondatapostdatastorlek %ldfelsökningssektionsdatadebug_abbrev sektionsdatadebug_add_to_current_namespace: ingen aktuell fildebug_end_block: försök gjordes att avsluta yttersta blocketdebug_end_block: inget aktuell blockdebug_end_common_block: inte implementeratdebug_end_function: ingen aktuell funktiondebug_end_function: några block avslutades intedebug_find_named_type: ingen aktuell kompileringsenhetdebug_get_real_type: %s har cirkulär felsökningsinformation -debug_make_undefined_type: sorten kan inte hanterasdebug_name_type: ingen aktuell fildebug_record_function: inget anrop till debug_set_filenamedebug_record_label: inte implementeratdebug_record_line: ingen aktuell kompileringsenhetdebug_record_parameter: ingen aktuell funktiondebug_record_variable: inget aktuellt blockdebug_record_variable: ingen aktuell fildebug_start_block: inget aktuell blockdebug_start_common_block: inte implementeratdebug_start_source: inget anrop till debug_set_filenamedebug_str sektionsdatadebug_tag_type: försök gjordes att sätta en extra taggdebug_tag_type: ingen aktuell fildebug_write_type: påträffade en ogiltig typstandardvärdet är --format=berkley +bfd_coff_get_auxent misslyckades: %sbfd_coff_get_syment misslyckades: %sbfd_open misslyckades att öppna stubbfil: %sblock kvar på stacken på slutetbytenummer måste vara mindre än antalet byte i intervalletbytenummer får inte vara negativtkan inte fastställa filtyp på fil "%s"; använd flagga -Ikan inte skapa sektion "%s": %skan inte exekvera "%s": %skan inte ta fram BFD_RELOC_RVA-relokeringstypkan inte öppna %s "%s": %skan inte öppna "%s" för utmatning: %skan inte öppna temporärfil "%s": %skan inte anropa popen "%s": %skan inte läsa resurssektionenkan inte omdirigera standard ut: "%s": %skan inte sätta BFD:s standardmål till "%s": %skan inte ta bort %s: %skan inte skapa katalog %s för arkivkopiering (fel: %s)kan inte öppna indatafil %skan inte öppna: %s: %skan inte ta status: %s: %skonfliktkonfliktlista utan tabellconst/volatile-indikator saknaskontrolldata kräver DIALOGEXkopierar från %s(%s) till %s(%s) +skapar %smarkörmarkörfil "%s" innehåller inte markördataanpassningsbar sektiondatapostdatastorlek %ldfelsökningssektionsdatadebug_abbrev-sektionsdatadebug_add_to_current_namespace: ingen aktuell fildebug_end_block: försök gjordes att avsluta yttersta blocketdebug_end_block: inget aktuellt blockdebug_end_common_block: inte implementeratdebug_end_function: ingen aktuell funktiondebug_end_function: några block avslutades intedebug_find_named_type: ingen aktuell kompileringsenhetdebug_get_real_type: %s har cirkulär felsökningsinformation +debug_make_undefined_type: sorten kan inte hanterasdebug_name_type: ingen aktuell fildebug_record_function: inget anrop till debug_set_filenamedebug_record_label: inte implementeratdebug_record_line: ingen aktuell kompileringsenhetdebug_record_parameter: ingen aktuell funktiondebug_record_variable: inget aktuellt blockdebug_record_variable: ingen aktuell fildebug_start_block: inget aktuellt blockdebug_start_common_block: inte implementeratdebug_start_source: inget anrop till debug_set_filenamedebug_str sektionsdatadebug_tag_type: försök gjordes att sätta en extra taggdebug_tag_type: ingen aktuell fildebug_write_type: påträffade en ogiltig typstandardvärdet är --format=berkeley standardvärdet är --format=sysv dialogkontrolldialogkontrollsdatadialogkontrollsslutdialogtypsnittsstorlekdialoghuvuddioalog-ext.kontrolldialog-ext.-typsnittsinformationkatalogkatalogpostnamndynamiskt segmentdynamisk strängtabelldynamiska strängarfelbalanserad uttrycksstacköverspill i uttrycksstackenunderspill i uttrycksstackenmisslyckades att öppna temporär huvudfil: %smisslyckades att öppna temporär svansfil: %sfilnamn krävs för COFF-indatafilnamn krävs för COFF-utdatafast versionsinfoflaggorflaggor 0x%08x: -typsnittskatalogtypsnittskatalogsenhetsnamntypsnittskatalogstypsnittsnamntypsnittskatalogshuvudgruppmarkörgruppmarkörshuvudgruppikongruppikonshuvudhar barnhjälp-ID kräver DIALOGEXhjälpsektionikon-fil "%s" innehåller inte ikondataotillåten flagga -- %cotillåtet typindexotillåtet variabelindexutdatafilen måste vara en annan än indatafilenindatafilen nämnd både på kommandoraden och via INPUTintervallstorleken måste vara positivinternt fel -- flaggan är inte implementeradinternt stat-fel för %sogiltigt argument till --format: %sogiltigt heltalsargument %sogiltigt talogiltigt tal %sogiltig stränglängdbibliotekslistaskapa .bss-sektionskapa .nlmsections-sektionskapa sektiontillverkningmenyhuvudmeny-ext.-huvudmeny-ext.-offsetmenyobjektmenyobjektshuvudmeddelandesektionutebliven indextypsaknar nödvändig ASNsaknar nödvändig ATN65modulsektionmer än ett dynamiskt segment +typsnittskatalogtypsnittskatalogsenhetsnamntypsnittskatalogstypsnittsnamntypsnittskatalogshuvudgruppmarkörgruppmarkörshuvudgruppikongruppikonshuvudhar barnhjälp-ID kräver DIALOGEXhjälpsektionikonfil "%s" innehåller inte ikondataotillåten flagga -- %cotillåtet typindexotillåtet variabelindexutdatafilen måste vara en annan än indatafilenindatafilen nämnd både på kommandoraden och via INPUTintervallstorleken måste vara positivinternt fel -- denna flagga är inte implementeradinternt stat-fel för %sogiltigt argument till --format: %sogiltigt heltalsargument %sogiltigt talogiltigt tal %sogiltig stränglängdbibliotekslistaskapa .bss-sektionskapa .nlmsections-sektionskapa sektiontillverkningmenyhuvudmeny-ext.-huvudmeny-ext.-offsetmenyobjektmenyobjektshuvudmeddelandesektionutebliven indextypsaknar nödvändig ASNsaknar nödvändig ATN65modulsektionmer än ett dynamiskt segment namngiven katalogpostnamngiven resursnamngiven underkatalogingen argumenttyp i kodad sträng inga barningen post %s i arkivet -ingen %s i arkiv %s!ingen export-definitionsfil gavs. -En sådan skapas, men det är kanske inte vad du villingen indatafilingen indatafil gavsinget namn på utdatafileningen kommandoflagga gavsinga resurseringen typinformation om C++-metodfunktioningenkommentarernollterminerad unicode-strängnumeriskt överspillflaggorslut på minne vid tolkning av omlokaliseringaröverspill vid justeringen av omlokalisering mot %sparse_coff_type: Felaktig typkod 0x%xprivat dataprogramhuvudenreferensparametern är inte en pekareomlokaliseringarresurs-IDresursdatastorlek på resursdataokänd resurstyprpc-sectionsektionsdatasektionshuvudensätt vma för .bsssätt .data-storleksätt .nlmsektions innehållsätt .nlmsections-flaggorsätt .nlmsektions storleksätt Adress till 0x%lx -sätt jämn gräns för sektionsätt sektionsflaggorsätt sektionsstorleksätt startadressdelad sektionstorlekstab_int_type: felaktig storlek %uöverspill i stackenunderspill i stackenstat misslyckades på bildfil "%s": %sstat returnerar negativ storlek på %ssträngtabellstring_hash_lookup misslyckades: %ssträngtabellssträngsträngtabellsstränglängdstubbsektionsstorleksubprocessen fick fatal signal %dinte kompilerad med stöd för %sflaggor som hanteras: %ssymbolinformationsymbolersymtab shndxtvå olika kommandoflaggor gavskan inte öppna utdatafil %sodefinierat C++-objektodefinierad C++-v-tabellodefinierad variabel i ATNodefinierad variabel i TYoväntad dialogsignatur %doväntat slut på felsökningsinformationenoväntad version %lu av fast versionsinformationoväntad längd %d på fast versionsinformationoväntad fast versions-signatur %luoväntad gruppmarkörstyp %doväntad gruppikonstyp %doväntat taloväntad posttypoväntad sträng i C++-miscoväntad längd %d på värde för strängfilsinfooväntad längd %d på värde för var.filinfooväntad versionssträngoväntad längd %d != %d + %d på versionssträngoväntad längd %d < %d på versionssträngoväntad längd %d på värde för versionssträngtabelloväntad versionstyp %doväntad längd %d på värde för versionokänd ATN-typokänd BB-typokänt C++-kodat namnokänd C++-synlighetokänd TY-kodokänd alternativ maskinkod, ignoreradokänd inbyggd typokänd avkodningsstil "%s"okänd formattyp "%s"okänd sektionokänt virtuellt tecken för basklassokänd synlighetskaraktär för basklassokänd synlighetskaraktär för fält$vb-typ utan namnokänd: %-7lxokänd --endian-typ "%s"okänd -E-flaggaokänd C++-förkortningokänd C++-standardtypokänd C++-misc-postokänd C++-objektöversiktsspecokänd C++-objektspecifikationokänd C++-referenstypokänd korsreferenstypokänd sektionsflagga "%s"olöst PC-relativ omlokalisering mot %sATN11 stöds inteATN12 stöds inteostödd C++-objekttypIEEE-uttrycksoperator som inte stödsostödd menyversion %dbestämningen stöds intetillbakarullningsinfotillbakarullningstabellversionsdataversionsdef.yttre versionsdef.versiondefinitionssektionversionslängd %d passar inte med resurslängd %luversionsbehovyttre versionsbehov (2)yttre versionsbehov (3)versionsbehovssektionversionssträngtabellversionsymbolsdatavariabel versionsinfoversionsvar.filinfovmawait: %svarning: CHECK-procedur %s är inte definieradvarning: EXIT-procedur %s är inte definieradvarning: MAP och FULLMAP stöds inte; försök med ld -Mvarning: Inget versionsnummer givetvarning: START-procedur %s är inte definieradvarning: formaten för in- och utdata är inte kompatiblavarning: symbolen %s importerades men finns inte med i importlistanskriver stubbe \ No newline at end of file +ingen post %s i arkiv %s!ingen export-definitionsfil angavs. +En sådan skapas, men det är kanske inte vad du villingen indatafilingen indatafil angavsinget namn på utdatafileninget kommando angavsinga resurseringen typinformation om C++-metodfunktioningenkommentarernollterminerad unicode-strängnumeriskt överspillflaggorslut på minne vid tolkning av omlokaliseringaröverspill vid justeringen av omlokalisering mot %sparse_coff_type: Felaktig typkod 0x%xprivat dataprogramhuvudenreferensparametern är inte en pekareomlokaliseringarresurs-IDresursdatastorlek på resursdataokänd resurstyprpc-sectionsektionsdatasektionshuvudensätt vma för .bsssätt .data-storleksätt inehåll i .nlmsektionensätt .nlmsections-flaggorsätt storlek på .nlmsektionensätt Adress till 0x%lx +sätt jämn gräns för sektionsätt sektionsflaggorsätt sektionsstorleksätt startadressdelad sektionstorlekstab_int_type: felaktig storlek %uöverspill i stackenunderspill i stackenstat misslyckades på bildfil "%s": %sstat returnerar negativ storlek på %ssträngtabellstring_hash_lookup misslyckades: %ssträngtabellssträngsträngtabellsstränglängdstubbsektionsstorlekbarnprocessen fick fatal signal %dinte kompilerad med stöd för %sflaggor som hanteras: %ssymbolinformationsymbolersymtab shndxtvå olika kommandoflaggor angavskan inte öppna utdatafil %sodefinierat C++-objektodefinierad C++-v-tabellodefinierad variabel i ATNodefinierad variabel i TYoväntad dialogsignatur %doväntat slut på felsökningsinformationenoväntad version %lu av fast versionsinformationoväntad längd %d på fast versionsinformationoväntad fast versionssignatur %luoväntad gruppmarkörstyp %doväntad gruppikonstyp %doväntat taloväntad posttypoväntad sträng i C++-miscoväntad längd %d på värde för strängfilsinfooväntad längd %d på värde för var.filinfooväntad versionssträngoväntad längd %d != %d + %d på versionssträngoväntad längd %d < %d på versionssträngoväntad längd %d på värde för versionssträngtabelloväntad versionstyp %doväntad längd %d på värde för versionokänd ATN-typokänd BB-typokänt C++-kodat namnokänd C++-synlighetokänd TY-kodokänd alternativ maskinkod, ignoreradokänd inbyggd typokänd avkodningsstil "%s"okänd formattyp "%s"okänd sektionokänt virtuellt tecken för basklassokänd synlighetstecken för basklassokänd synlighetstecken för fält$vb-typ utan namnokänd: %-7lxokänd --endian-typ "%s"okänd -E-flaggaokänd C++-förkortningokänd C++-standardtypokänd C++-misc-postokänd C++-objektöversiktsspecokänd C++-objektspecifikationokänd C++-referenstypokänd korsreferenstypokänd sektionsflagga "%s"olöst PC-relativ omlokalisering mot %sATN11 stöds inteATN12 stöds inteC++-objekttyp som inte stödsIEEE-uttrycksoperator som inte stödsmenyversion %d stöds intebestämningen stöds intetillbakarullningsinfotillbakarullningstabellversionsdataversionsdef.yttre versionsdef.versiondefinitionssektionversionslängd %d passar inte med resurslängd %luversionsbehovyttre versionsbehov (2)yttre versionsbehov (3)versionsbehovssektionversionssträngtabellversionsymbolsdatavariabel versionsinfoversionsvar.filinfovmawait: %svarning: CHECK-procedur %s är inte definieradvarning: EXIT-procedur %s är inte definieradvarning: MAP och FULLMAP stöds inte; försök med ld -Mvarning: Inget versionsnummer angivetvarning: START-procedur %s är inte definieradvarning: formaten för in- och utdata är inte kompatiblavarning: symbolen %s importerades men finns inte med i importlistanskriver stubbe \ No newline at end of file diff -Nurpa binutils-2.13/binutils/po/sv.po binutils-2.13.1/binutils/po/sv.po --- binutils-2.13/binutils/po/sv.po 2002-05-27 11:15:52.000000000 -0400 +++ binutils-2.13.1/binutils/po/sv.po 2002-09-23 18:13:12.000000000 -0400 @@ -4,15 +4,16 @@ # msgid "" msgstr "" -"Project-Id-Version: binutils 2.12-pre020121\n" +"Project-Id-Version: binutils 2.12.1\n" "POT-Creation-Date: 2002-01-17 13:58+0000\n" -"PO-Revision-Date: 2002-05-24 19:55+0200\n" +"PO-Revision-Date: 2002-08-05 00:03+0200\n" "Last-Translator: Tommy Pettersson \n" "Language-Team: Swedish \n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=iso-8859-1\n" "Content-Transfer-Encoding: 8bit\n" +# #: addr2line.c:73 #, c-format msgid "" @@ -22,172 +23,212 @@ msgid "" msgstr "" "Användning: %s [-CfsHV] [-b bfd-namn] [--target=bfd-namn]\n" " [-e programfil] [--exe=programfil] [--demangle[=stil]]\n" -" [--basenames] [--functions] [adr adr ...]\n" +" [--basenames] [--functions] [adress adress ...]\n" -#: addr2line.c:80 ar.c:289 nlmconv.c:1121 objcopy.c:423 objcopy.c:455 readelf.c:2181 size.c:91 strings.c:655 windres.c:737 +# +#: addr2line.c:80 ar.c:289 nlmconv.c:1121 objcopy.c:423 objcopy.c:455 +#: readelf.c:2181 size.c:91 strings.c:655 windres.c:737 #, c-format msgid "Report bugs to %s\n" msgstr "" "Rapportera fel till %s\n" -"Rapportera fel i översättningen till sv@li.org\n" +"Skicka synpunkter på översättningen till sv@li.org\n" +# #: addr2line.c:240 #, c-format msgid "%s: can not get addresses from archive" msgstr "%s: kommer inte åt adresserna i arkivet" +# #: addr2line.c:312 nm.c:447 objdump.c:2800 #, c-format msgid "unknown demangling style `%s'" msgstr "okänd avkodningsstil \"%s\"" +# #: ar.c:237 #, c-format msgid "no entry %s in archive\n" msgstr "ingen post %s i arkivet\n" +# #: ar.c:254 #, c-format msgid "Usage: %s [-X32_64] [-]{dmpqrstx}[abcfilNoPsSuvV] [member-name] [count] archive-file file...\n" msgstr "Användning: %s [-X32_64] [-]{dmpqrstx}[abcfilNoPsSuvV] [medlemsnamn] [nummer] arkivfil fil...\n" +# #: ar.c:257 #, c-format msgid " %s -M [\n" "\n" +# #: ar.c:850 ar.c:918 #, c-format msgid "%s is not a valid archive" msgstr "%s är inte ett giltigt arkiv" +# #: ar.c:886 #, c-format msgid "stat returns negative size for %s" msgstr "stat returnerar negativ storlek på %s" +# #: ar.c:1013 #, c-format msgid "%s is not an archive" msgstr "%s är inte ett arkiv" +# #: ar.c:1020 #, c-format msgid "creating %s" msgstr "skapar %s" +# #: ar.c:1226 #, c-format msgid "No member named `%s'\n" msgstr "Ingen medlem heter \"%s\"\n" +# #: ar.c:1278 #, c-format msgid "no entry %s in archive %s!" -msgstr "ingen %s i arkiv %s!" +msgstr "ingen post %s i arkiv %s!" +# # archive map verkar vara vad indexet kallas i källkoden #: ar.c:1439 #, c-format msgid "%s: no archive map to update" -msgstr "%s: inget index att uppdatera" +msgstr "%s: inget arkivindex att uppdatera" +# #: arsup.c:88 #, c-format msgid "No entry %s in archive.\n" -msgstr "Ingen %s i arkivet.\n" +msgstr "Ingen post %s i arkivet.\n" +# #: arsup.c:120 #, c-format msgid "Can't open file %s\n" msgstr "Kan inte öppna fil %s\n" +# #: arsup.c:171 #, c-format msgid "%s: Can't open output archive %s\n" -msgstr "%s: Kan inte öppna utdataakrivet %s\n" +msgstr "%s: Kan inte öppna utdataarkiv %s\n" +# #: arsup.c:183 #, c-format msgid "%s: Can't open input archive %s\n" -msgstr "%s: Kan inte öppna indataarkivet %s\n" +msgstr "%s: Kan inte öppna indataarkiv %s\n" +# #: arsup.c:189 #, c-format msgid "%s: file %s is not an archive\n" msgstr "%s: fil %s är inte ett arkiv\n" +# #: arsup.c:230 #, c-format msgid "%s: no output archive specified yet\n" -msgstr "%s: inget utdataarkiv anvisat än\n" +msgstr "%s: inget utdataarkiv angivet än\n" +# #: arsup.c:250 arsup.c:285 arsup.c:321 arsup.c:341 arsup.c:399 #, c-format msgid "%s: no open output archive\n" msgstr "%s: inget öppet utdataarkiv\n" +# #: arsup.c:258 arsup.c:359 arsup.c:379 #, c-format msgid "%s: can't open file %s\n" msgstr "%s: kan inte öppna fil %s\n" +# # module file är detsamma som member #: arsup.c:306 arsup.c:375 arsup.c:454 #, c-format msgid "%s: can't find module file %s\n" -msgstr "%s: hittar inte medlem %s\n" +msgstr "%s: hittar inte modulfil %s\n" +# #: arsup.c:406 #, c-format msgid "Current open archive is %s\n" msgstr "Det aktuella öppna arkivet är %s\n" +# # BUGG: dubbelt blanksteg #: arsup.c:433 #, c-format msgid "%s: no open archive\n" msgstr "%s: inget öppet arkiv\n" +# #: bucomm.c:106 #, c-format msgid "can't set BFD default target to `%s': %s" msgstr "kan inte sätta BFD:s standardmål till \"%s\": %s" +# #: bucomm.c:118 #, c-format msgid "%s: Matching formats:" msgstr "%s: Passande format:" +# #: bucomm.c:135 msgid "Supported targets:" msgstr "Mål som hanteras:" +# #: bucomm.c:137 #, c-format msgid "%s: supported targets:" msgstr "%s: mål som hanteras:" +# #: bucomm.c:153 msgid "Supported architectures:" msgstr "Arkitekturer som hanteras:" +# #: bucomm.c:155 #, c-format msgid "%s: supported architectures:" msgstr "%s: arkitekturer som hanteras:" +# #: bucomm.c:262 #, c-format msgid "%s: bad number: %s" msgstr "%s: felaktigt tal: %s" +# #: coffdump.c:106 #, c-format msgid "#lines %d " msgstr "#rader %d " +# #: coffdump.c:468 sysdump.c:740 #, c-format msgid "%s: Print a human readable interpretation of a SYSROFF object file\n" msgstr "%s: Skriv en mänskligt läsbar tolkning av en SYSROFF-objektfil\n" +# #: coffdump.c:531 srconv.c:2029 sysdump.c:799 msgid "no input file specified" -msgstr "ingen indatafil gavs" +msgstr "ingen indatafil angavs" +# #: debug.c:653 msgid "debug_add_to_current_namespace: no current file" msgstr "debug_add_to_current_namespace: ingen aktuell fil" +# #: debug.c:736 msgid "debug_start_source: no debug_set_filename call" msgstr "debug_start_source: inget anrop till debug_set_filename" +# #: debug.c:795 msgid "debug_record_function: no debug_set_filename call" msgstr "debug_record_function: inget anrop till debug_set_filename" +# #: debug.c:851 msgid "debug_record_parameter: no current function" msgstr "debug_record_parameter: ingen aktuell funktion" +# #: debug.c:885 msgid "debug_end_function: no current function" msgstr "debug_end_function: ingen aktuell funktion" +# #: debug.c:891 msgid "debug_end_function: some blocks were not closed" msgstr "debug_end_function: några block avslutades inte" +# #: debug.c:921 msgid "debug_start_block: no current block" -msgstr "debug_start_block: inget aktuell block" +msgstr "debug_start_block: inget aktuellt block" +# #: debug.c:959 msgid "debug_end_block: no current block" -msgstr "debug_end_block: inget aktuell block" +msgstr "debug_end_block: inget aktuellt block" +# #: debug.c:966 msgid "debug_end_block: attempt to close top level block" msgstr "debug_end_block: försök gjordes att avsluta yttersta blocket" +# #: debug.c:992 msgid "debug_record_line: no current unit" msgstr "debug_record_line: ingen aktuell kompileringsenhet" +# #. FIXME #: debug.c:1046 msgid "debug_start_common_block: not implemented" msgstr "debug_start_common_block: inte implementerat" +# #. FIXME #: debug.c:1058 msgid "debug_end_common_block: not implemented" msgstr "debug_end_common_block: inte implementerat" +# # BUGG: Kolon saknas antagligen #. FIXME. #: debug.c:1152 msgid "debug_record_label not implemented" msgstr "debug_record_label: inte implementerat" +# #: debug.c:1178 msgid "debug_record_variable: no current file" msgstr "debug_record_variable: ingen aktuell fil" +# #: debug.c:1194 msgid "debug_record_variable: no current block" msgstr "debug_record_variable: inget aktuellt block" +# #: debug.c:1764 msgid "debug_make_undefined_type: unsupported kind" msgstr "debug_make_undefined_type: sorten kan inte hanteras" +# #: debug.c:1970 msgid "debug_name_type: no current file" msgstr "debug_name_type: ingen aktuell fil" +# #: debug.c:2018 msgid "debug_tag_type: no current file" msgstr "debug_tag_type: ingen aktuell fil" +# #: debug.c:2026 msgid "debug_tag_type: extra tag attempted" msgstr "debug_tag_type: försök gjordes att sätta en extra tagg" +# #: debug.c:2066 #, c-format msgid "Warning: changing type size from %d to %d\n" msgstr "Varning: ändrar datatypens storlek från %d till %d\n" +# #: debug.c:2090 msgid "debug_find_named_type: no current compilation unit" msgstr "debug_find_named_type: ingen aktuell kompileringsenhet" +# #: debug.c:2197 #, c-format msgid "debug_get_real_type: circular debug information for %s\n" msgstr "debug_get_real_type: %s har cirkulär felsökningsinformation\n" +# #: debug.c:2662 msgid "debug_write_type: illegal type encountered" msgstr "debug_write_type: påträffade en ogiltig typ" +# #: dlltool.c:743 dlltool.c:768 dlltool.c:794 #, c-format msgid "Internal error: Unknown machine type: %d" msgstr "Internt fel: Okänd maskintyp: %d" +# #: dlltool.c:831 #, c-format msgid "Can't open def file: %s" msgstr "Kan inte öppna def-fil: %s" +# +# Här parsas def-filen bara, så den bearbetas inte #: dlltool.c:836 #, c-format msgid "Processing def file: %s" -msgstr "Bearbetar def-fil: %s" +msgstr "Behandlar def-fil: %s" +# #: dlltool.c:840 msgid "Processed def file" -msgstr "Def-filen är bearbetad" +msgstr "Def-filen är behandlad" +# #: dlltool.c:866 #, c-format msgid "Syntax error in def file %s:%d" msgstr "Syntaktiskt fel i def-fil %s:%d" +# #: dlltool.c:905 #, c-format msgid "NAME: %s base: %x" msgstr "NAME: %s bas: %x" +# #: dlltool.c:908 dlltool.c:927 msgid "Can't have LIBRARY and NAME" msgstr "Kan inte ha både LIBRARY och NAME" +# #: dlltool.c:924 #, c-format msgid "LIBRARY: %s base: %x" msgstr "LIBRARY: %s bas: %x" +# #: dlltool.c:1182 resrc.c:271 #, c-format msgid "wait: %s" msgstr "wait: %s" +# #: dlltool.c:1187 dllwrap.c:455 resrc.c:276 #, c-format msgid "subprocess got fatal signal %d" -msgstr "subprocessen fick fatal signal %d" +msgstr "barnprocessen fick fatal signal %d" +# #: dlltool.c:1193 dllwrap.c:462 resrc.c:283 #, c-format msgid "%s exited with status %d" msgstr "%s avslutade med status %d" +# #: dlltool.c:1225 #, c-format msgid "Sucking in info from %s section in %s" msgstr "Suger åt mig info från sektion %s i %s" +# #: dlltool.c:1349 #, c-format msgid "Excluding symbol: %s" msgstr "Undantar symbol: %s" +# #: dlltool.c:1444 dlltool.c:1455 nm.c:958 nm.c:969 objdump.c:383 objdump.c:400 #, c-format msgid "%s: no symbols" msgstr "%s: inga symboler" +# #. FIXME: we ought to read in and block out the base relocations #: dlltool.c:1482 #, c-format msgid "Done reading %s" msgstr "Klar med att läsa %s" +# #: dlltool.c:1493 #, c-format msgid "Unable to open object file: %s" msgstr "Kan inte öppna objektfil: %s" +# #: dlltool.c:1496 #, c-format msgid "Scanning object file %s" -msgstr "Avläser objektfil %s" +msgstr "Genomsöker objektfil %s" +# #: dlltool.c:1511 #, c-format msgid "Cannot produce mcore-elf dll from archive file: %s" msgstr "Kan inte producera en mcore-elf-dll från arkivfil: %s" +# #: dlltool.c:1603 msgid "Adding exports to output file" msgstr "Lägger till exporter till utdatafilen" +# #: dlltool.c:1648 msgid "Added exports to output file" msgstr "La till exporter till utdatafilen" +# #: dlltool.c:1772 #, c-format msgid "Generating export file: %s" msgstr "Genererar exportfil: %s" +# #: dlltool.c:1777 #, c-format msgid "Unable to open temporary assembler file: %s" msgstr "Kan inte öppna temporär assemblerfil: %s" +# #: dlltool.c:1780 #, c-format msgid "Opened temporary file: %s" msgstr "Öppnade temporär fil: %s" +# #: dlltool.c:2004 msgid "Generated exports file" msgstr "Genererade exportfil" +# #: dlltool.c:2266 #, c-format msgid "bfd_open failed open stub file: %s" msgstr "bfd_open misslyckades att öppna stubbfil: %s" +# #: dlltool.c:2269 #, c-format msgid "Creating stub file: %s" msgstr "Skapar stubbfil: %s" +# #: dlltool.c:2658 #, c-format msgid "failed to open temporary head file: %s" msgstr "misslyckades att öppna temporär huvudfil: %s" +# #: dlltool.c:2717 #, c-format msgid "failed to open temporary tail file: %s" msgstr "misslyckades att öppna temporär svansfil: %s" +# #: dlltool.c:2785 #, c-format msgid "Can't open .lib file: %s" msgstr "Kan inte öppna .lib-fil: %s" +# #: dlltool.c:2788 #, c-format msgid "Creating library file: %s" msgstr "Skapar biblioteksfil: %s" +# #: dlltool.c:2847 #, c-format msgid "cannot delete %s: %s" -msgstr "kan inte radera %s: %s" +msgstr "kan inte ta bort %s: %s" +# #: dlltool.c:2851 msgid "Created lib file" msgstr "Skapade biblioteksfilen" +# #: dlltool.c:2956 #, c-format msgid "Warning, ignoring duplicate EXPORT %s %d,%d" msgstr "Varning, ignorerar dubbel EXPORT %s %d,%d" +# #: dlltool.c:2962 #, c-format msgid "Error, duplicate EXPORT with oridinals: %s" msgstr "Fel, dubbel EXPORT med ordningstal: %s" +# +# Här bearbetas definitionerna (sorteras bl.a.) #: dlltool.c:3089 msgid "Processing definitions" msgstr "Bearbetar definitioner" +# #: dlltool.c:3127 msgid "Processed definitions" msgstr "Definitionerna är bearbetade" +# # BUGG: Kolon fattas #. xgetext:c-format #: dlltool.c:3138 dllwrap.c:519 @@ -617,44 +748,54 @@ msgstr "Definitionerna är bearbetade" msgid "Usage %s \n" msgstr "Användning: %s \n" +# #. xgetext:c-format #: dlltool.c:3140 #, c-format msgid " -m --machine Create as DLL for . [default: %s]\n" msgstr " -m --machine Skapa som DLL för . [förval: %s]\n" +# #: dlltool.c:3141 msgid " possible : arm[_interwork], i386, mcore[-elf]{-le|-be}, ppc, thumb\n" msgstr " möjliga : arm[_interwork], i386, mcore[-elf]{-le|-be}, ppc, thumb\n" +# #: dlltool.c:3142 msgid " -e --output-exp Generate an export file.\n" msgstr " -e --output-exp Generera en exportfil.\n" +# #: dlltool.c:3143 msgid " -l --output-lib Generate an interface library.\n" msgstr " -l --output-lib Generera ett gränssnittsbibliotek.\n" +# #: dlltool.c:3144 msgid " -a --add-indirect Add dll indirects to export file.\n" msgstr " -a --add-indirect Lägg till indirekta dll till exportfilen.\n" +# #: dlltool.c:3145 msgid " -D --dllname Name of input dll to put into interface lib.\n" msgstr " -D --dllname Namn på indata-dll att infoga i gränssnittsbiblioteket.\n" +# #: dlltool.c:3146 msgid " -d --input-def Name of .def file to be read in.\n" msgstr " -d --input-def Namn på .def-fil att läsa in.\n" +# #: dlltool.c:3147 msgid " -z --output-def Name of .def file to be created.\n" msgstr " -z --output-def Namn på .def-fil att skapa.\n" +# #: dlltool.c:3148 msgid " --export-all-symbols Export all symbols to .def\n" msgstr " --export-all-symbols Exportera alla symboler till .def\n" +# # Följande sträng har den beskrivande delen indenterad två tecken # extra i den engelska texten för att två flaggor är för långa. I den # svenska översättningen är de indenterade tre tecken extra för att @@ -663,6 +804,7 @@ msgstr " --export-all-symbols Exp msgid " --no-export-all-symbols Only export listed symbols\n" msgstr " --no-export-all-symbols Exportera endast anvisade symboler\n" +# # Följande sträng har den beskrivande delen indenterad två tecken # extra i den engelska texten för att två flaggor är för långa. I den # svenska översättningen är de indenterade tre tecken extra för att @@ -671,278 +813,343 @@ msgstr " --no-export-all-symbols msgid " --exclude-symbols Don't export \n" msgstr " --exclude-symbols Exportera inte symboler i \n" +# #: dlltool.c:3151 msgid " --no-default-excludes Clear default exclude symbols\n" -msgstr " --no-default-excludes Låt bli att inte exportera vissa standardsymboler\n" +msgstr " --no-default-excludes Inga automatiskt undantagna symboler\n" +# #: dlltool.c:3152 msgid " -b --base-file Read linker generated base file.\n" -msgstr " -b --base-file Läs den länkar-genererade basfilen.\n" +msgstr " -b --base-file Läs den länkargenererade basfilen.\n" +# #: dlltool.c:3153 msgid " -x --no-idata4 Don't generate idata$4 section.\n" msgstr " -x --no-idata4 Generera ingen idata$4-sektion.\n" +# #: dlltool.c:3154 msgid " -c --no-idata5 Don't generate idata$5 section.\n" msgstr " -c --no-idata5 Generera ingen idata$5-sektion.\n" +# #: dlltool.c:3155 msgid " -U --add-underscore Add underscores to symbols in interface library.\n" -msgstr " -U --add-underscore Sätt dit understreck på symboler i gränssnittsbiblioteket.\n" +msgstr " -U --add-underscore Lägg till understreck på symboler i gränssnittsbiblioteket.\n" +# #: dlltool.c:3156 msgid " -k --kill-at Kill @ from exported names.\n" msgstr " -k --kill-at Utplåna @ från exporterade namn.\n" +# #: dlltool.c:3157 msgid " -A --add-stdcall-alias Add aliases without @.\n" -msgstr " -A --add-stdcall-alias Tillför alias utan @.\n" +msgstr " -A --add-stdcall-alias Lägg till alias utan @.\n" +# #: dlltool.c:3158 msgid " -S --as Use for assembler.\n" msgstr " -S --as Använd som assemblerare.\n" +# #: dlltool.c:3159 msgid " -f --as-flags Pass to the assembler.\n" msgstr " -f --as-flags Skicka till assembleraren.\n" +# #: dlltool.c:3160 msgid " -C --compat-implib Create backward compatible import library.\n" msgstr " -C --compat-implib Skapa bakåtkompatibelt importbibliotek.\n" +# #: dlltool.c:3161 msgid " -n --no-delete Keep temp files (repeat for extra preservation).\n" msgstr " -n --no-delete Behåll temp.-filer (repetera för ökat antal).\n" +# #: dlltool.c:3162 msgid " -v --verbose Be verbose.\n" -msgstr " -v --verbose Beskriv utförligt.\n" +msgstr " -v --verbose Var mångordig.\n" +# #: dlltool.c:3163 msgid " -V --version Display the program version.\n" msgstr " -V --version Visa versionsinformation om programmet.\n" +# #: dlltool.c:3164 msgid " -h --help Display this information.\n" msgstr " -h --help Visa den här informationen.\n" +# #: dlltool.c:3166 msgid " -M --mcore-elf Process mcore-elf object files into .\n" msgstr " -M --mcore-elf Behandla mcore-elf-objektfiler till .\n" +# #: dlltool.c:3167 msgid " -L --linker Use as the linker.\n" msgstr " -L --linker Använd som länkare.\n" +# # Justeringen blir fel här för flaggan är för lång. #: dlltool.c:3168 msgid " -F --linker-flags Pass to the linker.\n" msgstr " -F --linker-flags Skicka till länkaren.\n" +# #: dlltool.c:3315 #, c-format msgid "Unable to open base-file: %s" msgstr "Kan inte öppna basfilen: %s" +# #: dlltool.c:3344 #, c-format msgid "Machine '%s' not supported" msgstr "Maskin \"%s\" hanteras inte" +# #: dlltool.c:3447 dllwrap.c:240 #, c-format msgid "Tried file: %s" msgstr "Provade fil: %s" +# #: dlltool.c:3454 dllwrap.c:247 #, c-format msgid "Using file: %s" msgstr "Använder fil: %s" +# #: dllwrap.c:334 #, c-format msgid "Keeping temporary base file %s" msgstr "Behåller temporär basfil %s" +# #: dllwrap.c:336 #, c-format msgid "Deleting temporary base file %s" msgstr "Tar bort temporär basfil %s" +# #: dllwrap.c:350 #, c-format msgid "Keeping temporary exp file %s" msgstr "Behåller temporär exportfil %s" +# #: dllwrap.c:352 #, c-format msgid "Deleting temporary exp file %s" msgstr "Tar bort temporär exportfil %s" +# #: dllwrap.c:365 #, c-format msgid "Keeping temporary def file %s" msgstr "Behåller temporär def-fil %s" +# #: dllwrap.c:367 #, c-format msgid "Deleting temporary def file %s" msgstr "Tar bort temporär def-fil %s" +# #: dllwrap.c:520 msgid " Generic options:\n" msgstr " Generella flaggor:\n" +# #: dllwrap.c:521 msgid " --quiet, -q Work quietly\n" msgstr " --quiet, -q Arbeta under tystnad\n" +# #: dllwrap.c:522 msgid " --verbose, -v Verbose\n" -msgstr " --verbose, -v Utförlig\n" +msgstr " --verbose, -v Mångordig\n" +# #: dllwrap.c:523 msgid " --version Print dllwrap version\n" msgstr " --version Visa versionsinformation för dllwrap\n" +# #: dllwrap.c:524 msgid " --implib Synonym for --output-lib\n" msgstr " --implib Synonym för --output-lib\n" +# #: dllwrap.c:525 #, c-format msgid " Options for %s:\n" msgstr " Flaggor för %s:\n" +# #: dllwrap.c:526 msgid " --driver-name Defaults to \"gcc\"\n" msgstr " --driver-name Förvald till \"gcc\"\n" +# #: dllwrap.c:527 msgid " --driver-flags Override default ld flags\n" msgstr " --driver-flags Förbigå förvalda flaggor för ld\n" +# #: dllwrap.c:528 msgid " --dlltool-name Defaults to \"dlltool\"\n" msgstr " --dlltool-name Förvalt till \"dlltool\"\n" +# #: dllwrap.c:529 msgid " --entry Specify alternate DLL entry point\n" -msgstr " --entry Ge alternativ ingångspunkt i DLL:en\n" +msgstr " --entry Ange alternativ ingångspunkt i DLL:en\n" +# #: dllwrap.c:530 msgid " --image-base Specify image base address\n" -msgstr " --image-base Ge bildens basadress\n" +msgstr " --image-base Ange bildens basadress\n" +# #: dllwrap.c:531 msgid " --target i386-cygwin32 or i386-mingw32\n" msgstr " --target i386-cygwin32 eller i386-mingw32\n" +# #: dllwrap.c:532 msgid " --dry-run Show what needs to be run\n" msgstr " --dry-run Gör inget annat än att visa vad som måste köras\n" +# #: dllwrap.c:533 msgid " --mno-cygwin Create Mingw DLL\n" msgstr " --mno-cygwin Skapa Mingw-DLL\n" +# #: dllwrap.c:534 msgid " Options passed to DLLTOOL:\n" msgstr " Flaggor som skickas till DLLVERKTYG:\n" +# #: dllwrap.c:535 msgid " --machine \n" msgstr " --machine \n" +# #: dllwrap.c:536 msgid " --output-exp Generate export file.\n" msgstr " --output-exp Generera exportfil.\n" +# #: dllwrap.c:537 msgid " --output-lib Generate input library.\n" msgstr " --output-lib Generera indatabibliotek.\n" +# #: dllwrap.c:538 msgid " --add-indirect Add dll indirects to export file.\n" msgstr " --add-indirect Lägg till indirekta dll till exportfilen.\n" +# #: dllwrap.c:539 msgid " --dllname Name of input dll to put into output lib.\n" msgstr " --dllname Namn på indata-dll som ska infogas i utdatabiblioteket.\n" +# #: dllwrap.c:540 msgid " --def Name input .def file\n" msgstr " --def Namnge .def-indatafilen\n" +# #: dllwrap.c:541 msgid " --output-def Name output .def file\n" msgstr " --output-def Namnge .def-utdatafilen\n" +# #: dllwrap.c:542 msgid " --export-all-symbols Export all symbols to .def\n" msgstr " --export-all-symbols Exportera alla symboler till .def\n" +# #: dllwrap.c:543 msgid " --no-export-all-symbols Only export .drectve symbols\n" msgstr " --no-export-all-symbols Exportera endast .drectve-symboler\n" +# #: dllwrap.c:544 msgid " --exclude-symbols Exclude from .def\n" msgstr " --exclude-symbols Undanta symbolerna i från .def\n" +# #: dllwrap.c:545 msgid " --no-default-excludes Zap default exclude symbols\n" -msgstr " --no-default-excludes Bortse från förvalt undantagna symboler\n" +msgstr " --no-default-excludes Inga automatiskt undantagna symboler\n" +# #: dllwrap.c:546 msgid " --base-file Read linker generated base file\n" msgstr " --base-file Läs länkargenererad basfil\n" +# #: dllwrap.c:547 msgid " --no-idata4 Don't generate idata$4 section\n" msgstr " --no-idata4 Generera ingen idata$4-sektion\n" +# #: dllwrap.c:548 msgid " --no-idata5 Don't generate idata$5 section\n" msgstr " --no-idata5 Generera ingen idata$5-sektion\n" +# #: dllwrap.c:549 msgid " -U Add underscores to .lib\n" -msgstr " -U Sätt dit understreck i .lib\n" +msgstr " -U Lägg till understreck i .lib\n" +# #: dllwrap.c:550 msgid " -k Kill @ from exported names\n" msgstr " -k Utplåna @ från exporterade namn\n" +# #: dllwrap.c:551 msgid " --add-stdcall-alias Add aliases without @\n" -msgstr " --add-stdcall-alias Tillför alias utan @\n" +msgstr " --add-stdcall-alias Lägg till alias utan @\n" +# #: dllwrap.c:552 msgid " --as Use for assembler\n" msgstr " --as Använd som assemblerare\n" +# #: dllwrap.c:553 msgid " --nodelete Keep temp files.\n" msgstr " --nodelete Behåll temporära filer.\n" +# #: dllwrap.c:554 msgid " Rest are passed unmodified to the language driver\n" msgstr " Övriga flaggor skickas oförändrade till programspråksenheten\n" +# #: dllwrap.c:824 msgid "Must provide at least one of -o or --dllname options" -msgstr "Tillför minst en av flaggorna -o eller --dllname" +msgstr "Ange minst en av flaggorna -o eller --dllname" +# #: dllwrap.c:852 msgid "" "no export definition file provided.\n" "Creating one, but that may not be what you want" msgstr "" -"ingen export-definitionsfil gavs.\n" +"ingen export-definitionsfil angavs.\n" "En sådan skapas, men det är kanske inte vad du vill" +# # Indenteringen är ökad för att översättningen ska få plats framför # kolonet på alla 4 strängar. #: dllwrap.c:1014 @@ -950,6 +1157,7 @@ msgstr "" msgid "DLLTOOL name : %s\n" msgstr "DLLVERKTYG namn : %s\n" +# # Indenteringen är ökad för att översättningen ska få plats framför # kolonet på alla 4 strängar. #: dllwrap.c:1015 @@ -957,370 +1165,456 @@ msgstr "DLLVERKTYG namn : %s\n" msgid "DLLTOOL options : %s\n" msgstr "DLLVERKTYG flaggor: %s\n" +# # Indenteringen är ökad för att översättningen ska få plats framför # kolonet på alla 4 strängar. #: dllwrap.c:1016 #, c-format msgid "DRIVER name : %s\n" -msgstr "ENHET namn : %s\n" +msgstr "DRIVRUTIN namn : %s\n" +# # Indenteringen är ökad för att översättningen ska få plats framför # kolonet på alla 4 strängar. #: dllwrap.c:1017 #, c-format msgid "DRIVER options : %s\n" -msgstr "ENHET flaggor : %s\n" +msgstr "DRIVRUTIN flaggor : %s\n" +# #: ieee.c:317 msgid "unexpected end of debugging information" msgstr "oväntat slut på felsökningsinformationen" +# #: ieee.c:412 msgid "invalid number" msgstr "ogiltigt tal" +# #: ieee.c:471 msgid "invalid string length" msgstr "ogiltig stränglängd" +# #: ieee.c:528 ieee.c:569 msgid "expression stack overflow" msgstr "överspill i uttrycksstacken" +# #: ieee.c:548 msgid "unsupported IEEE expression operator" msgstr "IEEE-uttrycksoperator som inte stöds" +# #: ieee.c:563 msgid "unknown section" msgstr "okänd sektion" +# #: ieee.c:584 msgid "expression stack underflow" msgstr "underspill i uttrycksstacken" +# #: ieee.c:598 msgid "expression stack mismatch" msgstr "felbalanserad uttrycksstack" +# #: ieee.c:637 msgid "unknown builtin type" msgstr "okänd inbyggd typ" +# #: ieee.c:782 msgid "BCD float type not supported" msgstr "flyttalstyp BCD stöds inte" +# #: ieee.c:928 msgid "unexpected number" msgstr "oväntat tal" +# #: ieee.c:935 msgid "unexpected record type" msgstr "oväntad posttyp" +# #: ieee.c:968 msgid "blocks left on stack at end" msgstr "block kvar på stacken på slutet" +# #: ieee.c:1233 msgid "unknown BB type" msgstr "okänd BB-typ" +# #: ieee.c:1242 msgid "stack overflow" msgstr "överspill i stacken" +# #: ieee.c:1267 msgid "stack underflow" msgstr "underspill i stacken" +# #: ieee.c:1381 ieee.c:1453 ieee.c:2152 msgid "illegal variable index" msgstr "otillåtet variabelindex" +# #: ieee.c:1431 msgid "illegal type index" msgstr "otillåtet typindex" +# #: ieee.c:1441 ieee.c:1478 msgid "unknown TY code" msgstr "okänd TY-kod" +# #: ieee.c:1460 msgid "undefined variable in TY" msgstr "odefinierad variabel i TY" +# #. Pascal file name. FIXME. #: ieee.c:1871 msgid "Pascal file name not supported" msgstr "Pascal-filnamn stöds inte" +# # BUGG: qualif>i in-file [out-file]\n" msgstr "Användning: %s indatafil [utdatafil]\n" +# #: objcopy.c:364 objcopy.c:433 msgid " The options are:\n" msgstr " Flaggorna är:\n" +# #: objcopy.c:365 msgid "" " -I --input-target Assume input file is in format \n" @@ -1681,11 +2005,13 @@ msgstr "" " -V --version Visa programmets versionsinformation\n" " -h --help Visa denna hjälp\n" +# #: objcopy.c:432 #, c-format msgid "Usage: %s in-file(s)\n" msgstr "Användning: %s indatafil(er)\n" +# #: objcopy.c:434 msgid "" " -I --input-target Assume input file is in format \n" @@ -1722,215 +2048,261 @@ msgstr "" " -h --help Visa denna hjälp\n" " -o Spara den utrensade utdatan i \n" +# #: objcopy.c:504 #, c-format msgid "unrecognized section flag `%s'" msgstr "okänd sektionsflagga \"%s\"" +# #: objcopy.c:505 #, c-format msgid "supported flags: %s" msgstr "flaggor som hanteras: %s" +# #: objcopy.c:582 objcopy.c:2206 #, c-format msgid "cannot stat: %s: %s" msgstr "kan inte ta status: %s: %s" +# #: objcopy.c:589 objcopy.c:2224 #, c-format msgid "cannot open: %s: %s" msgstr "kan inte öppna: %s: %s" +# #: objcopy.c:592 objcopy.c:2228 #, c-format msgid "%s: fread failed" msgstr "%s: fread misslyckades" +# #: objcopy.c:665 #, c-format msgid "Ignoring rubbish found on line %d of %s" msgstr "Ignorerar skräp hittat på rad %d i %s" +# #: objcopy.c:886 #, c-format msgid "%s: Multiple redefinition of symbol \"%s\"" msgstr "%s: Flera omdefinieringar av symbol \"%s\"" +# #: objcopy.c:891 #, c-format msgid "%s: Symbol \"%s\" is target of more than one redefinition" msgstr "%s: Symbol \"%s\" är mål för mer än en omdefiniering" +# #: objcopy.c:943 msgid "Unable to change endianness of input file(s)" msgstr "Kan inte ändra endian-typ på indatafilen(erna)" +# #: objcopy.c:951 #, c-format msgid "copy from %s(%s) to %s(%s)\n" msgstr "kopierar från %s(%s) till %s(%s)\n" +# #: objcopy.c:975 #, c-format msgid "Warning: Output file cannot represent architecture %s" msgstr "Varning: Utdatafilen kan inte representera arkitektur %s" +# #: objcopy.c:1002 #, c-format msgid "can't create section `%s': %s" msgstr "kan inte skapa sektion \"%s\": %s" +# #: objcopy.c:1088 #, c-format msgid "Can't fill gap after %s: %s" msgstr "Kan inte fylla luckan efter %s: %s" +# #: objcopy.c:1113 #, c-format msgid "Can't add padding to %s: %s" msgstr "Kan inte fylla ut efter %s: %s" +# #: objcopy.c:1252 #, c-format msgid "%s: error copying private BFD data: %s" msgstr "%s: fel vid kopiering av privat BFD-data: %s" +# #: objcopy.c:1265 msgid "unknown alternate machine code, ignored" msgstr "okänd alternativ maskinkod, ignorerad" +# #: objcopy.c:1295 #, c-format msgid "cannot mkdir %s for archive copying (error: %s)" msgstr "kan inte skapa katalog %s för arkivkopiering (fel: %s)" +# #: objcopy.c:1466 #, c-format msgid "Multiple renames of section %s" msgstr "Flera namnbyten på sektion %s" +# #: objcopy.c:1550 msgid "making" msgstr "tillverkning" +# #: objcopy.c:1559 msgid "size" msgstr "storlek" +# #: objcopy.c:1573 msgid "vma" msgstr "vma" +# #: objcopy.c:1599 msgid "alignment" msgstr "jämn gräns" +# #: objcopy.c:1607 msgid "flags" msgstr "flaggor" +# #: objcopy.c:1624 msgid "private data" msgstr "privat data" +# #: objcopy.c:1632 #, c-format msgid "%s: section `%s': error in %s: %s" msgstr "%s: sektion \"%s\": fel på %s: %s" +# #: objcopy.c:1910 #, c-format msgid "%s: can't create debugging section: %s" msgstr "%s: kan inte skapa felsökningssektion: %s" +# #: objcopy.c:1925 #, c-format msgid "%s: can't set debugging section contents: %s" msgstr "%s: kan inte sätta innehållet i felsökningssektionen: %s" +# #: objcopy.c:1934 #, c-format msgid "%s: don't know how to write debugging information for %s" msgstr "%s: vet inte hur man skriver felsökningsinformation för %s" +# #: objcopy.c:2041 #, c-format msgid "%s: cannot stat: %s" msgstr "%s: kan inte ta status: %s" +# #: objcopy.c:2092 msgid "byte number must be non-negative" -msgstr "byte-nr får inte vara negativt" +msgstr "bytenummer får inte vara negativt" +# #: objcopy.c:2102 msgid "interleave must be positive" msgstr "intervallstorleken måste vara positiv" +# #: objcopy.c:2122 objcopy.c:2130 #, c-format msgid "%s both copied and removed" msgstr "%s både kopierad och borttagen" -#: objcopy.c:2203 objcopy.c:2273 objcopy.c:2373 objcopy.c:2400 objcopy.c:2424 objcopy.c:2428 objcopy.c:2448 +# +#: objcopy.c:2203 objcopy.c:2273 objcopy.c:2373 objcopy.c:2400 objcopy.c:2424 +#: objcopy.c:2428 objcopy.c:2448 #, c-format msgid "bad format for %s" msgstr "felaktigt format på %s" +# #: objcopy.c:2342 #, c-format msgid "Warning: truncating gap-fill from 0x%s to 0x%x" msgstr "Varning: kortar av utfyllnadsvärdet från 0x%s till 0x%x" +# #: objcopy.c:2494 msgid "alternate machine code index must be positive" msgstr "index för alternativ maskinkod måste vara positivt" +# #: objcopy.c:2512 msgid "byte number must be less than interleave" -msgstr "byte-nr måste vara mindre än antalet byte i intervallet" +msgstr "bytenummer måste vara mindre än antalet byte i intervallet" +# #: objcopy.c:2539 #, c-format msgid "architecture %s unknown" msgstr "arkitektur %s är okänd" +# #: objcopy.c:2543 msgid "Warning: input target 'binary' required for binary architecture parameter." -msgstr "Varning: indata måste ha formatet 'binary' för binärarkitektursparametrar." +msgstr "Varning: indata måste ha formatet \"binary\" för binärarkitektursparametern." +# #: objcopy.c:2544 #, c-format msgid " Argument %s ignored" msgstr " Argument %s ignoreras" +# #: objcopy.c:2550 #, c-format msgid "Cannot stat: %s: %s" msgstr "Kan inte ta status: %s: %s" +# #: objcopy.c:2590 objcopy.c:2604 #, c-format msgid "%s %s%c0x%s never used" msgstr "%s %s%c0x%s användes aldrig" +# #: objdump.c:164 #, c-format msgid "Usage: %s OPTION... FILE...\n" -msgstr "Användning: %s FLAGGOR... FIL...\n" +msgstr "Användning: %s FLAGGA... FIL...\n" +# #: objdump.c:165 msgid "Display information from object FILE.\n" msgstr "Visa information från en objektFIL.\n" +# #: objdump.c:166 msgid "" "\n" " At least one of the following switches must be given:\n" msgstr "" "\n" -" Minst en av följande flaggor måste ges:\n" +" Minst en av följande flaggor måste anges:\n" +# #: objdump.c:167 msgid "" " -a, --archive-headers Display archive header information\n" @@ -1971,6 +2343,7 @@ msgstr "" " -i, --info Lista de objektformat och arkitekturer som hanteras\n" " -H, --help Visa denna hjälp\n" +# #: objdump.c:189 msgid "" "\n" @@ -1979,6 +2352,7 @@ msgstr "" "\n" " Följande flaggor är frivilliga:\n" +# #: objdump.c:190 msgid "" " -b, --target=BFDNAME Specify the target object format as BFDNAME\n" @@ -2001,8 +2375,8 @@ msgid "" " --adjust-vma=OFFSET Add OFFSET to all displayed section addresses\n" "\n" msgstr "" -" -b, --target=BFDNAMN Specificera att målobjektets format är BFDNAMN\n" -" -m, --architecture=MASKIN Specificera att målarkitekturen är MASKIN\n" +" -b, --target=BFDNAMN Ange att målobjektets format är BFDNAMN\n" +" -m, --architecture=MASKIN Ange att målarkitekturen är MASKIN\n" " -j, --section=NAMN Visa endast information om sektion NAMN\n" " -M, --disassembler-options=FLG Skicka vidare FLG till disassembleraren\n" " -EB --endian=big Antag big endian-format vid disassemblering\n" @@ -2010,7 +2384,7 @@ msgstr "" " --file-start-context Ta med omgivningen i början av filen (med -S)\n" " -l, --line-numbers Ta med radnummer och filnamn i utdatan\n" " -C, --demangle[=STIL] Avkoda kodade symbolnamn\n" -" STIL, om givet, kan vara: \"auto\", \"gnu\",\n" +" STIL, om angivet, kan vara: \"auto\", \"gnu\",\n" " \"lucid\", \"arm\", \"hp\", \"edg\", \"gnu-new-abi\"\n" " -w, --wide Anpassa utdatan för mer än 80 kolumner\n" " -z, --disassemble-zeroes Hoppa inte över block av nollor vid\n" @@ -2022,51 +2396,62 @@ msgstr "" " --adjust-vma=OFFSET Lägg till OFFSET till alla visade sektionsadresser\n" "\n" +# #: objdump.c:359 msgid "Sections:\n" msgstr "Sektioner:\n" +# #: objdump.c:362 msgid "Idx Name Size VMA LMA File off Algn" msgstr "Idx Namn Storlek VMA LMA Filoffs Just" +# #: objdump.c:364 msgid "Idx Name Size VMA LMA File off Algn" msgstr "Idx Namn Storlek VMA LMA Filoffs Just" +# #: objdump.c:368 msgid " Flags" msgstr " Flaggor" +# #: objdump.c:418 #, c-format msgid "%s: not a dynamic object" msgstr "%s: inte ett dynamiskt objekt" +# #: objdump.c:434 #, c-format msgid "%s: No dynamic symbols" msgstr "%s: Inga dynamiska symboler" +# #: objdump.c:1124 msgid "Out of virtual memory" msgstr "Slut på virtuellt minne" +# #: objdump.c:1553 #, c-format msgid "Can't use supplied machine %s" msgstr "Kan inte använda den tillhandahållna maskinen %s" +# #: objdump.c:1571 #, c-format msgid "Can't disassemble for architecture %s\n" msgstr "Kan inte disassemblera för arkitektur %s\n" +# #: objdump.c:1653 #, c-format msgid "Disassembly of section %s:\n" msgstr "Disassemblering av sektion %s:\n" +# #: objdump.c:1828 #, c-format msgid "" @@ -2076,21 +2461,25 @@ msgstr "" "Det finns ingen %s-sektion\n" "\n" +# #: objdump.c:1835 #, c-format msgid "%s has no %s section" msgstr "%s har ingen %s-sektion" +# #: objdump.c:1849 #, c-format msgid "Reading %s section of %s failed: %s" msgstr "Läsa %s-sektionen i %s misslyckades: %s" +# #: objdump.c:1861 #, c-format msgid "Reading %s section of %s failed: %s\n" msgstr "Läsa %s-sektionen i %s misslyckades: %s\n" +# #: objdump.c:1904 #, c-format msgid "" @@ -2100,16 +2489,19 @@ msgstr "" "Innehåll i %s-sektionen:\n" "\n" +# #: objdump.c:2004 #, c-format msgid "architecture: %s, " msgstr "arkitektur: %s, " +# #: objdump.c:2007 #, c-format msgid "flags 0x%08x:\n" msgstr "flaggor 0x%08x:\n" +# #: objdump.c:2020 msgid "" "\n" @@ -2118,6 +2510,7 @@ msgstr "" "\n" "startadress 0x" +# #: objdump.c:2052 #, c-format msgid "" @@ -2127,396 +2520,485 @@ msgstr "" "\n" "%s: filformat %s\n" +# #: objdump.c:2094 #, c-format msgid "%s: printing debugging information failed" msgstr "%s: visa felsökningsinformationen misslyckades" +# #: objdump.c:2171 #, c-format msgid "In archive %s:\n" msgstr "I arkiv %s:\n" +# #: objdump.c:2223 #, c-format msgid "Contents of section %s:\n" msgstr "Innehåll i %s-sektionen:\n" +# #: objdump.c:2736 #, c-format msgid "BFD header file version %s\n" msgstr "BFD-huvudfil version %s\n" +# #: objdump.c:2825 msgid "unrecognized -E option" msgstr "okänd -E-flagga" +# #: objdump.c:2836 #, c-format msgid "unrecognized --endian type `%s'" msgstr "okänd --endian-typ \"%s\"" +# #: rdcoff.c:205 #, c-format msgid "parse_coff_type: Bad type code 0x%x" msgstr "parse_coff_type: Felaktig typkod 0x%x" +# #: rdcoff.c:423 rdcoff.c:531 rdcoff.c:730 #, c-format msgid "bfd_coff_get_syment failed: %s" msgstr "bfd_coff_get_syment misslyckades: %s" +# #: rdcoff.c:439 rdcoff.c:750 #, c-format msgid "bfd_coff_get_auxent failed: %s" msgstr "bfd_coff_get_auxent misslyckades: %s" +# #: rdcoff.c:817 #, c-format msgid "%ld: .bf without preceding function" msgstr "%ld: .bf saknar inledande funktion" +# #: rdcoff.c:867 #, c-format msgid "%ld: unexpected .ef\n" msgstr "%ld: oväntad .ef\n" +# #: rddbg.c:87 #, c-format msgid "%s: no recognized debugging information" msgstr "%s: ingen känd felsökningsinformation" +# #: rddbg.c:410 msgid "Last stabs entries before error:\n" msgstr "De sista stabs-posterna innan felet:\n" +# #: readelf.c:318 #, c-format msgid "%s: Error: " msgstr "%s: Fel: " +# #: readelf.c:329 #, c-format msgid "%s: Warning: " msgstr "%s: Varning: " +# #: readelf.c:351 #, c-format msgid "Unable to seek to %x for %s\n" msgstr "Kan inte uppsöka %2$s på %1$x\n" +# #: readelf.c:362 #, c-format msgid "Out of memory allocating %d bytes for %s\n" msgstr "Slut på minne vid allokering av %d byte för %s\n" +# #: readelf.c:370 #, c-format msgid "Unable to read in %d bytes of %s\n" -msgstr "Kan inte läsa in %d byte %s\n" +msgstr "Kan inte läsa in %d byte från %s\n" +# #: readelf.c:423 readelf.c:581 #, c-format msgid "Unhandled data length: %d\n" msgstr "Storlek på data som inte kan behandlas: %d\n" +# #: readelf.c:660 msgid "Don't know about relocations on this machine architecture\n" msgstr "Vet inte hur man omlokaliserar på den här maskinarkitekturen\n" +# #: readelf.c:682 readelf.c:711 readelf.c:757 readelf.c:784 msgid "relocs" msgstr "omlokaliseringar" +# #: readelf.c:693 readelf.c:722 readelf.c:767 readelf.c:794 msgid "out of memory parsing relocs" msgstr "slut på minne vid tolkning av omlokaliseringar" +# #: readelf.c:845 msgid " Offset Info Type Symbol's Value Symbol's Name Addend\n" msgstr " Offset Info Typ Symbolvärde Symbolnamn Tillägg\n" +# #: readelf.c:848 msgid " Offset Info Type Symbol's Value Symbol's Name\n" msgstr " Offset Info Typ Symbolvärde Symbolnamn\n" +# #: readelf.c:854 msgid " Offset Info Type Symbol's Value Symbol's Name Addend\n" msgstr " Offset Info Typ Symbolvärde Symbolnamn Tillägg\n" +# #: readelf.c:857 msgid " Offset Info Type Symbol's Value Symbol's Name\n" msgstr " Offset Info Typ Symbolvärde Symbolnamn\n" +# #: readelf.c:1061 readelf.c:1063 #, c-format msgid "unrecognised: %-7lx" msgstr "okänd: %-7lx" +# #: readelf.c:1085 #, c-format msgid "" msgstr "" +# #: readelf.c:1315 #, c-format msgid "Processor Specific: %lx" msgstr "processorspecifik: %lx" +# #: readelf.c:1334 #, c-format msgid "Operating System specific: %lx" msgstr "operativsystemsspecifik: %lx" +# #: readelf.c:1337 readelf.c:1961 #, c-format msgid ": %lx" msgstr ": %lx" +# #: readelf.c:1351 msgid "NONE (None)" msgstr "NONE (ingen)" +# #: readelf.c:1352 msgid "REL (Relocatable file)" msgstr "REL (omlokaliseringsbar fil)" +# #: readelf.c:1353 msgid "EXEC (Executable file)" msgstr "EXEC (exekverbar fil)" +# #: readelf.c:1354 msgid "DYN (Shared object file)" msgstr "DYN (delad objektfil)" +# #: readelf.c:1355 msgid "CORE (Core file)" msgstr "CORE (minnesfil)" +# #: readelf.c:1359 #, c-format msgid "Processor Specific: (%x)" msgstr "processorspecifik: (%x)" +# #: readelf.c:1361 #, c-format msgid "OS Specific: (%x)" msgstr "OS-specifik: (%x)" +# #: readelf.c:1363 readelf.c:1460 readelf.c:2112 #, c-format msgid ": %x" msgstr ": %x" +# #: readelf.c:1376 msgid "None" msgstr "ingen" +# #: readelf.c:2152 msgid "Usage: readelf {options} elf-file(s)\n" msgstr "Användning: readelf {flaggor} elf-fil(er)\n" +# #: readelf.c:2153 msgid " Options are:\n" msgstr " Flaggorna är:\n" +# #: readelf.c:2154 msgid " -a or --all Equivalent to: -h -l -S -s -r -d -V -A -I\n" msgstr " -a eller --all Samma som: -h -l -S -s -r -d -V -A -I\n" +# #: readelf.c:2155 msgid " -h or --file-header Display the ELF file header\n" msgstr " -h eller --file-header Visa ELF-filens huvud\n" +# #: readelf.c:2156 msgid " -l or --program-headers or --segments\n" msgstr " -l eller --program-headers eller --segments\n" +# #: readelf.c:2157 msgid " Display the program headers\n" msgstr " Visa programhuvudena\n" +# #: readelf.c:2158 msgid " -S or --section-headers or --sections\n" msgstr " -S eller --section-headers eller --sections\n" +# #: readelf.c:2159 msgid " Display the sections' header\n" msgstr " Visa sektionernas huvud\n" +# #: readelf.c:2160 msgid " -e or --headers Equivalent to: -h -l -S\n" msgstr " -e eller --headers Samma som: -h -l -S\n" +# #: readelf.c:2161 msgid " -s or --syms or --symbols Display the symbol table\n" msgstr "" " -s eller --syms eller --symbols\n" " Visa symboltabellen\n" +# #: readelf.c:2162 msgid " -n or --notes Display the core notes (if present)\n" msgstr " -n eller --notes Visa kommentarer från minnesutskriften (om de finns)\n" +# #: readelf.c:2163 msgid " -r or --relocs Display the relocations (if present)\n" msgstr " -r eller --relocs Visa omlokaliseringsinformationen (om den finns)\n" +# #: readelf.c:2164 msgid " -u or --unwind Display the unwind info (if present)\n" msgstr " -u eller --unwind Visa tillbakarullningsinformation (om den finns)\n" +# #: readelf.c:2165 msgid " -d or --dynamic Display the dynamic segment (if present)\n" -msgstr " -d eller --dynamic Visa det dynamiska segmentet (om det finns)\n" +msgstr " -d eller --dynamic Visa det dynamiska segmentet (om det finns)\n" +# #: readelf.c:2166 msgid " -V or --version-info Display the version sections (if present)\n" msgstr " -V eller --version-info Visa versionssektionen (om den finns)\n" +# #: readelf.c:2167 msgid " -A or --arch-specific Display architecture specific information (if any).\n" msgstr " -A eller --arch-specific Visa arkitekturspecifik information (om den finns)\n" +# #: readelf.c:2168 msgid " -D or --use-dynamic Use the dynamic section info when displaying symbols\n" msgstr " -D eller --use-dynamic Använd den dynamiska sektionen för att visa symboler\n" +# #: readelf.c:2169 msgid " -x or --hex-dump=\n" msgstr " -x eller --hex-dump=\n" +# #: readelf.c:2170 msgid " Dump the contents of section \n" msgstr " Visa innehållet i sektion \n" +# #: readelf.c:2171 msgid " -w[liaprmfs] or --debug-dump[=line,=info,=abbrev,=pubnames,=ranges,=macro,=frames,=str]\n" msgstr " -w[liaprmfs] eller --debug-dump[=line,=info,=abbrev,=pubnames,=ranges,=macro,=frames,=str]\n" +# #: readelf.c:2172 msgid " Display the contents of DWARF2 debug sections\n" msgstr " Visa innehållet i DWARF2-felsökningssektioner\n" +# #: readelf.c:2174 msgid " -i or --instruction-dump=\n" msgstr " -i eller --instruction-dump=\n" +# #: readelf.c:2175 msgid " Disassemble the contents of section \n" msgstr " Disassemblera innehållet i sektion \n" +# #: readelf.c:2177 msgid " -I or --histogram Display histogram of bucket list lengths\n" msgstr " -I eller --histogram Visa ett histogram över hinkarnas listlängder\n" +# #: readelf.c:2178 msgid " -v or --version Display the version number of readelf\n" msgstr " -v eller --version Visa versionsinformation om readelf\n" +# #: readelf.c:2179 msgid " -W or --wide Don't split lines or truncate symbols to fit into 80 columns\n" msgstr " -W eller --wide Bryt inga rader och kapa inga symboler för att passa 80 kolumner\n" +# #: readelf.c:2180 msgid " -H or --help Display this information\n" msgstr " -H eller --help Visa denna hjälp\n" +# #: readelf.c:2198 msgid "Out of memory allocating dump request table." msgstr "Slut på minne vid allokering av tabell för önskade utskrifter." +# #: readelf.c:2357 #, c-format msgid "Unrecognised debug option '%s'\n" msgstr "Okänt felsökningsargument \"%s\"\n" +# #: readelf.c:2385 #, c-format msgid "Invalid option '-%c'\n" msgstr "Ogiltig flagga \"-%c\"\n" +# #: readelf.c:2398 msgid "Nothing to do.\n" msgstr "Inget att göra.\n" +# #: readelf.c:2411 readelf.c:2428 readelf.c:4700 msgid "none" msgstr "ingen" +# #: readelf.c:2415 readelf.c:2432 readelf.c:2460 #, c-format msgid "" msgstr "" +# #: readelf.c:2429 msgid "2's complement, little endian" -msgstr "2-komplement, little endian" +msgstr "tvåkomplement, little endian" +# #: readelf.c:2430 msgid "2's complement, big endian" -msgstr "2-komplement, big endian" +msgstr "tvåkomplement, big endian" +# #: readelf.c:2457 msgid "Standalone App" -msgstr "Självständig app." +msgstr "Självständigt program" +# #: readelf.c:2475 msgid "Not an ELF file - it has the wrong magic bytes at the start\n" msgstr "Inte en ELF-fil - den har fel magiska byte i början\n" +# #: readelf.c:2483 msgid "ELF Header:\n" msgstr "ELF-huvud:\n" +# #: readelf.c:2484 msgid " Magic: " msgstr " Magi: " +# #: readelf.c:2488 #, c-format msgid " Class: %s\n" msgstr " Klass: %s\n" +# #: readelf.c:2490 #, c-format msgid " Data: %s\n" msgstr " Data: %s\n" +# #: readelf.c:2492 #, c-format msgid " Version: %d %s\n" msgstr " Version: %d %s\n" +# #: readelf.c:2499 #, c-format msgid " OS/ABI: %s\n" msgstr " OS/ABI: %s\n" +# #: readelf.c:2501 #, c-format msgid " ABI Version: %d\n" msgstr " ABI-version: %d\n" +# #: readelf.c:2503 #, c-format msgid " Type: %s\n" msgstr " Typ: %s\n" +# #: readelf.c:2505 #, c-format msgid " Machine: %s\n" msgstr " Maskin: %s\n" +# #: readelf.c:2507 #, c-format msgid " Version: 0x%lx\n" msgstr " Version: 0x%lx\n" +# #: readelf.c:2510 msgid " Entry point address: " msgstr " Ingångsadress: " +# #: readelf.c:2512 msgid "" "\n" @@ -2525,6 +3007,7 @@ msgstr "" "\n" " Start för programhuvuden: " +# #: readelf.c:2514 msgid "" " (bytes into file)\n" @@ -2533,49 +3016,59 @@ msgstr "" " (byte in i filen)\n" " Start för sektionshuvuden: " +# #: readelf.c:2516 msgid " (bytes into file)\n" msgstr " (byte in i filen)\n" +# #: readelf.c:2518 #, c-format msgid " Flags: 0x%lx%s\n" msgstr " Flaggor: 0x%lx%s\n" +# #: readelf.c:2521 #, c-format msgid " Size of this header: %ld (bytes)\n" msgstr " Detta huvuds storlek: %ld (byte)\n" +# #: readelf.c:2523 #, c-format msgid " Size of program headers: %ld (bytes)\n" msgstr " Programhuvudenas storlek: %ld (byte)\n" +# #: readelf.c:2525 #, c-format msgid " Number of program headers: %ld\n" msgstr " Antal programhuvuden: %ld\n" +# #: readelf.c:2527 #, c-format msgid " Size of section headers: %ld (bytes)\n" msgstr " Sektionshuvudenas storlek: %ld (byte)\n" +# #: readelf.c:2529 #, c-format msgid " Number of section headers: %ld" msgstr " Antal sektionshuvuden: %ld" +# #: readelf.c:2534 #, c-format msgid " Section header string table index: %ld" msgstr " Sektionshuvudets strängtabellsndx: %ld" +# #: readelf.c:2568 readelf.c:2604 msgid "program headers" msgstr "programhuvuden" +# #: readelf.c:2638 msgid "" "\n" @@ -2584,6 +3077,7 @@ msgstr "" "\n" "Det finns inga programhuvuden i denna fil.\n" +# #: readelf.c:2644 #, c-format msgid "" @@ -2593,10 +3087,12 @@ msgstr "" "\n" "Elf-filtyp är %s\n" +# #: readelf.c:2645 msgid "Entry point " msgstr "Ingångspunkt " +# #: readelf.c:2647 #, c-format msgid "" @@ -2606,10 +3102,14 @@ msgstr "" "\n" "Det finns %d programhuvuden, med början på offset " -#: readelf.c:2658 readelf.c:2883 readelf.c:2929 readelf.c:2992 readelf.c:3059 readelf.c:4087 readelf.c:4130 readelf.c:4310 readelf.c:5246 readelf.c:5260 readelf.c:9246 readelf.c:9286 +# +#: readelf.c:2658 readelf.c:2883 readelf.c:2929 readelf.c:2992 readelf.c:3059 +#: readelf.c:4087 readelf.c:4130 readelf.c:4310 readelf.c:5246 readelf.c:5260 +#: readelf.c:9246 readelf.c:9286 msgid "Out of memory\n" msgstr "Slut på minne\n" +# # BUGG: plural-s #: readelf.c:2676 #, c-format @@ -2620,30 +3120,37 @@ msgstr "" "\n" "Programhuvud%0.s:\n" +# #: readelf.c:2680 msgid " Type Offset VirtAddr PhysAddr FileSiz MemSiz Flg Align\n" msgstr " Typ Offset VirtAdr FysAdr FilSt MinneSt Flg Just\n" +# #: readelf.c:2683 msgid " Type Offset VirtAddr PhysAddr FileSiz MemSiz Flg Align\n" -msgstr " Typ Offset VirtAdr FysAdr FilStrl MinneSt Flg Just\n" +msgstr " Typ Offset VirtAdress FysAdress FilStrl MinneSt Flg Just\n" +# #: readelf.c:2687 msgid " Type Offset VirtAddr PhysAddr\n" -msgstr " Typ Offset VirtAdr FysAdr\n" +msgstr " Typ Offset VirtAdress FysAdress\n" +# #: readelf.c:2689 msgid " FileSiz MemSiz Flags Align\n" -msgstr " FilStrl MinneStrl Flagg Just\n" +msgstr " FilStorlek MinneStorlek Flagg Justering\n" +# #: readelf.c:2789 msgid "more than one dynamic segment\n" msgstr "mer än ett dynamiskt segment\n" +# #: readelf.c:2797 msgid "Unable to find program interpreter name\n" msgstr "Kan inte hitta namnet på programtolken\n" +# #: readelf.c:2804 #, c-format msgid "" @@ -2653,6 +3160,7 @@ msgstr "" "\n" " [Begär programtolkare: %s]" +# #: readelf.c:2822 msgid "" "\n" @@ -2661,22 +3169,27 @@ msgstr "" "\n" " Sektion till segment-avbildning:\n" +# #: readelf.c:2823 msgid " Segment Sections...\n" msgstr " Segmentsektioner...\n" +# #: readelf.c:2874 readelf.c:2920 msgid "section headers" msgstr "sektionshuvuden" +# #: readelf.c:2968 readelf.c:3035 msgid "symbols" msgstr "symboler" +# #: readelf.c:2979 readelf.c:3046 msgid "symtab shndx" msgstr "symtab shndx" +# #: readelf.c:3147 msgid "" "\n" @@ -2685,31 +3198,38 @@ msgstr "" "\n" "Det finns inga sektioner i denna fil.\n" +# #: readelf.c:3153 #, c-format msgid "There are %d section headers, starting at offset 0x%lx:\n" msgstr "Det finns %d sektionshuvuden, med början på offset 0x%lx:\n" +# #: readelf.c:3170 readelf.c:3479 readelf.c:3826 readelf.c:5397 msgid "string table" msgstr "strängtabell" +# #: readelf.c:3191 msgid "File contains multiple dynamic symbol tables\n" msgstr "Filen innehåller flera tabeller med dynamiska symboler\n" +# #: readelf.c:3203 msgid "File contains multiple dynamic string tables\n" msgstr "Filen innehåller flera dynamiska strängtabeller\n" +# #: readelf.c:3209 msgid "dynamic strings" msgstr "dynamiska strängar" +# #: readelf.c:3215 msgid "File contains multiple symtab shndx tables\n" msgstr "Filen innehåller flera symtab-shndx-tabeller\n" +# # BUGG: plural-s #: readelf.c:3250 #, c-format @@ -2720,22 +3240,27 @@ msgstr "" "\n" "Sektionshuvud%0.s:\n" +# #: readelf.c:3254 msgid " [Nr] Name Type Addr Off Size ES Flg Lk Inf Al\n" -msgstr " [Nr] Namn Typ Adr Off Strl PS Flg Lk Inf Ju\n" +msgstr " [Nr] Namn Typ Adress Off Strl PS Flg Lk Inf Ju\n" +# #: readelf.c:3257 msgid " [Nr] Name Type Address Off Size ES Flg Lk Inf Al\n" msgstr " [Nr] Namn Typ Adress Off Strl PS Flg Lk Inf Ju\n" +# #: readelf.c:3260 msgid " [Nr] Name Type Address Offset\n" msgstr " [Nr] Namn Typ Adress Offset\n" +# #: readelf.c:3261 msgid " Size EntSize Flags Link Info Align\n" msgstr " Storlek Poststorlek Flagg Länk Info Just\n" +# #: readelf.c:3356 msgid "" "Key to Flags:\n" @@ -2746,8 +3271,9 @@ msgstr "" "Nyckel till flaggorna:\n" " W (skriv), A (allokera), X (exekvera), M (förena), S (strängar)\n" " I (info), L (länkordning), G (grupp), x (okänd)\n" -" O (extra OS-bearbetning krävs) o (OS-specifik), p (processor-specifik)\n" +" O (extra OS-bearbetning krävs) o (OS-specifik), p (processorspecifik)\n" +# #: readelf.c:3417 #, c-format msgid "" @@ -2757,6 +3283,7 @@ msgstr "" "\n" "Omlokaliseringssektionen på offset 0x%lx innehåller %ld byte:\n" +# #: readelf.c:3424 msgid "" "\n" @@ -2765,6 +3292,7 @@ msgstr "" "\n" "Det finns inga dynamiska omlokaliseringar i denna fil.\n" +# #: readelf.c:3451 msgid "" "\n" @@ -2773,11 +3301,13 @@ msgstr "" "\n" "Omlokaliseringssektion " +# #: readelf.c:3458 readelf.c:3905 #, c-format msgid " at offset 0x%lx contains %lu entries:\n" msgstr " på offset 0x%lx innehåller %lu poster:\n" +# #: readelf.c:3496 msgid "" "\n" @@ -2786,20 +3316,24 @@ msgstr "" "\n" "Det finns inga omlokaliseringar i denna fil.\n" +# #: readelf.c:3692 msgid "unwind table" msgstr "tillbakarullningstabell" +# #: readelf.c:3743 readelf.c:3755 readelf.c:7608 readelf.c:7619 #, c-format msgid "Skipping unexpected symbol type %u\n" msgstr "Hoppar över oväntad symboltyp %u\n" +# #: readelf.c:3763 #, c-format msgid "Skipping unexpected relocation type %s\n" msgstr "Hoppar över oväntad omlokaliseringstyp %s\n" +# #: readelf.c:3808 readelf.c:3833 msgid "" "\n" @@ -2808,6 +3342,7 @@ msgstr "" "\n" "Det finns inga tillbakarullningssektioner i denna fil.\n" +# # BUGG: Fortsättningen är inte markerad för översättning i koden och innehåller '-citattecken. #: readelf.c:3884 msgid "" @@ -2817,10 +3352,12 @@ msgstr "" "\n" "Kunde inte hitta tillbakarullningssektion till " +# #: readelf.c:3896 msgid "unwind info" msgstr "tillbakarullningsinfo" +# #: readelf.c:3898 msgid "" "\n" @@ -2829,10 +3366,12 @@ msgstr "" "\n" "Tillbakarullningssektion " +# #: readelf.c:4071 readelf.c:4114 msgid "dynamic segment" msgstr "dynamiskt segment" +# #: readelf.c:4183 msgid "" "\n" @@ -2841,30 +3380,37 @@ msgstr "" "\n" "Det finns inget dynamiskt segment i denna fil.\n" +# #: readelf.c:4217 msgid "Unable to seek to end of file!" msgstr "Kan inte uppsöka slutet av filen!" +# #: readelf.c:4228 msgid "Unable to determine the number of symbols to load\n" msgstr "Kan inte fastställa hur många symboler som ska läsas in\n" +# #: readelf.c:4258 msgid "Unable to seek to end of file\n" msgstr "Kan inte uppsöka slutet av filen\n" +# #: readelf.c:4264 msgid "Unable to determine the length of the dynamic string table\n" msgstr "Kan inte fastställa längden på den dynamiska strängtabellen\n" +# #: readelf.c:4269 msgid "dynamic string table" msgstr "dynamisk strängtabell" +# #: readelf.c:4303 msgid "symbol information" msgstr "symbolinformation" +# #: readelf.c:4327 #, c-format msgid "" @@ -2874,67 +3420,82 @@ msgstr "" "\n" "Dynamiskt segment på offset 0x%x innehåller %ld poster:\n" +# #: readelf.c:4330 msgid " Tag Type Name/Value\n" msgstr " Tagg Typ Namn/Värde\n" +# #: readelf.c:4366 msgid "Auxiliary library" msgstr "yttre bibliotek" +# #: readelf.c:4370 msgid "Filter library" msgstr "filterbibliotek" +# #: readelf.c:4374 msgid "Configuration file" msgstr "konfigurationsfil" +# #: readelf.c:4378 msgid "Dependency audit library" msgstr "beroendövervakningsbibliotek" +# #: readelf.c:4382 msgid "Audit library" msgstr "övervakningsbibliotek" +# #: readelf.c:4400 readelf.c:4426 readelf.c:4452 msgid "Flags:" msgstr "flaggor:" +# #: readelf.c:4402 readelf.c:4428 readelf.c:4454 msgid " None\n" msgstr " inga\n" +# #: readelf.c:4573 #, c-format msgid "Shared library: [%s]" msgstr "delat bibliotek: [%s]" +# #: readelf.c:4576 msgid " program interpreter" msgstr " programtolk" +# #: readelf.c:4580 #, c-format msgid "Library soname: [%s]" msgstr "biblioteks so-namn: [%s]" +# #: readelf.c:4584 #, c-format msgid "Library rpath: [%s]" msgstr "bibliotekets rpath: [%s]" +# #: readelf.c:4588 #, c-format msgid "Library runpath: [%s]" msgstr "bibliotekets runpath: [%s]" +# #: readelf.c:4649 #, c-format msgid "Not needed object: [%s]\n" msgstr "onödigt objekt: [%s]\n" +# #: readelf.c:4746 #, c-format msgid "" @@ -2944,49 +3505,59 @@ msgstr "" "\n" "Versiondefinitionssektion \"%s\" innehåller %ld poster:\n" +# #: readelf.c:4749 msgid " Addr: 0x" msgstr " Adr: 0x" +# #: readelf.c:4751 readelf.c:4946 #, c-format msgid " Offset: %#08lx Link: %lx (%s)\n" msgstr " Offset: %#08lx Länk: %lx (%s)\n" +# #: readelf.c:4758 msgid "version definition section" msgstr "versiondefinitionssektion" +# #: readelf.c:4784 #, c-format msgid " %#06x: Rev: %d Flags: %s" msgstr " %#06x: Rev: %d Flaggor: %s" +# #: readelf.c:4787 #, c-format msgid " Index: %d Cnt: %d " msgstr " Index: %d Ant: %d " +# #: readelf.c:4798 #, c-format msgid "Name: %s\n" msgstr "Namn: %s\n" +# #: readelf.c:4800 #, c-format msgid "Name index: %ld\n" msgstr "Namnindex: %ld\n" +# #: readelf.c:4815 #, c-format msgid " %#06x: Parent %d: %s\n" msgstr " %#06x: Förälder %d: %s\n" +# #: readelf.c:4818 #, c-format msgid " %#06x: Parent %d, name index: %ld\n" msgstr " %#06x: Förälder %d, namnindex: %ld\n" +# #: readelf.c:4837 #, c-format msgid "" @@ -2996,58 +3567,70 @@ msgstr "" "\n" "Versionbehovssektion \"%s\" innehåller %ld poster:\n" +# #: readelf.c:4840 msgid " Addr: 0x" msgstr " Adr: 0x" +# #: readelf.c:4842 #, c-format msgid " Offset: %#08lx Link to section: %ld (%s)\n" msgstr " Offset: %#08lx Länk till sektion: %ld (%s)\n" +# #: readelf.c:4848 msgid "version need section" msgstr "versionsbehovssektion" +# #: readelf.c:4870 #, c-format msgid " %#06x: Version: %d" msgstr " %#06x: Version: %d" +# #: readelf.c:4873 #, c-format msgid " File: %s" msgstr " Fil: %s" +# #: readelf.c:4875 #, c-format msgid " File: %lx" msgstr " Fil: %lx" +# #: readelf.c:4877 #, c-format msgid " Cnt: %d\n" msgstr " Ant: %d\n" +# #: readelf.c:4895 #, c-format msgid " %#06x: Name: %s" msgstr " %#06x: Namn: %s" +# #: readelf.c:4898 #, c-format msgid " %#06x: Name index: %lx" msgstr " %#06x: Namnindex: %lx" +# #: readelf.c:4901 #, c-format msgid " Flags: %s Version: %d\n" msgstr " Flaggor: %s Version: %d\n" +# #: readelf.c:4937 msgid "version string table" msgstr "versionssträngtabell" +# #: readelf.c:4941 #, c-format msgid "" @@ -3057,38 +3640,47 @@ msgstr "" "\n" "Versionsymbolssektion \"%s\" innehåller %d poster:\n" +# #: readelf.c:4944 msgid " Addr: " msgstr " Adr: " +# #: readelf.c:4954 msgid "version symbol data" msgstr "versionsymbolsdata" +# #: readelf.c:4981 msgid " 0 (*local*) " msgstr " 0 (*lokal*) " +# #: readelf.c:4985 msgid " 1 (*global*) " msgstr " 1 (*global*) " +# #: readelf.c:5020 readelf.c:5454 msgid "version need" msgstr "versionsbehov" +# #: readelf.c:5030 msgid "version need aux (2)" msgstr "yttre versionsbehov (2)" +# #: readelf.c:5071 readelf.c:5516 msgid "version def" msgstr "versionsdef." +# #: readelf.c:5090 readelf.c:5531 msgid "version def aux" msgstr "yttre versionsdef." +# #: readelf.c:5121 msgid "" "\n" @@ -3097,37 +3689,45 @@ msgstr "" "\n" "Det fanns ingen versionsinformation i denna fil.\n" +# #: readelf.c:5139 readelf.c:5174 #, c-format msgid ": %d" -msgstr ": %d" +msgstr ": %d" +# #: readelf.c:5141 readelf.c:5186 #, c-format msgid ": %d" msgstr ": %d" +# #: readelf.c:5143 readelf.c:5189 #, c-format msgid ": %d" msgstr ": %d" +# #: readelf.c:5252 msgid "Unable to read in dynamic data\n" -msgstr "Kan inte läsa in den dynamiska datan\n" +msgstr "Kan inte läsa in dynamisk data\n" +# #: readelf.c:5294 msgid "Unable to seek to start of dynamic information" msgstr "Kan inte uppsöka början av den dynamiska informationen" +# #: readelf.c:5300 msgid "Failed to read in number of buckets\n" msgstr "Misslyckades läsa in antalet hinkar\n" +# #: readelf.c:5306 msgid "Failed to read in number of chains\n" msgstr "Misslyckades Läsa in antalet kedjor\n" +# #: readelf.c:5326 msgid "" "\n" @@ -3136,14 +3736,17 @@ msgstr "" "\n" "Symboltabell för filbilden:\n" +# #: readelf.c:5328 msgid " Num Buc: Value Size Type Bind Vis Ndx Name\n" msgstr " Nr Hin: Värde Strl Typ Bind Synl Idx Namn\n" +# #: readelf.c:5330 msgid " Num Buc: Value Size Type Bind Vis Ndx Name\n" msgstr " Nr Hin: Värde Strl Typ Bind Synl Idx Namn\n" +# #: readelf.c:5375 #, c-format msgid "" @@ -3153,26 +3756,32 @@ msgstr "" "\n" "Symboltabell \"%s\" innehåller %lu poster:\n" +# #: readelf.c:5379 msgid " Num: Value Size Type Bind Vis Ndx Name\n" msgstr " Nr: Värde Strl Typ Bind Synl Idx Namn\n" +# #: readelf.c:5381 msgid " Num: Value Size Type Bind Vis Ndx Name\n" msgstr " Nr: Värde Strl Typ Bind Synl Idx Namn\n" +# #: readelf.c:5427 msgid "version data" msgstr "versionsdata" +# #: readelf.c:5467 msgid "version need aux (3)" msgstr "yttre versionsbehov (3)" +# #: readelf.c:5492 msgid "bad dynamic symbol" msgstr "felaktig dynamisk symbol" +# #: readelf.c:5554 msgid "" "\n" @@ -3181,6 +3790,7 @@ msgstr "" "\n" "Informationen om dynamiska symboler är inte tillgänglig för att visa symboler.\n" +# #: readelf.c:5566 #, c-format msgid "" @@ -3190,15 +3800,18 @@ msgstr "" "\n" "Histogram över hinkarnas listlängd (totalt %d hinkar):\n" +# #: readelf.c:5568 #, c-format msgid " Length Number %% of total Coverage\n" msgstr " Längd Nummer %% av alla Täckning\n" +# #: readelf.c:5573 readelf.c:5592 readelf.c:8825 readelf.c:9017 msgid "Out of memory" msgstr "Slut på minne" +# #: readelf.c:5641 #, c-format msgid "" @@ -3208,10 +3821,12 @@ msgstr "" "\n" "Dynamiskt info-segment på offset 0x%lx innehåller %d poster:\n" +# #: readelf.c:5644 msgid " Num: Name BoundTo Flags\n" -msgstr " Nr: Namn Bind till Flagg\n" +msgstr " Nr: Namn BundenTill Flaggor\n" +# #: readelf.c:5696 #, c-format msgid "" @@ -3221,6 +3836,7 @@ msgstr "" "\n" "Disassembleringsutskrift av sektion %s\n" +# #: readelf.c:5719 #, c-format msgid "" @@ -3230,6 +3846,7 @@ msgstr "" "\n" "Sektion \"%s\" har ingen data att skriva ut.\n" +# #: readelf.c:5724 #, c-format msgid "" @@ -3237,21 +3854,25 @@ msgid "" "Hex dump of section '%s':\n" msgstr "" "\n" -"Hex.utskrift av sektion \"%s\":\n" +"Hexadecimal utskrift av sektion \"%s\":\n" +# #: readelf.c:5729 msgid "section data" msgstr "sektionsdata" +# #: readelf.c:5878 msgid "badly formed extended line op encountered!\n" msgstr "felaktigt utformad utökad rad-op påträffades!\n" +# #: readelf.c:5885 #, c-format msgid " Extended opcode %d: " msgstr " Utökad op-kod %d: " +# #: readelf.c:5890 msgid "" "End of Sequence\n" @@ -3260,29 +3881,36 @@ msgstr "" "Slut på sekvensen\n" "\n" +# #: readelf.c:5896 #, c-format msgid "set Address to 0x%lx\n" msgstr "sätt Adress till 0x%lx\n" +# #: readelf.c:5901 msgid " define new File Table entry\n" msgstr " definiera ny filtabellspost\n" +# #: readelf.c:5902 readelf.c:6031 msgid " Entry\tDir\tTime\tSize\tName\n" msgstr " Post\tKatalog\tTid\tStorl.\tNamn\n" +# #: readelf.c:5904 #, c-format msgid " %d\t" msgstr " %d\t" -#: readelf.c:5907 readelf.c:5909 readelf.c:5911 readelf.c:6043 readelf.c:6045 readelf.c:6047 +# +#: readelf.c:5907 readelf.c:5909 readelf.c:5911 readelf.c:6043 readelf.c:6045 +#: readelf.c:6047 #, c-format msgid "%lu\t" msgstr "%lu\t" +# #: readelf.c:5912 #, c-format msgid "" @@ -3292,11 +3920,13 @@ msgstr "" "%s\n" "\n" +# #: readelf.c:5916 #, c-format msgid "UNKNOWN: length %d\n" msgstr "OKÄND: längd %d\n" +# #: readelf.c:5942 #, c-format msgid "" @@ -3308,59 +3938,71 @@ msgstr "" "Utskrift av felsökningsinnehåll i sektion %s:\n" "\n" +# #: readelf.c:5954 msgid "64-bit DWARF line info is not supported yet.\n" msgstr "64-bitars DWARF-radinformation stöds inte än.\n" +# #: readelf.c:5961 msgid "The line info appears to be corrupt - the section is too small\n" msgstr "Radinformationen verkar vara trasig - sektionen är för liten\n" +# #: readelf.c:5969 msgid "Only DWARF version 2 line info is currently supported.\n" msgstr "Endast DWARF version 2:s radinfo stöds för närvarande.\n" +# #: readelf.c:5984 #, c-format msgid " Length: %ld\n" msgstr " längd: %ld\n" +# #: readelf.c:5985 #, c-format msgid " DWARF Version: %d\n" msgstr " DWARF version: %d\n" +# #: readelf.c:5986 #, c-format msgid " Prologue Length: %d\n" msgstr " prologlängd: %d\n" +# #: readelf.c:5987 #, c-format msgid " Minimum Instruction Length: %d\n" -msgstr " min.-instruktionslängd: %d\n" +msgstr " minsta instruktionslängd: %d\n" +# # BUGG: Ska det inte vara `' på engelska? #: readelf.c:5988 #, c-format msgid " Initial value of 'is_stmt': %d\n" msgstr " initialvärde på \"is_stmt\": %d\n" +# #: readelf.c:5989 #, c-format msgid " Line Base: %d\n" msgstr " radbas: %d\n" +# #: readelf.c:5990 #, c-format msgid " Line Range: %d\n" -msgstr " radomfång: %d\n" +msgstr " radintervall: %d\n" +# #: readelf.c:5991 #, c-format msgid " Opcode Base: %d\n" msgstr " op-kodbas: %d\n" +# #: readelf.c:6000 msgid "" "\n" @@ -3369,11 +4011,13 @@ msgstr "" "\n" " Op-koder:\n" +# #: readelf.c:6003 #, c-format msgid " Opcode %d has %d args\n" msgstr " Op-kod %d har %d argument\n" +# #: readelf.c:6009 msgid "" "\n" @@ -3382,6 +4026,7 @@ msgstr "" "\n" " Katalogtabellen är tom.\n" +# #: readelf.c:6012 msgid "" "\n" @@ -3390,11 +4035,13 @@ msgstr "" "\n" " Katalogtabellen:\n" +# #: readelf.c:6016 #, c-format msgid " %s\n" msgstr " %s\n" +# #: readelf.c:6027 msgid "" "\n" @@ -3403,6 +4050,7 @@ msgstr "" "\n" " Filnamnstabellen är tom.\n" +# #: readelf.c:6030 msgid "" "\n" @@ -3411,16 +4059,19 @@ msgstr "" "\n" " Filnamnstabellen:\n" +# #: readelf.c:6038 #, c-format msgid " %d\t" msgstr " %d\t" +# #: readelf.c:6049 #, c-format msgid "%s\n" msgstr "%s\n" +# #. Now display the statements. #: readelf.c:6057 msgid "" @@ -3428,79 +4079,95 @@ msgid "" " Line Number Statements:\n" msgstr "" "\n" -" Radnumersatser:\n" +" Radnummersatser:\n" +# #: readelf.c:6073 #, c-format msgid " Special opcode %d: advance Address by %d to 0x%lx" -msgstr " Särskilld op-kod %d: öka adressen med %d till 0x%lx" +msgstr " Särskild op-kod %d: öka adressen med %d till 0x%lx" +# #: readelf.c:6077 #, c-format msgid " and Line by %d to %d\n" msgstr " och radnumret med %d till %d\n" +# #: readelf.c:6088 msgid " Copy\n" msgstr " Kopiera\n" +# #: readelf.c:6095 #, c-format msgid " Advance PC by %d to %lx\n" msgstr " Öka PC med %d till %lx\n" +# #: readelf.c:6103 #, c-format msgid " Advance Line by %d to %d\n" msgstr " Öka radnumret med %d till %d\n" +# #: readelf.c:6110 #, c-format msgid " Set File Name to entry %d in the File Name Table\n" msgstr " Sätt filnamnet till post %d i filnamnstabellen\n" +# #: readelf.c:6118 #, c-format msgid " Set column to %d\n" msgstr " Sätt kolumnen till %d\n" +# #: readelf.c:6125 #, c-format msgid " Set is_stmt to %d\n" msgstr " Sätt is_stmt till %d\n" +# #: readelf.c:6130 msgid " Set basic block\n" msgstr " Sätt basblocket\n" +# #: readelf.c:6138 #, c-format msgid " Advance PC by constant %d to 0x%lx\n" msgstr " Öka PC med konstant %d till 0x%lx\n" +# #: readelf.c:6146 #, c-format msgid " Advance PC by fixed size amount %d to 0x%lx\n" msgstr " Öka PC med fastlängdsantal %d till 0x%lx\n" +# #: readelf.c:6151 msgid " Set prologue_end to true\n" -msgstr " Sätt prologue_end till sann\n" +msgstr " Sätt prologue_end till sannt\n" +# #: readelf.c:6155 msgid " Set epilogue_begin to true\n" -msgstr " Sätt epilogue_begin till sann\n" +msgstr " Sätt epilogue_begin till sannt\n" +# #: readelf.c:6161 #, c-format msgid " Set ISA to %d\n" msgstr " Sätt ISA till %d\n" +# #: readelf.c:6165 #, c-format msgid " Unknown opcode %d with operands: " msgstr " Okänd op-kod %d med operand: " +# #: readelf.c:6197 readelf.c:6658 readelf.c:6730 #, c-format msgid "" @@ -3510,34 +4177,41 @@ msgstr "" "%s-sektionens innehåll:\n" "\n" +# #: readelf.c:6216 msgid "64-bit DWARF pubnames are not supported yet.\n" -msgstr "64-bitars DWARF-publika namn stöds inte än.\n" +msgstr "64-bitars publika DWARF-namn stöds inte än.\n" +# #: readelf.c:6226 msgid "Only DWARF 2 pubnames are currently supported\n" -msgstr "Endast DWARF 2 pub.-namn stöds för närvarande\n" +msgstr "Endast publika DWARF 2-namn stöds för närvarande\n" +# #: readelf.c:6233 #, c-format msgid " Length: %ld\n" msgstr " längd: %ld\n" +# #: readelf.c:6235 #, c-format msgid " Version: %d\n" msgstr " version: %d\n" +# #: readelf.c:6237 #, c-format msgid " Offset into .debug_info section: %ld\n" msgstr " offset i .debug_info-sektionen: %ld\n" +# #: readelf.c:6239 #, c-format msgid " Size of area in .debug_info section: %ld\n" msgstr " storl. på omr. i .debug_info-sekt.: %ld\n" +# #: readelf.c:6242 msgid "" "\n" @@ -3546,92 +4220,113 @@ msgstr "" "\n" " Offset\tNamn\n" +# #: readelf.c:6333 #, c-format msgid "Unknown TAG value: %lx" msgstr "Okänt TAG-värde: %lx" +# #: readelf.c:6443 #, c-format msgid "Unknown AT value: %lx" msgstr "Okänt AT-värde: %lx" +# #: readelf.c:6480 #, c-format msgid "Unknown FORM value: %lx" msgstr "Okänt FORM-värde: %lx" +# #: readelf.c:6679 #, c-format msgid " DW_MACINFO_start_file - lineno: %d filenum: %d\n" -msgstr " DW_MACINFO_start_file - rad: %d filnr: %d\n" +msgstr " DW_MACINFO_start_file - rad: %d filnummer: %d\n" +# #: readelf.c:6684 msgid " DW_MACINFO_end_file\n" msgstr " DW_MACINFO_end_file\n" +# #: readelf.c:6692 #, c-format msgid " DW_MACINFO_define - lineno : %d macro : %s\n" -msgstr " DW_MACINFO_define - rad : %d makro : %s\n" +msgstr " DW_MACINFO_define - rad: %d makro: %s\n" +# #: readelf.c:6700 #, c-format msgid " DW_MACINFO_undef - lineno : %d macro : %s\n" -msgstr " DW_MACINFO_undef - rad : %d makro : %s\n" +msgstr " DW_MACINFO_undef - rad: %d makro: %s\n" +# #: readelf.c:6711 #, c-format msgid " DW_MACINFO_vendor_ext - constant : %d string : %s\n" -msgstr " DW_MACINFO_vendor_ext - konstant : %d sträng : %s\n" +msgstr " DW_MACINFO_vendor_ext - konstant: %d sträng: %s\n" +# +# Detta är ett tabellhuvud med två kolumner. #: readelf.c:6739 msgid " Number TAG\n" msgstr " Nummer TAGG\n" +# #: readelf.c:6745 #, c-format msgid " %ld %s [%s]\n" msgstr " %ld %s [%s]\n" +# #: readelf.c:6748 msgid "has children" msgstr "har barn" +# #: readelf.c:6748 msgid "no children" msgstr "inga barn" +# #: readelf.c:6752 #, c-format msgid " %-18s %s\n" msgstr " %-18s %s\n" +# #: readelf.c:6773 #, c-format msgid " %lu byte block: " msgstr " %lu byte-block: " +# #: readelf.c:7096 msgid "(User defined location op)" msgstr "(användardefinierad plats-op)" +# #: readelf.c:7098 msgid "(Unknown location op)" msgstr "(okänd plats-op)" +# #: readelf.c:7137 msgid "debug_str section data" msgstr "debug_str sektionsdata" +# #: readelf.c:7156 msgid "" msgstr "" +# #: readelf.c:7159 msgid "" msgstr "" +# #: readelf.c:7179 msgid "" "\n" @@ -3640,6 +4335,7 @@ msgstr "" "\n" ".debug_str-sektionen är tom.\n" +# #: readelf.c:7183 msgid "" "Contents of the .debug_str section:\n" @@ -3648,37 +4344,45 @@ msgstr "" "Innehåll i .debug_str-sektionen:\n" "\n" +# #: readelf.c:7354 #, c-format msgid " (indirect string, offset: 0x%lx): " msgstr " (indirekt sträng, offset: 0x%lx): " +# #: readelf.c:7363 #, c-format msgid "Unrecognised form: %d\n" msgstr "Okänt formulär: %d\n" +# #: readelf.c:7376 msgid "(not inlined)" msgstr "(inte inlajnad)" +# #: readelf.c:7377 msgid "(inlined)" msgstr "(inlajnad)" +# #: readelf.c:7378 msgid "(declared as inline but ignored)" msgstr "(deklarerad som inlajn men ignorerad)" +# #: readelf.c:7379 msgid "(declared as inline and inlined)" msgstr "(deklarerad som inlajn och inlajnad)" +# #: readelf.c:7380 #, c-format msgid " (Unknown inline attribute value: %lx)" msgstr " (okänt inlajnattributvärde: %lx)" +# #: readelf.c:7545 readelf.c:7746 #, c-format msgid "" @@ -3688,90 +4392,109 @@ msgstr "" "Sektion %s innehåller:\n" "\n" +# #: readelf.c:7568 msgid "64-bit DWARF debug info is not supported yet.\n" msgstr "64-bitars DWARF-felsökningsinfo stöds inte än.\n" +# #: readelf.c:7637 #, c-format msgid " Compilation Unit @ %lx:\n" msgstr " Kompileringsenhet @ %lx:\n" +# #: readelf.c:7638 #, c-format msgid " Length: %ld\n" msgstr " längd: %ld\n" +# #: readelf.c:7639 #, c-format msgid " Version: %d\n" msgstr " version: %d\n" +# #: readelf.c:7640 #, c-format msgid " Abbrev Offset: %ld\n" msgstr " förk.-offset: %ld\n" +# #: readelf.c:7641 #, c-format msgid " Pointer Size: %d\n" msgstr " pekarstorlek: %d\n" +# #: readelf.c:7645 msgid "Only version 2 DWARF debug information is currently supported.\n" -msgstr "Endast version 2 av DWARF felsökningsinformation stöds för närvarande.\n" +msgstr "Endast version 2 av DWARF-felsökningsinformation stöds för närvarande.\n" +# #: readelf.c:7666 msgid "Unable to locate .debug_abbrev section!\n" msgstr "Kan inte hitta någon .debug_abbrev-sektion!\n" +# #: readelf.c:7672 msgid "debug_abbrev section data" -msgstr "debug_abbrev sektionsdata" +msgstr "debug_abbrev-sektionsdata" +# #: readelf.c:7709 #, c-format msgid "Unable to locate entry %lu in the abbreviation table\n" msgstr "Kan inte hitta post %lu i förkortningstabellen\n" +# #: readelf.c:7714 #, c-format msgid " <%d><%lx>: Abbrev Number: %lu (%s)\n" -msgstr " <%d><%lx>: Förk.-nummer: %lu (%s)\n" +msgstr " <%d><%lx>: Förkortningsnummer: %lu (%s)\n" +# #: readelf.c:7767 msgid "64-bit DWARF aranges are not supported yet.\n" msgstr "64-bitars DWARF-a-intervall stöds inte än.\n" +# #: readelf.c:7773 msgid "Only DWARF 2 aranges are currently supported.\n" msgstr "Endast DWARF2:s a-intervall stöds för närvarande.\n" +# #: readelf.c:7777 #, c-format msgid " Length: %ld\n" msgstr " längd: %ld\n" +# #: readelf.c:7778 #, c-format msgid " Version: %d\n" msgstr " version: %d\n" +# #: readelf.c:7779 #, c-format msgid " Offset into .debug_info: %lx\n" msgstr " offset i .debug_info: %lx\n" +# #: readelf.c:7780 #, c-format msgid " Pointer Size: %d\n" msgstr " pekarstorlek: %d\n" +# #: readelf.c:7781 #, c-format msgid " Segment Size: %d\n" msgstr " segmentstorlek: %d\n" +# #: readelf.c:7783 msgid "" "\n" @@ -3780,20 +4503,24 @@ msgstr "" "\n" " adresslängd\n" +# #: readelf.c:7965 #, c-format msgid "The section %s contains:\n" msgstr "Sektion %s innehåller:\n" +# #: readelf.c:7988 msgid "64-bit DWARF format frames are not supported yet.\n" msgstr "64-bitars DWARF-formatmallar stöds inte än.\n" +# #: readelf.c:8499 #, c-format msgid "Displaying the debug contents of section %s is not yet supported.\n" msgstr "Visa felsökningsinnehållet i sektion %s stöds inte än.\n" +# #: readelf.c:8565 #, c-format msgid "" @@ -3803,27 +4530,33 @@ msgstr "" "\n" "Sektion \"%s\" innehåller ingen felsökningsdata.\n" +# #: readelf.c:8570 readelf.c:8632 msgid "debug section data" msgstr "felsökningssektionsdata" +# #: readelf.c:8586 #, c-format msgid "Unrecognised debug section: %s\n" msgstr "Okänd felsökningssektion: %s\n" +# #: readelf.c:8660 msgid "Some sections were not dumped because they do not exist!\n" msgstr "Några sektioner skrevs inte ut eftersom de inte existerar!\n" +# #: readelf.c:8733 msgid "liblist" msgstr "bibliotekslista" +# #: readelf.c:8818 msgid "options" msgstr "flaggor" +# #: readelf.c:8849 #, c-format msgid "" @@ -3833,15 +4566,18 @@ msgstr "" "\n" "Sektion \"%s\" innehåller %d poster:\n" +# # BUGG: Fel i originalet? #: readelf.c:9010 msgid "conflict list with without table" msgstr "konfliktlista utan tabell" +# #: readelf.c:9028 readelf.c:9044 msgid "conflict" msgstr "konflikt" +# #: readelf.c:9054 #, c-format msgid "" @@ -3851,85 +4587,104 @@ msgstr "" "\n" "Sektion \".conflict\" innehåller %ld poster:\n" +# #: readelf.c:9056 msgid " Num: Index Value Name" msgstr " Num: Index Värde Namn" +# #: readelf.c:9083 msgid "NT_PRSTATUS (prstatus structure)" msgstr "NT_PRSTATUS (prstatus-struktur)" +# #: readelf.c:9084 msgid "NT_FPREGSET (floating point registers)" msgstr "NT_FPREGSET (flyttalsregister)" +# #: readelf.c:9085 msgid "NT_PRPSINFO (prpsinfo structure)" msgstr "NT_PRPSINFO (prpsinfo-struktur)" +# #: readelf.c:9086 msgid "NT_TASKSTRUCT (task structure)" -msgstr "NT_TASKSTRUCT (task-struktur)" +msgstr "NT_TASKSTRUCT (uppgiftsstruktur)" +# #: readelf.c:9087 msgid "NT_PRXFPREG (user_xfpregs structure)" msgstr "NT_PRXFPREG (user_xfpregs-struktur)" +# #: readelf.c:9088 msgid "NT_PSTATUS (pstatus structure)" msgstr "NT_PSTATUS (pstatus-struktur)" +# #: readelf.c:9089 msgid "NT_FPREGS (floating point registers)" msgstr "NT_FPREGS (flyttalsregister)" +# #: readelf.c:9090 msgid "NT_PSINFO (psinfo structure)" msgstr "NT_PSINFO (psinfo-struktur)" +# #: readelf.c:9091 msgid "NT_LWPSTATUS (lwpstatus_t structure)" msgstr "NT_LWPSTATUS (lwpstatus_t-struktur)" +# #: readelf.c:9092 msgid "NT_LWPSINFO (lwpsinfo_t structure)" msgstr "NT_LWPSINFO (lwpsinfo_t-struktur)" +# # BUGG: Stavfel i originalet (str>ucƒe=Âe>f6?f<vf7³f8ëf<$g<agIžgNèg)7h=ah>ŸhÞhñhii@2i8si¬iÂiØiñi$j(j@j\jqjwj'}jn¥j7kPLkQk5ïkò%lm{E†(ÌFõY<€F–€øÝ€fÖ…E=‹4ƒ‹8¸‹-ñ‹(Œ@HŒA‰Œ5ËŒABCZ†%á(Ž -0Ž;ŽWŽ%rŽ.˜Ž(ÇŽ -ðŽûŽ"(Aj%†¬ à -ÏÚ-â*>"U+x#¤ È"é" ‘(/‘ X‘"d‘B‡‘:Ê‘!’ '’)5’(_’(ˆ’+±’ Ý’,þ’!+“M“"f“‰“™“¬“Ê“ê“" -”4-”(b”‹”¢”3”ö”••.•L•a•+}•1©•1Û•1 –3?–5s–@©–\ê–JG—(’—#»—*ß—+ -˜+6˜b˜‚˜.ž˜C͘Q™Yc™3½™-ñ™,š1Lš@~š>¿š.þš)-›6W›QŽ›à›1ý›/œ-Nœ4|œ5±œIçœ-12_’¤8¸#ñ$ž:ž BžLž,ažŽž0¤ž+Õž3Ÿ*5Ÿ`Ÿ7gŸBŸŸRâŸ5 H '_ ‡  ¥ ± Æ  -Û #æ  -¡¡$¡(¡-¡ D¡N¡i¡‚¡—¡±¡Æ¡ ä¡!¢:'¢:b¢ ¢©¢É¢(ߢ£C£7c£ ›£©£&¼£&㣠-¤)¤,A¤n¤†¤8š¤&Ó¤ú¤¥6¥G¥c¥}¥¥¬¥Â¥$Þ¥'¦+¦C¦R¦k¦)†¦°¦ ͦÚ¦!é¦ §§<§S§j§ }§=‹§2ɧ -ü§¨¨ 8¨ Y¨ z¨ „¨’¨­¨,˨.ø¨2'©-Z©-ˆ©¶©É©ç©ªª*ª>ªWª qª ªª œªªªǪ åªóª«"« >«L«%g«&«$´«Ù«ò«¬'¬A¬R¬&n¬•¬±¬ͬæ¬þ¬­20­c­­“­¦­À­Ù­%÷­.®L®]®w®Ž®ª®À®Ö®ì®¯¯;¯Z¯y¯’¯&®¯BÕ¯:°S° c°p°‡° ™°*¦°Ñ°æ°Òý°$б#õ±-²-G²+u²¡²°²·²βé² ü²³³ 2³&S³$z³&Ÿ³NƳ>´'T´|´Œ´(¦´Ï´å´ø´µ5µÈSµ¶!1¶S¶g¶}¶,’¶¿¶Ú¶4ù¶.· @·$L·&q·"˜·$»· à· ¸$"¸G¸d¸ƒ¸)¢¸̸Né¸8¹ I¹S¹m¹…¹ž¹´¹+ʹö¹<û¹8ºQºaºsº.Žº.½º7ìº?$»d»~»p» ¿¿)+¿,U¿‚¿˜¿¨¿Ç¿â¿ÀÀ*ÀBÀYÀqÀŠÀ#¡À$ÅÀêÀýÀÁ -)Á4Á'IÁ#qÁ9•ÁÏÁ%ÞÁÂÂ0Â?O©Â8ÄÂwý”uà -Ä Ä)Ä!8Ä"ZÄ}Ä,‘Ä;¾Ä2úÄ(-Å(VÅ5ŵÅÒÅ+ñÅ!Æ?Æ_Æ|Æ›Æ.ºÆéÆúÆÇ+ÇCÇZÇvǖǶÇÍÇ"éÇ' È4ÈTȲqÈ¥$É]ÊÉã(Êò Ë%ÿË%Ì>Ì WÌ/xÌ%¨Ì ÎÌÚÌ(éÌ6ÍIÍ+iÍ•Í5¦Í*ÜÍJÎ.RÎ4Î+¶Î âÎ îÎ-øÎ&Ï>ÏQÏbÏ€Ï“Ï¥Ï¼Ï ÌÏ+íÏÐ8Ð"WÐzÐ(–Ð ¿Ð6àÐÑ5Ñ'LÑtÑ‹Ñ"ªÑÍÑâÑþÑ(ÒGÒ/\ҌҦҺÒÎÒ ×Ò øÒÓ8Ó TÓ`Ó-gÓ•Ó -¤Ó ¯Ó½ÓÐÓ/êÓ1Ô!LÔ'nÔ'–Ô/¾Ô2îÔ7!Õ+YÕ …Õ1¦Õ"ØÕ"ûÕ+Ö'JÖ&rÖ#™Ö)½Ö.çÖ×#-×Q×*qל׺×Ô×ã×÷× -Ø !Ø/Ø@Ø ZØdØy؉؞خØÈØâØ&ýØ&$Ù KÙ!lَ١٧ٶپÙÒÙäÙ óÙÚ -ÚÚ 1Ú>Ú XÚ)eÚÚ¤Ú·Ú(ÎÚ4÷Ú,Û-HÛvÛ Û±ÛÍÛÜÛîÛÜ ÜÜ 8ÜEÜ LÜ XÜ fÜtÜ}ÜÜÜ°ÜÅÜÜÜëÜ -Ý Ý/Ý$BÝ gÝsÝ‹ÝS¦Ý úÝÞ Þ8Þ OÞ+\ÞˆÞÞ“Þ²ÞÃÞËÞ-èÞ#ß :ßGß$Wß|ß ƒß ßß°ß Æß Òßßß ïßüß à$à;àQàgà}àà à²àÁàÆàáàðà#á!$á FáSáqá„ážá±áÐáïáââ â)+âUâsâˆââ·âÐâ'ïâ)ã.Aã&pã—ã·ãÕãçãþã)ä&Fämä.‡ä(¶ä.ßäå")åLå]åmå†åå'­åÕåêåæ!æ'1æ*Yæ&„æ«æ¼æÐæðæç%çCç%`ç†ç£ç!Ãçåç'è,è>èPè$lè‘è­è Âè Îè Ûè èèôèé4é Téaévé‹é éµéÉéÚéîéòé'ûé&#ê5Jê €ê'¡ê4Éê2þê 1ëe>ë¤ì¹ì"Òì&õì,íIí^íØqí+Jô7vô®ô ËôØôõô õõ7õ%Mõsõ õ™õªõ#Èõ-ìõIö:döHŸöèö ýö" ÷2,÷_÷7÷·÷Ì÷@ä÷ %ø$Fø+kø(—øÀø)Óøýøù82ù+kù!—ù#¹ùÝù"õùú8ú.Kú6zú1±úãúFøúQ?û:‘û8Ìû@üDFüR‹üÞüBúü8=ý@výS·ýJ þ VþVdþm»þ)ÿ0ÿGHÿ:ÿ;ËÿQ7YE‘4×I -V>„@ÃG?L8Œ7Åý.ECF‰5Ð52<:o5ª7à)HB%‹4±@æG'IoF¹?Q@=’0ÐN9PJŠOÕ8% A^ 7  CØ 2 -CO -G“ -:Û -O df -Ë 8ù F2 y Œ ¡ ¼ @Ô 8 N e y ” #¦ Ê ß ý +iHG²KúVF2JÐá$Lý(,J)Fw)R¾)D*çV*É>/C52L5=5+½5,é5C6GZ6:¢6IÝ6C'7\k7#È7'ì7 8& 8'G8'o8'—8(¿8 è8ô8 9"9(<9e9&ƒ9ª9 º9 Ç9 Ó92à9:0:F:"_:+‚:#®:!Ò:%ô:%;'@; h; t;B•;:Ø;!< 5<%A<&g<(Ž<0·<+è<(=!==_=#=£=²="É=ì= >"*>7M>(…>®>Ä>Dâ>'?@?T?,m?š?*¶?*á?, @*9@-d@8’@5Ë@CA[EAI¡A'ëA'B*;B)fB)BºBØB8øBD1CQvCYÈC8"D+[D+‡D6³DFêDL1E/~E1®E2àEXF lF+F&¹F+àF6 G:CGa~G,àG, H:HNH=dH!¢H(ÄHíH -öHI.IHI3^I-’I/ÀIQðI BJ<LJ?‰JUÉJK.K'NKvK ”K K¸K ÏK ÝKþKLLL"L ?LILgL~LLªL ½LÞLýL=MBZM -M¨MÅM#ÛMÿMIN9`N šN¦NºN+ÚN O'O-AOoO‡O@O*ÞO) P3PSPgP†P P$³PØPìP(Q%0QVQlQ{Q“Q3¯Q!ãQRR/RNRbRR™R³R ÎRCÚR5S -TS_S!zS*œS)ÇSñSTT-T3KT<T8¼T4õT4*U _UmUU’U¢UºUÏUäUÿUV!V3V DV"eVˆVšV¬VËVéVøV+W)CW.mWœW¸WÕWîWXX+5X'aX‰X©XÄXàXöX2Y IYjY €YY¥Y¼YÔY4ôY)ZAZ`Z€Z—Z¬ZÆZÛZõZ[2[R[r[[#­[NÑ[B \ c\ m\{\ “\Ÿ\)®\Ø\#ì\]*^A^/Z^0Š^.»^ê^ û^_!_A_ -R_ ]_j__)¡_'Ë_(ó_N`>k`6ª`á`ô`#a6aNaba€a aÐÀa‘b!¨bÊbàbüb4cGc*dcPcàcóc"d$(dMd!mdd­d!Ëdíde#e&@egeš‡e"f 5f?fVfff„fžf#·fÛf;ãfg5gMgjg6ˆg5¿g=õgE3hyh‘h§­hUlel.ul.¤lÓlèl(øl!m†$]†‚† †±†/º† -ê† õ†‡‡0‡6J‡7‡%¹‡/߇'ˆ07ˆ6hˆDŸˆ1äˆ'‰>>‰-}‰)«‰/Õ‰+Š,1Š'^Š1†Š8¸ŠñŠ1‹):‹*d‹‹¬‹Å‹Ö‹í‹ŒŒ-Œ?ŒYŒ_Œ pŒ~Œ”Œ¥Œ¾ŒÔŒ#èŒ# #0!Tv -Š•©¹Ìæý Ž -#Ž.Ž @ŽLŽ lŽ'zŽ¢Ž¹ŽÎŽ&èŽ@P%k‘±Ñ îü %-A ] k y†• -¥° ÃÐâò ‘‘-‘ B‘P‘'`‘ ˆ‘”‘'¬‘WÔ‘,’>’Y’u’ -‰’&”’»’¿’%Æ’ ì’ -ú’*“40“#e“ ‰“““#¦“ Ê“ Ø“ â“ð“” -” #”0” A”O”_”z”˜”±”Ë”â”û”•'•8•>• [•i•%{•0¡• Ò• à•––2–#F–j–…– – ¯– ¹–%Æ–ì–—!—<—U—m—*‹—*¶—)á—" ˜!.˜P˜n˜˜!–˜/¸˜2蘙.7™(f™/™¿™#Ù™ý™š$š@š[š-nšœšµšÔšïš*›4+›)`›Š› ›²›Л盜œ"9œ\œxœ•œ´œ+Óœÿœ)"Gjˆ¢´ Æ Óàö5 -ž@žQžožž¤ž¶žÈžßžûž ÿž% Ÿ"/Ÿ<RŸ Ÿ#°Ÿ,ÔŸ9 ; LÌpÁæÔkð#Mÿ²Â÷’ú]2¢r¹Dzzf4«„sl­ÿÉ'•RY~oim£;nV2Bó«¨výހݾáFEh1Ö/au¢[µ2a µµMCøoÌ0e샔»S¬.â˱BÅ’G5tJ~¨)¸É ÙUš(bùCTm¤Î -ÍÆ×;@NˆEñq4O1¤`äÐá R$mp&›p[©ïÕ!‰DôÀ…Ê«^b“ã0þ&d‹uÈç®8­7”¯¤‘X"A,yV8 ž:Qߣa7œZêŸè$Ð5#ìä¥Ëláy;\AÏ -'PåÔ·½˜¾MŒX‚Ï[kÛ¶´=Gj%|`nžÁsÝïçÔ·ØE<)s Q´ÙUH€6qÚ‡k›úzæ³â¹'ñ-{§÷ªÍ¯Q<û×ü”3Ñ¿0+Wé¿ÛÀ³9Y¹Žò† 몺Kê@ -€ÅÎÖlÚí$j*_ô^‰ Ãüe}-„¢ QÕMÈ6nbø<¶=ßv1ãxH²5ýe%=f–ò ¬îªä‰Üiß^.!Z4‡ž9·ùD?Syt_¸ „ô>ü¾({¦9ÅIœŸ!‚ùéÃÌT•èš­òå)–. ‚™¼Ž*"HÄ“Š{@$qJÉ¿/6íÂõ½r_°;àˆ3GûpÞ+,%ìkoÑ.›Wt@ú]WxwYÂKV['SÒh+ÄŒÀ&»/P¬J™LŸoÖà¡}ó²Äqx+—ð=¡õ —AŽ3÷j0ŠXFw}g¥S±LE1j#“Ù¯Ç2,å9" ¶ÈÐCY°`†(†g¼yCþ\Š|ZsâgWïg~ÓdPx¡¦}Ác7?XÝ?Ú]ö5ʈRr\a:ÆÓ6iõØ^ðÊ m Aef»íûÜê‹ö™c–l{h FÏ‹Tº©ÇѱNO --IýºF4_|Î&¼˜D©>n /øÿfØ|´KNdÃI•,§?ëc8î£zw *u¸>³Û<b:¦>ç cU…Uš®ƒVî~Ƙv]!B#è‘ZrhI%7K-8"þË…Òv\G§u ƒi®ëwNãÜ’ñ‡`B¨L*Þ½:3OœÒt‘àOÕ ÇPJ¥H×°—RéæŒd(Tó öÓ)Í +Þ•ˆ\½œ8K‘K¦K¿K"ÞK+L-LCL+UL&L¨L ÃLÏL îLM 'MHM'`MˆM¡M°MÁM(ßM(N;1N6mNE¤NêN +O O9'O1aO,“O.ÀOïOP8P#PP#tP%˜P+¾PêPüP)Q9Q"SQ"vQ2™Q0ÌQ,ýQ(*R%SR,yR+¦RÒR7ãR2S3NS‚SE”STÚS/TCKT3T8ÃT;üT:8U8sU ¬UXºUaVuV|V<”V3ÑV3W:9W/tWD¤W2éW4X,QX4~X<³X5ðX7&Y5^Y3”YÈY+àY8 Z9EZ8Z8¸Z+ñZ0[0N[2['²[8Ú["\06\7g\HŸ\Jè\93]7m]L¥]7ò]2*^N]^:¬^?ç^>'_=f_>¤_6ã_<`7W`8`<È`<aIBaNŒa)Ûa=b>Cb‚b•b¨b¿b@Öb8cPcfc|c•c$§cÌcäcddd'!d÷IdòAem4tø¢xf›}pƒgsƒ(Ûƒ +„„+„%F„.l„(›„ +Ä„Ï„ê„"ò„(…>…%Z…€… —… +£…®…-¶…ä…þ…†")†+L†#x† œ†"½†"à†(‡ ,‡"8‡ [‡B|‡:¿‡!ú‡ ˆ)*ˆ(Tˆ(}ˆH¦ˆQïˆ+A‰ m‰,Ž‰!»‰݉"ö‰Š,ŠJŠjŠ"ŠŠ4­Š(⊠‹"‹3B‹v‹‡‹š‹®‹Ì‹á‹+ý‹1)Œ1[Œ1Œ3¿Œ5óŒ@)\jJÇ(Ž#;Ž*_Ž+ŠŽ+¶ŽâŽ(/+([&„.«CÚQYp3Ê-þ,,‘1Y‘@‹‘>Ì‘. ’):’6d’Q›’í’1 +“<“-[“4‰“5¾“Iô“->”2l”Ÿ”±”8Å”#þ”$"•G• O•Y•7n•5¦•7Ü•?–,T––0—–+È–3ô–<(—,e—;’—4Η/˜Q3˜5…˜*»˜/昙7™BU™K˜™9ä™Bš¢aš@Ÿ)EŸoŸ¾‚ŸÚA¡ó£Ï¦ଂb®|å®tb¯ׯ"õ²´'/´W´ u´´—´¬´,Á´ +î´#ù´µ2µ7µ;µ@µ Wµaµ|µ•µªµĵÙµ ÷µ!¶ :¶F¶f¶(|¶¥¶7¼¶ ô¶·&·&<·c·‚·,š·Ç·ß·8ó·&,¸S¸p¸¸ ¸¼¸Ö¸è¸¹¹$6¹'[¹ƒ¹›¹ª¹ù)Þ¹º %º2º!Aºcºwº”º«ºº Õº=ãº2!» +T»_»d»z» •» ¶» ×» á»ï» +¼,(¼.U¼2„¼-·¼-å¼½&½D½]½o½‡½›½´½ ν ܽê½ ù½¾$¾ B¾P¾b¾¾ ›¾©¾%ľ&ê¾$¿6¿O¿l¿„¿ž¿¯¿&Ë¿ò¿À*ÀCÀ[ÀoÀ2ÀÀÀÜÀðÀÁÁ6Á%TÁ%zÁ6 Á.×ÁÂÂ1ÂHÂdÂz¦¼ÂÕÂõÂÃ3ÃLÃBhÃ:«Ãæà öÃÄÄ ,Ä*9ÄdÄyÄÒÄ$cÅ#ˆÅ-¬Å-ÚÅ+Æ4ÆCÆJÆaÆ|Æ Æ›Æ«Æ ÅÆ&æÆ$ Ç&2ÇNYÇ>¨Ç'çÇÈÈ(9ÈbÈxȋȪÈÈÈÈæȯÉ!ÄÉæÉúÉÊ%Ê@Ê4_Ê”Ê ¦Ê$²Ê&×Ê"þÊ$!Ë FË gË$ˆË­ËÊËéË)Ì2Ì`OÌP°ÌÍ ÍÍ6ÍNÍgÍ}Í+“Í¿Í<ÄÍÎÎ*Î<Î.WÎ.†Î7µÎ?íÎ-ÏGÏ fÏtÏ)ƒÏ,­ÏÚÏðÏÐÐ:Ð?YЙЬÐÂÐÚÐñÐ Ñ"Ñ#9Ñ$]Ñ‚Ñ•Ñ©Ñ +ÁÑÌÑ'áÑ# Ò9-ÒgÒ%vҜҵÒÈÒ?çÒ'ÓAÓ8\Ów•Ó” Ô¢Ô µÔÁÔ!ÐÔ"òÔÕ,)Õ;VÕ2’Õ(ÅÕ(îÕ5ÖMÖjÖ+‰Ö!µÖ×Ö÷Ö×3×.R××’×­×Ã×Û×ò×Ø*ØJØjØ&Ø ¨Ø!ÉØgëØ SÙ tÙ+•Ù1ÁÙóÙ)Ú<Ú'YÚ ÚÚ(œÚ6ÅÚüÚ+ÛHÛ5YÛ*ÛJºÛ.Ü44Ü+iÜ •Ü ¡Ü-«ÜÙÜñÜÝÝ3ÝFÝXÝoÝ Ý+ ÝÌÝëÝ" +Þ-Þ(IÞ rÞ6“ÞÊÞèÞ'ÿÞ'ß>ß"]߀ߕ߱ß(Ñßúß/à?àYàmàà2Šà ½àÞàýà0á JáVá-]á‹á +šá ¥á³áÆá/àá1â!Bâ'dâ'Œâ/´â2äâ7ãOã+fã ’ã1³ã#åã" ä+,ä'Xä&€ä#§ä)Ëä.õä$å#;å_å*åªå¹åÍåàå ÷åææ 0æ:æOæ_ætæ„æžæ¸æ&Óæ&úæ !ç!Bçdçwç}çŒç”ç¨çºç ÉçÖç +êçõç èè .è);èeèzèè(¤è4Íèé-éLé fé‡é£é²éÄéÚéâé÷é ê #ê0ê 7ê Cê Qê_êhêxêˆê›ê°êÇêÖêõê ëë$-ë Rë^ëvëS‘ë åëóë ì#ì :ì+Gìsìxì~ìì®ì¶ì-Óì#í %í2í$Bígí ní zíˆí›í ±í ½íÊí Úíçíöíî&î<îRîhîzî‹îî¬î±îÌîÛî#ëî!ï 1ï>ï\ïoï‰ïœï»ïÚïîïð ð)ð@ð^ðsðˆð¢ð»ð'Úð)ñ.,ñ&[ñ‚ñ¢ñÀñÒñéñ)ò&1òXò.rò(¡ò.Êòùò"ó7óHóXóqóˆó'˜óÀóÕóóó ô'ô*Dô&oô–ô§ôÇôÞôüôõ%7õ]õzõ!šõ¼õÛõ'ïõö)ö;ö$Wö|ö˜ö ®ö ºö Çö Ôöàöðö4 ÷ @÷M÷b÷w÷Œ÷¡÷µ÷Æ÷Ú÷Þ÷'ç÷&ø56ø lø'ø4µø2êø ùY*ù„ú™ú%²ú)Øú1û4ûIû)]û3‡û»û Úû!çû ü ü2üNü,eü’ü ­üºü%Ìü'òü7ýMRý= ýKÞý*þ ?þ+Kþ7wþ6¯þ!æþ9ÿBÿ]ÿGzÿ$Âÿ)çÿ/,An…*žÉçA!-c'‘%¹ß%ù @6V<7ÊET`µDÒ9CQY•MïN= ŒZšbõX_Jw=Â=W>;–LÒ8OX3¨EÜC" Hf B¯ 9ò =, +j +/ +M± +Hÿ +:H :ƒ 4¾ Bó =6 ?t -´ Hâ (+ :T B MÒ N LoC¼\?]0RÎ<!N^W­<FB?‰GÉ5HGMCÞT"hw/à<LMš­ÂàDø<=z’¨Ä$×ü2GM-SM˜5æ,82$U7tz=pï=*`> ‹>(—>'À>'è>'?*8? c?p? ‰?%•?(»?ä?'@+@ ;@ H@ T@3b@–@¶@Í@&ç@+A#:A!^A&€A)§A'ÑA ùA#B%)BGOB?—B#×B ûB+C-4C(bCM‹CYÙC63D-jD+˜D"ÄD!çD# E-E$FEkE!ŠE$¬E>ÑE.F?FXFHwFÀFÚFïF- G7G+SG2G0²G.ãG1H9DH7~HD¶H_ûHK[I'§I(ÏI,øI+%J+QJ}J/J6ÍJ/K+4K>`KEŸKSåK]9L=—L,ÕL0M93MKmMR¹M2 N3?N4sN`¨N" O,,O'YO/O:±O=ìOd*P0P/ÀPðPQFQ#cQ*‡Q²Q +»QÆQ;âQ=RC\R6 R/×RS4S.RS/S?±S'ñSUT8oT7¨TGàT8(URaU<´U +ñU@üUC=VOVCÑVOWÒeWL8\.…\´\-Ä\ò^)a~+d¦ªkƒQmxÕmpNnk¿n +r!8s)Zs!„s ¦s²sÏsés.t4t"Ctft|tt…tŠt ªt´tÓtítuu&4u"[u%~u +¤u!¯uÑu'êuv<)v fvsv"‰v1¬v#Þvw3 wTwmwF„w,Ëw2øw"+xNx!ex‡x¦x'ºxâx ùx-y'Hypy‰y˜y±y:Íy%z.z=z YzzzŽz«zÆzàz ûzL{:U{ +{›{ {&¼{-ã{-|?|O|b|}|6›|>Ò|<}6N}5…}»}Ë}Ý}ð}~~5~L~g~x~‰~›~%¬~'Ò~ú~$#Dh$y4ž0Ó5€:€W€v€‘€ª€¿€1Ú€) "6Y x™!³6Õ" ‚/‚ F‚T‚r‚‚%­‚%Ó‚=ù‚57ƒmƒ#‡ƒ"«ƒ΃éƒÿƒ„3„#Q„u„"”„"·„#Ú„$þ„V#…Ez… À…Ê…Ü… õ…†*†=†,T†*†¬‡LJ/ã‡0ˆ.Dˆsˆ ‡ˆ”ˆ#²ˆÖˆ çˆ ôˆ‰!‰+<‰(h‰)‘‰O»‰? Š;KŠ‡ŠœŠ%¼ŠâŠüŠ‹"0‹"S‹ßv‹VŒ"nŒ‘Œ ¨ŒÉŒáŒ-ÿŒS-–$­&Ò!ù#Ž?Ž_Ž#Ž£Ž¿ŽÝŽ(ýŽ"&eIS¯ +";NnŒ&§ÎBב0‘J‘j‘:‰‘7Ä‘Bü‘J?’Š’¦’Å’Õ’2æ’3“M“c“+s“Ÿ“ ½“KÞ“*”C”V”u”Š”¡” ¹”8Ú”9•pM•f¾•%– B–O–.m–(œ–8Å–þ–)—=—V—+l—-˜—Æ—ß—Jù—oD˜¸´˜m™ „™’™'¤™(Ì™õ™= š1Iš*{š,¦š%Óš-ùš'›G›+g›“›³›+Ì›"ø›œ1;œmœ"œ¢œ½œÚœöœ+.)Z„.™1È/ús*ž'žž)ÆžAðžA2Ÿ/tŸ?¤Ÿ#äŸ2 ; P +i M• ã -¡.¡5>¡/t¡Q¤¡+ö¡7"¢.Z¢‰¢š¢.£¢Ò¢ ê¢ö¢% £1£H£%`£†£%š£4À£$õ£$¤-?¤!m¤4¤ Ĥ?å¤#%¥I¥0i¥š¥$³¥'Ø¥¦¦.:¦1i¦›¦B­¦ð¦§$§ +;§8F§ §% §Ƨ?ä§$¨ 6¨3@¨ t¨ ‚¨¨§¨Ũ8á¨9©&T©3{©*¯©6Ú©7ªIIª“ª5±ª(çªG«2X«,‹«2¸«/ë«0¬)L¬6v¬?­¬í¬2­*9­,d­‘­£­º­ Ï­ð­®®2®8®I®Y®o®€®ž®¹®*Ò®(ý®%&¯&L¯s¯ ‰¯•¯ª¯»¯ѯ쯰° +4°?° U°!b°„°)–°À°Ù°ï°, ±D9±~±*›±"Ʊ!é± ²,²<²O²i²q²‡²Ÿ²¿²вß²ñ²³ ³#³<³L³^³n³€³‘³®³ óѳ.á³ ´´)6´]`´¾´Ñ´ í´µ +$µ)/µYµ]µ)dµŽµ žµ-ªµ:ص%¶ +9¶D¶$\¶¶ ‘¶ ›¶©¶º¶ Ѷ߶î¶ ··"·?·^·w·‘·«·Ç·Ý·ø·¸¸2¸E¸'\¸5„¸ º¸#ȸ츹¹(6¹_¹|¹˜¹ §¹ ±¹*¾¹!é¹ º(ºFºcº!º+¡º/ͺ,ýº%*»"P»s»‘»£»"»»1Þ»6¼G¼1f¼+˜¼3ļø¼'½<½P½c½ €½¡½/´½ä½ ÿ½ ¾<¾-O¾9}¾.·¾æ¾ý¾¿6¿ S¿t¿$¿´¿Ò¿!ï¿"À4À1FÀxÀÀ¢À#ÀÀ!äÀÁ Á2ÁDÁSÁdÁ€Á;›Á×Á!êÁ! Â.ÂIÂ]Âq ŒÂ­Â ±Â(»Â&äÂ= Ã%IÃ'oÃ2—Ã<ÊÃÄ’½@$ß\اhfž‚Êðäžëk–ÎÊ"ªŽçÐÄ`Ø„~bw4`^p¬nÆÌÙyu–»ltPÂF­7ç ߣ˜~O.YK"vÐÔe$¥æ2Žwƒòu®)!vb#sNè¸;KÓ˜º„³Mq† +²JGUí‚wR} 8{J8ÓøêÎuÇ_… òPaødï0Koda}†þ²†;0)îQGc·Döœé?(´—jÕ›p±”š>å,c, +{ƒ3z¿8û9:âïÜ!+y*.1PÕV,£E;±PNIÇ>Ò&[qà×|© +ëѤãˆQ Jº%ÝÅ:º&âô^ŽQãTíë½³êçm|ŸŠ¦Æ(LCGÛk[‚Ñ2^Òó]‰7.g;zjkö!tß+‹¾Áo`<S‡¿*Î ®Þz°v„6©Ï›]TH +p¥3SÂf£¿ñ°à˜š$n8äNˆB•9oiù5LAE#ª¶Oœ÷ÛAáVš1ø€H[åª<XxÃâŒwR™·ôGÉÉW*Yý¯a6Ïm%’{<ÐÄ ÂH~e)¡=Éú ]‰S\—+T]\ä-«eI1BSÒ‹6ü†ÛÜr-kU@¸À?Ë@fó‘l…ó-Ì{Šb ÷AuD‰BÖÈgêK_»  )rÀ:qJ§–Š“_R:qy5R­&ŒÖ¡X„N(LüÆ|"xò2 ݨg$nHj´4‡í+Áæ™Õ# Ó`«D¢µiCm€y5/ÈOÿú’}| U°2þ94Ê'ðiýF³X0VtÄ=•0A´hûW>4'n¦Á ‘ô7 ͯƒI5 tÝ6ù&Y"_¨ €ì>“¯ÞE¾÷ ‹œõhj¬®é§¶ùMž¾C­iÍËöŸ¨á¢áÜ-ÞWL=¢ccfÚŸæÍrÿð“1½3ü¬Ë²s×9å”Q%õ…ZÔMŒØ¹o±@~?ss€g¶ TB‘õ'ü ¹Ù…ƒìhZb?VÚ»ìñ^a¼•zldrY*UÏ (È!èµ›¸àµIýî‡/<ÑïDZ¥þÖe'«×Çp¦ZÙ,¤¤™OXÌÚxFÀÔWîEúÅÃÅ#ˆ F‚¡”/û©}v.ˆ[lñ/·ÿm\=è¹M37 %x釼C—ãd Symbols from %s: @@ -57,39 +50,9 @@ Undefined symbols from %s[%s]: Offset Name - -a, --debug-syms Display debugger-only symbols - -A, --print-file-name Print name of the input file before every symbol - -B Same as --format=bsd - -C, --demangle[=STYLE] Decode low-level symbol names into user-level names - The STYLE, if specified, can be `auto' (the default), - `gnu', 'lucid', 'arm', 'hp', 'edg' or 'gnu-new-abi' - --no-demangle Do not demangle low-level symbol names - -D, --dynamic Display dynamic symbols instead of normal symbols - --defined-only Display only defined symbols - -e (ignored) - -f, --format=FORMAT Use the output format FORMAT. FORMAT can be `bsd', - `sysv' or `posix'. The default is `bsd' - -g, --extern-only Display only external symbols - -h, --help Display this information - -l, --line-numbers Use debugging information to find a filename and - line number for each symbol - -n, --numeric-sort Sort symbols numerically by address - -o Same as -A - -p, --no-sort Do not sort the symbols - -P, --portability Same as --format=posix - -r, --reverse-sort Reverse the sense of the sort - -s, --print-armap Include index for symbols from archive members - --size-sort Sort symbols by size - -t, --radix=RADIX Use RADIX for printing symbol values - --target=BFDNAME Specify the target object format as BFDNAME - -u, --undefined-only Display only undefined symbols - -V, --version Display this program's version number - -X 32_64 (ignored) - + Offset Begin End Expression Start of program headers: - At least one of the following switches must be given: - Line Number Statements: Opcodes: @@ -133,11 +96,13 @@ Hex dump of section '%s': Histogram for bucket list length (total of %d buckets): +Library list section '%s' contains %lu entries: + No version information found in this file. Notes at offset 0x%08lx with length 0x%08lx: -Program Header%s: +Program Headers: Relocation section Relocation section at offset 0x%lx contains %ld bytes: @@ -150,12 +115,16 @@ Section '%s' has no debugging data. Section '.conflict' contains %ld entries: -Section Header%s: +Section Header: + +Section Headers: Symbol table '%s' contains %lu entries: Symbol table for image: +The .debug_loc section is empty. + The .debug_str section is empty. There are %d program headers, starting at offset @@ -178,12 +147,7 @@ Version needs section '%s' contains %ld Version symbols section '%s' contains %d entries: -start address 0x Disassemble the contents of section - Display the contents of DWARF2 debug sections - Display the program headers - Display the sections' header - Dump the contents of section - FileSiz MemSiz Flags Align +start address 0x FileSiz MemSiz Flags Align possible : arm[_interwork], i386, mcore[-elf]{-le|-be}, ppc, thumb %s -M [ @@ -258,12 +223,10 @@ start address 0x %#06x: Name index: %lx %#06x: Name: %s %#06x: Parent %d, name index: %ld %#06x: Parent %d: %s %#06x: Rev: %d Flags: %s %#06x: Version: %d %d %s - (Unknown inline attribute value: %lx) --help Print this help message - --version Print version information - --yydebug Turn on parser debugging - -A or --arch-specific Display architecture specific information (if any). - -D or --use-dynamic Use the dynamic section info when displaying symbols - -H or --help Display this information + (Unknown inline attribute value: %lx) -I --histogram Display histogram of bucket list lengths + -W --wide Allow output width to exceed 80 characters + -H --help Display this information + -v --version Display the version number of readelf -I --input-target Assume input file is in format -O --output-target Create an output file in format -B --binary-architecture Set arch of output file, when input is binary @@ -318,27 +281,22 @@ start address 0x -v --verbose List all object files modified -V --version Display this program's version number -h --help Display this output - -I --input-target Assume input file is in format - -O --output-target Create an output file in format - -F --target Set both input and output format to + -I --input-target= Assume input file is in format + -O --output-target= Create an output file in format + -F --target= Set both input and output format to -p --preserve-dates Copy modified/access timestamps to the output - -R --remove-section Remove section from the output + -R --remove-section= Remove section from the output -s --strip-all Remove all symbol and relocation information - -g -S --strip-debug Remove all debugging symbols + -g -S -d --strip-debug Remove all debugging symbols --strip-unneeded Remove all symbols not needed by relocations - -N --strip-symbol Do not copy symbol - -K --keep-symbol Only copy symbol + -N --strip-symbol= Do not copy symbol + -K --keep-symbol= Only copy symbol -x --discard-all Remove all non-global symbols -X --discard-locals Remove any compiler-generated symbols -v --verbose List all object files modified -V --version Display this program's version number -h --help Display this output -o Place stripped output into - -I or --histogram Display histogram of bucket list lengths - -S or --section-headers or --sections - -V or --version-info Display the version sections (if present) - -W or --wide Don't split lines or truncate symbols to fit into 80 columns - -a or --all Equivalent to: -h -l -S -s -r -d -V -A -I -a, --archive-headers Display archive header information -f, --file-headers Display the contents of the overall file header -p, --private-headers Display object format specific file header contents @@ -354,7 +312,7 @@ start address 0x -T, --dynamic-syms Display the contents of the dynamic symbol table -r, --reloc Display the relocation entries in the file -R, --dynamic-reloc Display the dynamic relocation entries in the file - -V, --version Display this program's version number + -v, --version Display this program's version number -i, --info List object formats and architectures supported -H, --help Display this information -b, --target=BFDNAME Specify the target object format as BFDNAME @@ -376,18 +334,10 @@ start address 0x --[no-]show-raw-insn Display hex alongside symbolic disassembly --adjust-vma=OFFSET Add OFFSET to all displayed section addresses - -d or --dynamic Display the dynamic segment (if present) - -e or --headers Equivalent to: -h -l -S - -h or --file-header Display the ELF file header - -i or --instruction-dump= - -l or --program-headers or --segments - -n or --notes Display the core notes (if present) - -r or --relocs Display the relocations (if present) - -s or --syms or --symbols Display the symbol table - -u or --unwind Display the unwind info (if present) - -v or --version Display the version number of readelf - -w[liaprmfs] or --debug-dump[=line,=info,=abbrev,=pubnames,=ranges,=macro,=frames,=str] - -x or --hex-dump= + -h --help Print this help message + -V --version Print version information + -i --instruction-dump= + Disassemble the contents of section ABI Version: %d Addr: 0x Advance Line by %d to %d Advance PC by %d to %lx @@ -411,18 +361,20 @@ start address 0x Line Range: %d Machine: %s Magic: Minimum Instruction Length: %d + No emulation specific options Num Buc: Value Size Type Bind Vis Ndx Name Num Buc: Value Size Type Bind Vis Ndx Name Num: Index Value Name Number TAG Number of program headers: %ld Number of section headers: %ld OS/ABI: %s + Offset Info Type Sym. Value Sym. Name + Offset Info Type Sym. Value Sym. Name + Addend Offset into .debug_info section: %ld Offset into .debug_info: %lx Offset: %#08lx Link to section: %ld (%s) Offset: %#08lx Link: %lx (%s) Opcode %d has %d args Opcode Base: %d - Options are: Options for %s: Options passed to DLLTOOL: Owner Data size Description @@ -451,7 +403,10 @@ start address 0x Version: %d %s Version: 0x%lx Version: %d - [-X32_64] - (ignored) + [-X32] - ignores 64 bit objects + [-X32_64] - accepts 32 and 64 bit objects + [-X64] - ignores 32 bit objects + [-g] - 32 bit small archive [N] - use instance [count] of name [Nr] Name Type Address Offset [Nr] Name Type Addr Off Size ES Flg Lk Inf Al @@ -478,40 +433,173 @@ start address 0x %lu byte block: (bytes into file) (bytes into file) Start of section headers: (indirect string, offset: 0x%lx): <%d><%lx>: Abbrev Number: %lu (%s) - Addr: Addr: 0x Argument %s ignored DW_MACINFO_define - lineno : %d macro : %s + Addr: Addr: 0x Argument %s ignored At least one of the following switches must be given: + Convert addresses into line number/file name pairs. + Convert an object file into a NetWare Loadable Module + Copies a binary file, possibly transforming it in the process + DW_MACINFO_define - lineno : %d macro : %s DW_MACINFO_end_file DW_MACINFO_start_file - lineno: %d filenum: %d DW_MACINFO_undef - lineno : %d macro : %s DW_MACINFO_vendor_ext - constant : %d string : %s + Display information about the contents of ELF format files + Display information from object . + Display printable strings in [file(s)] (stdin by default) + Displays the sizes of sections inside binary files + Generate an index to speed access to archives + If no addresses are specified on the command line, they will be read from stdin + If no input file(s) are specified, a.out is assumed Length Number %% of total Coverage + List symbols in [file(s)] (a.out by default). None Num: Name BoundTo Flags - Offset Info Type Symbol's Value Symbol's Name - Offset Info Type Symbol's Value Symbol's Name Addend + Offset Info Type Sym. Value Symbol's Name + Offset Info Type Sym. Value Symbol's Name + Addend + Offset Info Type Sym.Value Sym. Name + Offset Info Type Sym.Value Sym. Name + Addend + Options are: + -a --all Equivalent to: -h -l -S -s -r -d -V -A -I + -h --file-header Display the ELF file header + -l --program-headers Display the program headers + --segments An alias for --program-headers + -S --section-headers Display the sections' header + --sections An alias for --section-headers + -e --headers Equivalent to: -h -l -S + -s --syms Display the symbol table + --symbols An alias for --syms + -n --notes Display the core notes (if present) + -r --relocs Display the relocations (if present) + -u --unwind Display the unwind info (if present) + -d --dynamic Display the dynamic segment (if present) + -V --version-info Display the version sections (if present) + -A --arch-specific Display architecture specific information (if any). + -D --use-dynamic Use the dynamic section info when displaying symbols + -x --hex-dump= Dump the contents of section + -w --debug-dump[=line,=info,=abbrev,=pubnames,=ranges,=macro,=frames,=str,=loc] + Display the contents of DWARF2 debug sections + Print a human readable interpretation of a SYSROFF object file + Removes symbols and sections from files + The options are: + The options are: + -A|-B --format={sysv|berkeley} Select output style (default is %s) + -o|-d|-h --radix={8|10|16} Display numbers in octal, decimal or hex + -t --totals Display the total sizes (Berkeley only) + --target= Set the binary file format + -h --help Display this information + -v --version Display the program's version + + The options are: + -I --input-target= Set the input binary file format + -O --output-target= Set the output binary file format + -T --header-file= Read for NLM header information + -l --linker= Use for any linking + -d --debug Display on stderr the linker command line + -h --help Display this information + -v --version Display the program's version + The options are: + -a - --all Scan the entire file, not just the data section + -f --print-file-name Print the name of the file before each string + -n --bytes=[number] Locate & print any NUL-terminated sequence of at + - least [number] characters (default 4). + -t --radix={o,x,d} Print the location of the string in base 8, 10 or 16 + -o An alias for --radix=o + -T --target= Specify the binary file format + -e --encoding={s,b,l,B,L} Select character size and endianness: + s = 8-bit, {b,l} = 16-bit, {B,L} = 32-bit + -h --help Display this information + -v --version Print the program's version number + The options are: + -a, --debug-syms Display debugger-only symbols + -A, --print-file-name Print name of the input file before every symbol + -B Same as --format=bsd + -C, --demangle[=STYLE] Decode low-level symbol names into user-level names + The STYLE, if specified, can be `auto' (the default), + `gnu', 'lucid', 'arm', 'hp', 'edg' or 'gnu-new-abi' + --no-demangle Do not demangle low-level symbol names + -D, --dynamic Display dynamic symbols instead of normal symbols + --defined-only Display only defined symbols + -e (ignored) + -f, --format=FORMAT Use the output format FORMAT. FORMAT can be `bsd', + `sysv' or `posix'. The default is `bsd' + -g, --extern-only Display only external symbols + -l, --line-numbers Use debugging information to find a filename and + line number for each symbol + -n, --numeric-sort Sort symbols numerically by address + -o Same as -A + -p, --no-sort Do not sort the symbols + -P, --portability Same as --format=posix + -r, --reverse-sort Reverse the sense of the sort + -S, --print-size Print size of defined symbols + -s, --print-armap Include index for symbols from archive members + --size-sort Sort symbols by size + -t, --radix=RADIX Use RADIX for printing symbol values + --target=BFDNAME Specify the target object format as BFDNAME + -u, --undefined-only Display only undefined symbols + -X 32_64 (ignored) + -h, --help Display this information + -V, --version Display this program's version number + + The options are: + -b --target= Set the binary file format + -e --exe= Set the input file name (default is a.out) + -s --basenames Strip directory names + -f --functions Show function names + -C --demangle[=style] Demangle function names + -h --help Display this information + -v --version Display the program's version + + The options are: + -h --help Print this help message + -V --version Print version information + The options are: + -h --help Display this information + -v --version Display the program's version + + The options are: + -h --help Display this information + -v --version Print the program's version number + The options are: + -i --input= Name input file + -o --output= Name output file + -I --input-format= Specify input format + -O --output-format= Specify output format + -F --target= Specify COFF target + --preprocessor= Program to use to preprocess rc file + --include-dir= Include directory when preprocessing rc file + -D --define [=] Define SYM when preprocessing rc file + -v --verbose Verbose - tells you what it's doing + --language= Set language when reading rc file + --use-temp-file Use a temporary file instead of popen to read + the preprocessor output + --no-use-temp-file Use popen (default) The options are: + -q --quick (Obsolete - ignoerd) + -n --noprescan Do not perform a scan to convert commons into defs + -d --debug Display information about what is being done + -h --help Display this information + -v --version Print the program's version number and Line by %d to %d at offset 0x%lx contains %lu entries: command specific modifiers: commands: + emulation options: generic modifiers: - program interpreter#lines %d %ld: .bf without preceding function%ld: unexpected .ef + program interpreter type: %x, namesize: %08lx, descsize: %08lx +#lines %d %ld: .bf without preceding function%ld: unexpected .ef %lu %s %s %s %s%c0x%s never used%s %s: %s%s both copied and removed%s exited with status %d%s has no %s section%s is not a valid archive%s is not an archive%s: %s: address out of bounds%s: Can't open input archive %s %s: Can't open output archive %s -%s: Convert a COFF object file into a SYSROFF object file -%s: Convert an object file into a NetWare Loadable Module %s: Error: %s: Failed to read file header -%s: Matching formats:%s: Multiple redefinition of symbol "%s"%s: No dynamic symbols%s: Print a human readable interpretation of a SYSROFF object file -%s: Symbol "%s" is target of more than one redefinition%s: Warning: %s: bad number: %s%s: can not get addresses from archive%s: can't create debugging section: %s%s: can't find module file %s +%s: Matching formats:%s: Multiple redefinition of symbol "%s"%s: No dynamic symbols%s: Symbol "%s" is target of more than one redefinition%s: Warning: %s: bad number: %s%s: can not get addresses from archive%s: can't create debugging section: %s%s: can't find module file %s %s: can't open file %s %s: can't set debugging section contents: %s%s: cannot set time: %s%s: cannot stat: %s%s: don't know how to write debugging information for %s%s: error copying private BFD data: %s%s: execution of %s failed: %s: file %s is not an archive -%s: fread failed%s: fseek to %lu failed: %s%s: invalid output format%s: invalid radix%s: no archive map to update%s: no open archive +%s: fread failed%s: fseek to %lu failed: %s%s: invalid output format%s: invalid radix%s: no archive map to update%s: no open archive %s: no open output archive %s: no output archive specified yet %s: no recognized debugging information%s: no resource section%s: no symbols%s: not a dynamic object%s: not enough binary data%s: printing debugging information failed%s: read of %lu returned %lu%s: read: %s%s: rename: %s%s: section `%s': error in %s: %s%s: simple_copy: %s%s: supported architectures:%s: supported formats:%s: supported targets:%s: unexpected EOF%s: warning: %s: warning: shared libraries can not have uninitialized data%s: warning: unknown size for field `%s' in struct%s:%d: %s -(Unknown location op)(User defined location op)(declared as inline and inlined)(declared as inline but ignored)(inlined)(not inlined)2's complement, big endian2's complement, little endian64-bit DWARF aranges are not supported yet. +'%s'(Unknown location op)(User defined location op)(declared as inline and inlined)(declared as inline but ignored)(inlined)(not inlined)2's complement, big endian2's complement, little endian64-bit DWARF aranges are not supported yet. 64-bit DWARF debug info is not supported yet. 64-bit DWARF format frames are not supported yet. 64-bit DWARF line info is not supported yet. @@ -529,16 +617,18 @@ start address 0x Contents of section %s: Contents of the %s section: +Contents of the .debug_loc section: + Contents of the .debug_str section: -Copyright 2001 Free Software Foundation, Inc. +Convert a COFF object file into a SYSROFF object file +Copyright 2002 Free Software Foundation, Inc. Created lib fileCreating library file: %sCreating stub file: %sCurrent open archive is %s DLLTOOL name : %s DLLTOOL options : %s DRIVER name : %s DRIVER options : %s DYN (Shared object file)Deleting temporary base file %sDeleting temporary def file %sDeleting temporary exp file %sDependency audit libraryDisassembly of section %s: -Display information from object FILE. Displaying the debug contents of section %s is not yet supported. Don't know about relocations on this machine architecture Done reading %sELF Header: @@ -565,9 +655,10 @@ No input-file is stdin, default rc. No I (info), L (link order), G (group), x (unknown) O (extra OS processing required) o (OS specific), p (processor specific) LIBRARY: %s base: %xLast stabs entries before error: -Library rpath: [%s]Library runpath: [%s]Library soname: [%s]List symbols from FILEs (a.out by default). -Machine '%s' not supportedMultiple renames of section %sMust provide at least one of -o or --dllname optionsNAME: %s base: %xNONE (None)NT_FPREGS (floating point registers)NT_FPREGSET (floating point registers)NT_LWPSINFO (lwpsinfo_t structure)NT_LWPSTATUS (lwpstatus_t structure)NT_PRPSINFO (prpsinfo structure)NT_PRSTATUS (prstatus structure)NT_PRXFPREG (user_xfpregs structure)NT_PSINFO (psinfo structure)NT_PSTATUS (pstatus structure)NT_TASKSTRUCT (task structure)NT_WIN32PSTATUS (win32_pstatus strcuture)N_LBRAC not within function -Name Value Class Type Size Line Section +Library rpath: [%s]Library runpath: [%s]Library soname: [%s]Machine '%s' not supportedMultiple renames of section %sMust provide at least one of -o or --dllname optionsNAME: %s base: %xNONE (None)NT_FPREGS (floating point registers)NT_FPREGSET (floating point registers)NT_LWPSINFO (lwpsinfo_t structure)NT_LWPSTATUS (lwpstatus_t structure)NT_PRPSINFO (prpsinfo structure)NT_PRSTATUS (prstatus structure)NT_PRXFPREG (user_xfpregs structure)NT_PSINFO (psinfo structure)NT_PSTATUS (pstatus structure)NT_TASKSTRUCT (task structure)NT_WIN32PSTATUS (win32_pstatus structure)N_LBRAC not within function +Name Value Class Type Size Line Section + +Name Value Class Type Size Line Section Name index: %ld Name: %s @@ -584,26 +675,10 @@ No input-file is stdin, default rc. No Only DWARF 2 pubnames are currently supported Only DWARF version 2 line info is currently supported. Only version 2 DWARF debug information is currently supported. -Opened temporary file: %sOperating System specific: %lxOptions: - -i FILE, --input FILE Name input file - -o FILE, --output FILE Name output file - -I FORMAT, --input-format FORMAT - Specify input format - -O FORMAT, --output-format FORMAT - Specify output format - -F TARGET, --target TARGET Specify COFF target - --preprocessor PROGRAM Program to use to preprocess rc file - --include-dir DIR Include directory when preprocessing rc file - -DSYM[=VAL], --define SYM[=VAL] - Define SYM when preprocessing rc file - -v Verbose - tells you what it's doing - --language VAL Set language when reading rc file - --use-temp-file Use a temporary file instead of popen to read - the preprocessor output - --no-use-temp-file Use popen (default) -Out of memoryOut of memory +Opened temporary file: %sOperating System specific: %lxOut of memoryOut of memory Out of memory allocating %d bytes for %s -Out of memory allocating dump request table.Out of virtual memoryPT_FIRSTMACH+%dPT_GETFPREGS (fpreg structure)PT_GETREGS (reg structure)Pascal file name not supportedProcessed def fileProcessed definitionsProcessing def file: %sProcessing definitionsProcessor Specific: %lxProcessor Specific: (%x)REL (Relocatable file)Reading %s section of %s failed: %sReading %s section of %s failed: %s +Out of memory allocating dump request table.Out of virtual memoryPT_FIRSTMACH+%dPT_GETFPREGS (fpreg structure)PT_GETREGS (reg structure)Pascal file name not supportedPrint a human readable interpretation of a SYSROFF object file +Processed def fileProcessed definitionsProcessing def file: %sProcessing definitionsProcessor Specific: %lxProcessor Specific: (%x)REL (Relocatable file)Reading %s section of %s failed: %sReading %s section of %s failed: %s Report bugs to %s Report bugs to %s. Scanning object file %sSections: @@ -634,35 +709,22 @@ the GNU General Public License. This pr Unable to seek to %x for %s Unable to seek to end of file Unable to seek to end of file!Unable to seek to start of dynamic informationUndefined N_EXCLUnhandled data length: %d -Unknown AT value: %lxUnknown FORM value: %lxUnknown TAG value: %lxUnknown note type: (0x%08x)Unrecognised debug option '%s' -Unrecognised debug section: %s -Unrecognised form: %d -Unrecognized XCOFF type %d -Usage %s -Usage: %s in-file [out-file] -Usage: %s in-file(s) -Usage: %s OPTION... FILE... -Usage: %s [-A | --format=sysv | -B | --format=berkeley] - [-o | --radix=8 | -d | --radix=10 | -h | --radix=16] - [-V | --version] [--target=bfdname] [--help] [file...] -Usage: %s [-CfsHV] [-b bfdname] [--target=bfdname] - [-e executable] [--exe=executable] [--demangle[=style]] - [--basenames] [--functions] [addr addr ...] -Usage: %s [-X32_64] [-]{dmpqrstx}[abcfilNoPsSuvV] [member-name] [count] archive-file file... -Usage: %s [-afov] [-n min-len] [-min-len] [-t {o,x,d}] [-e {s,b,l,B,L}] - [-] [--all] [--print-file-name] [--bytes=min-len] [--radix={o,x,d}] - [--target=bfdname] [--encoding {s,b,l,B,L}] [--help] [--version] file... -Usage: %s [-dhV] [-I bfdname] [-O bfdname] [-T header-file] [-l linker] - [--input-target=bfdname] [--output-target=bfdname] - [--header-file=file] [--linker=linker] [--debug] - [--help] [--version] - [in-file [out-file]] -Usage: %s [-dhVq] in-file [out-file] -Usage: %s [-hV] in-file -Usage: %s [-vV] archive -Usage: %s [OPTION]... [FILE]... -Usage: %s [options] [input-file] [output-file] -Usage: readelf {options} elf-file(s) +Unknown AT value: %lxUnknown FORM value: %lxUnknown TAG value: %lxUnknown note type: (0x%08x)Unrecognized XCOFF type %d +Unrecognized debug option '%s' +Unrecognized debug section: %s +Unrecognized form: %d +Usage %s +Usage: %s +Usage: %s in-file(s) +Usage: %s [emulation options] [-]{dmpqrstx}[abcfilNoPsSuvV] [member-name] [count] archive-file file... +Usage: %s [option(s)] [addr(s)] +Usage: %s [option(s)] [file(s)] +Usage: %s [option(s)] [in-file [out-file]] +Usage: %s [option(s)] [input-file] [output-file] +Usage: %s [option(s)] in-file +Usage: %s [option(s)] in-file [out-file] +Usage: %s [options] archive +Usage: readelf elf-file(s) Using `%s' Using file: %sUsing popen to read preprocessor output Using temporary file `%s' to read preprocessor output @@ -670,23 +732,22 @@ the GNU General Public License. This pr Warning: Output file cannot represent architecture %sWarning: changing type size from %d to %d Warning: input target 'binary' required for binary architecture parameter.Warning: truncating gap-fill from 0x%s to 0x%x`N' is only meaningful with the `x' and `d' options.`u' is only meaningful with the `r' option.acceleratoralignmentalternate machine code index must be positivearchitecture %s unknownarchitecture: %s, bad ATN65 recordbad C++ field bit pos or sizebad dynamic symbolbad format for %sbad mangled name `%s' bad misc recordbad type for C++ method functionbadly formed extended line op encountered! -bfd_coff_get_auxent failed: %sbfd_coff_get_syment failed: %sbfd_open failed open stub file: %sblocks left on stack at endbyte number must be less than interleavebyte number must be non-negativecan not determine type of file `%s'; use the -I optioncan't create section `%s': %scan't execute `%s': %scan't get BFD_RELOC_RVA relocation typecan't open %s `%s': %scan't open `%s' for output: %scan't open temporary file `%s': %scan't popen `%s': %scan't read resource sectioncan't redirect stdout: `%s': %scan't set BFD default target to `%s': %scannot delete %s: %scannot mkdir %s for archive copying (error: %s)cannot open input file %scannot open: %s: %scannot stat: %s: %sconflictconflict list with without tableconst/volatile indicator missingcontrol data requires DIALOGEXcopy from %s(%s) to %s(%s) +bfd_coff_get_auxent failed: %sbfd_coff_get_syment failed: %sbfd_open failed open stub file: %sblocks left on stack at endbyte number must be less than interleavebyte number must be non-negativecan not determine type of file `%s'; use the -I optioncan't create section `%s': %scan't execute `%s': %scan't get BFD_RELOC_RVA relocation typecan't open %s `%s': %scan't open `%s' for output: %scan't open temporary file `%s': %scan't popen `%s': %scan't read resource sectioncan't redirect stdout: `%s': %scan't set BFD default target to `%s': %scannot delete %s: %scannot mkdir %s for archive copying (error: %s)cannot open input file %scannot open: %s: %scannot stat: %s: %sconflictconflict list found without a dynamic symbol tableconst/volatile indicator missingcontrol data requires DIALOGEXcopy from %s(%s) to %s(%s) +corrupt note found at offset %x into core notes creating %scursorcursor file `%s' does not contain cursor datacustom sectiondata entrydata size %lddebug section datadebug_abbrev section datadebug_add_to_current_namespace: no current filedebug_end_block: attempt to close top level blockdebug_end_block: no current blockdebug_end_common_block: not implementeddebug_end_function: no current functiondebug_end_function: some blocks were not closeddebug_find_named_type: no current compilation unitdebug_get_real_type: circular debug information for %s -debug_make_undefined_type: unsupported kinddebug_name_type: no current filedebug_record_function: no debug_set_filename calldebug_record_label not implementeddebug_record_line: no current unitdebug_record_parameter: no current functiondebug_record_variable: no current blockdebug_record_variable: no current filedebug_start_block: no current blockdebug_start_common_block: not implementeddebug_start_source: no debug_set_filename calldebug_str section datadebug_tag_type: extra tag attempteddebug_tag_type: no current filedebug_write_type: illegal type encountereddefault is --format=berkeley -default is --format=sysv -dialog controldialog control datadialog control enddialog font point sizedialog headerdialogex controldialogex font informationdirectorydirectory entry namedynamic segmentdynamic string tabledynamic stringsexpression stack mismatchexpression stack overflowexpression stack underflowfailed to open temporary head file: %sfailed to open temporary tail file: %sfilename required for COFF inputfilename required for COFF outputfixed version infoflagsflags 0x%08x: -fontdirfontdir device namefontdir face namefontdir headergroup cursorgroup cursor headergroup icongroup icon headerhas childrenhelp ID requires DIALOGEXhelp sectionicon file `%s' does not contain icon dataillegal option -- %cillegal type indexillegal variable indexinput and output files must be differentinput file named both on command line and with INPUTinterleave must be positiveinternal error -- this option not implementedinternal stat error on %sinvalid argument to --format: %sinvalid integer argument %sinvalid numberinvalid number %sinvalid string lengthliblistmake .bss sectionmake .nlmsections sectionmake sectionmakingmenu headermenuex headermenuex offsetmenuitemmenuitem headermessage sectionmissing index typemissing required ASNmissing required ATN65module sectionmore than one dynamic segment +debug_loc section datadebug_make_undefined_type: unsupported kinddebug_name_type: no current filedebug_record_function: no debug_set_filename calldebug_record_label: not implementeddebug_record_line: no current unitdebug_record_parameter: no current functiondebug_record_variable: no current blockdebug_record_variable: no current filedebug_start_block: no current blockdebug_start_common_block: not implementeddebug_start_source: no debug_set_filename calldebug_str section datadebug_tag_type: extra tag attempteddebug_tag_type: no current filedebug_write_type: illegal type encountereddialog controldialog control datadialog control enddialog font point sizedialog headerdialogex controldialogex font informationdirectorydirectory entry namedynamic segmentdynamic string tabledynamic stringsexpression stack mismatchexpression stack overflowexpression stack underflowfailed to open temporary head file: %sfailed to open temporary tail file: %sfilename required for COFF inputfilename required for COFF outputfixed version infoflagsflags 0x%08x: +fontdirfontdir device namefontdir face namefontdir headergroup cursorgroup cursor headergroup icongroup icon headerhas childrenhelp ID requires DIALOGEXhelp sectionicon file `%s' does not contain icon dataillegal option -- %cillegal type indexillegal variable indexinput and output files must be differentinput file named both on command line and with INPUTinterleave must be positiveinternal error -- this option not implementedinternal stat error on %sinvalid argument to --format: %sinvalid integer argument %sinvalid numberinvalid number %sinvalid string lengthliblistliblist string tablemake .bss sectionmake .nlmsections sectionmake sectionmakingmenu headermenuex headermenuex offsetmenuitemmenuitem headermessage sectionmissing index typemissing required ASNmissing required ATN65module sectionmore than one dynamic segment named directory entrynamed resourcenamed subdirectoryno argument types in mangled string no childrenno entry %s in archive no entry %s in archive %s!no export definition file provided. Creating one, but that may not be what you wantno input fileno input file specifiedno name for output fileno operation specifiedno resourcesno type information for C++ method functionnonenotesnull terminated unicode stringnumeric overflowoptionsout of memory parsing relocsoverflow when adjusting relocation against %sparse_coff_type: Bad type code 0x%xprivate dataprogram headersreference parameter is not a pointerrelocsresource IDresource dataresource data sizeresource type unknownrpc sectionsection datasection headersset .bss vmaset .data sizeset .nlmsection contentsset .nlmsections flagsset .nlmsections sizeset Address to 0x%lx -set section alignmentset section flagsset section sizeset start addressshared sectionsizestab_int_type: bad size %ustack overflowstack underflowstat failed on bitmap file `%s': %sstat returns negative size for %sstring tablestring_hash_lookup failed: %sstringtable stringstringtable string lengthstub section sizessubprocess got fatal signal %dsupport not compiled in for %ssupported flags: %ssymbol informationsymbolssymtab shndxtwo different operation options specifiedunable to open output file %sundefined C++ objectundefined C++ vtableundefined variable in ATNundefined variable in TYunexpected dialog signature %dunexpected end of debugging informationunexpected fixed version info version %luunexpected fixed version information length %dunexpected fixed version signature %luunexpected group cursor type %dunexpected group icon type %dunexpected numberunexpected record typeunexpected string in C++ miscunexpected stringfileinfo value length %dunexpected varfileinfo value length %dunexpected version stringunexpected version string length %d != %d + %dunexpected version string length %d < %dunexpected version stringtable value length %dunexpected version type %dunexpected version value length %dunknown ATN typeunknown BB typeunknown C++ encoded nameunknown C++ visibilityunknown TY codeunknown alternate machine code, ignoredunknown builtin typeunknown demangling style `%s'unknown format type `%s'unknown sectionunknown virtual character for baseclassunknown visibility character for baseclassunknown visibility character for fieldunnamed $vb typeunrecognised: %-7lxunrecognized --endian type `%s'unrecognized -E optionunrecognized C++ abbreviationunrecognized C++ default typeunrecognized C++ misc recordunrecognized C++ object overhead specunrecognized C++ object specunrecognized C++ reference typeunrecognized cross reference typeunrecognized section flag `%s'unresolved PC relative reloc against %sunsupported ATN11unsupported ATN12unsupported C++ object typeunsupported IEEE expression operatorunsupported menu version %dunsupported qualiferunwind infounwind tableversion dataversion defversion def auxversion definition sectionversion length %d does not match resource length %luversion needversion need aux (2)version need aux (3)version need sectionversion string tableversion symbol dataversion var infoversion varfileinfovmawait: %swarning: CHECK procedure %s not definedwarning: EXIT procedure %s not definedwarning: MAP and FULLMAP are not supported; try ld -Mwarning: No version number givenwarning: START procedure %s not definedwarning: input and output formats are not compatiblewarning: symbol %s imported but not in import listwriting stubProject-Id-Version: binutils 2.12-pre020121 -POT-Creation-Date: 2002-01-17 13:58+0000 -PO-Revision-Date: 2002-02-04 21:49EET +set section alignmentset section flagsset section sizeset start addressshared sectionsizestab_int_type: bad size %ustack overflowstack underflowstat failed on bitmap file `%s': %sstat returns negative size for %sstring tablestring_hash_lookup failed: %sstringtable stringstringtable string lengthstub section sizessubprocess got fatal signal %dsupport not compiled in for %ssupported flags: %ssymbol informationsymbolssymtab shndxtwo different operation options specifiedunable to open output file %sundefined C++ objectundefined C++ vtableundefined variable in ATNundefined variable in TYunexpected DIALOGEX version %dunexpected end of debugging informationunexpected fixed version info version %luunexpected fixed version information length %dunexpected fixed version signature %luunexpected group cursor type %dunexpected group icon type %dunexpected numberunexpected record typeunexpected string in C++ miscunexpected stringfileinfo value length %dunexpected varfileinfo value length %dunexpected version stringunexpected version string length %d != %d + %dunexpected version string length %d < %dunexpected version stringtable value length %dunexpected version type %dunexpected version value length %dunknown ATN typeunknown BB typeunknown C++ encoded nameunknown C++ visibilityunknown TY codeunknown alternate machine code, ignoredunknown builtin typeunknown demangling style `%s'unknown format type `%s'unknown sectionunknown virtual character for baseclassunknown visibility character for baseclassunknown visibility character for fieldunnamed $vb typeunrecognized --endian type `%s'unrecognized -E optionunrecognized C++ abbreviationunrecognized C++ default typeunrecognized C++ misc recordunrecognized C++ object overhead specunrecognized C++ object specunrecognized C++ reference typeunrecognized cross reference typeunrecognized section flag `%s'unrecognized: %-7lxunresolved PC relative reloc against %sunsupported ATN11unsupported ATN12unsupported C++ object typeunsupported IEEE expression operatorunsupported menu version %dunsupported qualifierunwind infounwind tableversion dataversion defversion def auxversion definition sectionversion length %d does not match resource length %luversion needversion need aux (2)version need aux (3)version need sectionversion string tableversion symbol dataversion var infoversion varfileinfovmawait: %swarning: CHECK procedure %s not definedwarning: EXIT procedure %s not definedwarning: MAP and FULLMAP are not supported; try ld -Mwarning: No version number givenwarning: START procedure %s not definedwarning: input and output formats are not compatiblewarning: symbol %s imported but not in import listwriting stubProject-Id-Version: binutils 2.12.91 +POT-Creation-Date: 2002-07-23 15:55-0400 +PO-Revision-Date: 2002-08-10 21:49EET Last-Translator: Deniz Akkus Kanca Language-Team: Turkish MIME-Version: 1.0 -Content-Type: text/plain; charset=ISO-8859-9 +Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Generator: KBabel 0.9.5 @@ -699,689 +760,740 @@ X-Generator: KBabel 0.9.5 -%s'de tanýmlanmamýþ semboller: +%s'de tanımlanmamış semboller: -%s[%s]'de tanýmlanmamýþ semboller: +%s[%s]'de tanımlanmamış semboller: - [Yazýlým yorumlayýcýsý isteniyor: %s] + [Yazılım yorumlayıcısı isteniyor: %s] Adres Uzunluk - Basamak Ýsim - - -a, --debug-syms Yalnýzca hata ayýklamaya dair sembolleri gösterir - -A, --print-file-name Her sembolden önce girdi dosyasýnýn adýný yazdýrýr - -B --format=bsd ile ayný - -C, --demangle[=TARZ] Alt düzey sembol adlarýný kullanýcý seviyesinde adlara çevirir - TARZ, eðer belirtilirse, 'auto' (öntanýmlý), - `gnu', 'lucid', 'arm', 'hp', 'edg' veya 'gnu-new-abi' olabilir - --no-demangle Alt düzey sembol adlarýný çevirmez - -D, --dynamic Normal semboller yerine dinamik sembolleri gösterir - --defined-only Yalnýzca tanýmlanmýþ sembolleri gösterir - -e (yoksayýlýr) - -f, --format=BÝÇEM Çýktý biçemi için BÝÇEM'i kullanýr. BÝÇEM, 'bsd' (öntanýmlý), - `sysv' veya `posix' olabilir - -g, --extern-only Yalnýzca harici sembolleri gösterir - -h, --help Bu bilgiyi gösterir - -l, --line-numbers Hata ayýklama bilgisini kullanarak her sembol için bir - satýr numarasý ve dosya adý bulur. - -n, --numeric-sort Sembolleri adres numarasýna göre sýralar - -o -A ile ayný - -p, --no-sort Sembolleri sýralamaz - -P, --portability --format=posix ile ayný - -r, --reverse-sort Ters sýralar - -s, --print-armap Arþiv üyelerinden gelen semboller için endeks içerir - --size-sort Sembolleri büyüklüðe göre sýralar - -t, --radix=RADIX Sembol deðerlerini yazdýrmak için RADIX kullanýr - --target=BFD_ADI Hedef nesne biçemini BFD_ADI olarak belirler - -u, --undefined-only Yalnýzca tanýmlanmamýþ sembolleri gösterir - -V, --version Sürüm bilgilerini gösterir - -X 32_64 (yoksayýlýr) - + Basamak Ä°sim - Yazýlým baþlýklarý baþlangýcý: - En azýndan aþaðýdaki seçeneklerin biri verilmelidir: + Görece BaÅŸlan. Son Ä°fade - Satýr Numarasý Deyimleri: + Yazılım baÅŸlıkları baÅŸlangıcı: + Satır Numarası Deyimleri: Opkodlar: - Bölümden parçaya eþleþme: + Bölümden parçaya eÅŸleÅŸme: - Dizin Tablosu boþ. + Dizin Tablosu boÅŸ. Dizin Tablosu: - Dosya Adý Tablosu boþ. + Dosya Adı Tablosu boÅŸ. - Dosya Adý Tablosu: + Dosya Adı Tablosu: - Aþaðýdaki seçenekler isteðe baðlý: + AÅŸağıdaki seçenekler isteÄŸe baÄŸlı: -%s: %s dosya biçemi +%s: %s dosya biçemi -<üye %s> +<üye %s> -Arþiv endeksi: +ArÅŸiv endeksi: -%s bölümünün üretici dökümü +%s bölümünün üretici dökümü -Geri alma bilgi bölümü bulunamadý -%s bölümünün hata ayýklama içeriði dökümü: +Geri alma bilgi bölümü bulunamadı +%s bölümünün hata ayıklama içeriÄŸi dökümü: -Göreli konum 0x%lx'de yer alan dinamik bilgi parçasý %d girdi içeriyor: +Göreli konum 0x%lx'de yer alan dinamik bilgi parçası %d girdi içeriyor: -Göreli konum 0x%x'deki dinamik parça %ld girdi içeriyor: +Göreli konum 0x%x'deki dinamik parça %ld girdi içeriyor: -Dinamik sembolleri göstermek için dinamik sembol bilgisi mevcut deðil. +Dinamik sembolleri göstermek için dinamik sembol bilgisi mevcut deÄŸil. Elf dosya tipi: %s Dosya: %s -'%s' bölümünün onaltýlýk dökümü: +'%s' bölümünün onaltılık dökümü: -Küme liste boyu (toplam %d küme) geçmiþ grafiði: +Küme liste boyu (toplam %d küme) geçmiÅŸ grafiÄŸi: -Bu dosyada sürüm bilgisi yok. +Kitaplık liste bölümü '%s', %lu girdi içeriyor: -0x%08lx göreli konumunda, 0x%08lx uzunluðunda notlar: +Bu dosyada sürüm bilgisi yok. -Yazýlým Baþlýðý%s: +0x%08lx göreli konumunda, 0x%08lx uzunluÄŸunda notlar: -Yer deðiþtirme bölümü -Göreli konum 0x%lx'da yer deðiþtirme bölümü %ld bayt içeriyor: +Yazılım BaÅŸlıkları: -'%s' bölümü %d girdi içeriyor: +Yer deÄŸiÅŸtirme bölümü +Göreli konum 0x%lx'da yer deÄŸiÅŸtirme bölümü %ld bayt içeriyor: -'%s' bölümünde dökülecek veri yok. +'%s' bölümü %d girdi içeriyor: -'%s' bölümünde hata ayýklama bilgisi yok. +'%s' bölümünde dökülecek veri yok. -'.conflict' bölümü %ld girdi içeriyor: +'%s' bölümünde hata ayıklama bilgisi yok. -Bölüm Baþlýðý%s: +'.conflict' bölümü %ld girdi içeriyor: -'%s' sembol tablosu %lu girdi içeriyor: +Bölüm BaÅŸlığı: -Ýmaj için sembol tablosu: +Bölüm BaÅŸlıkları: -.debug_str bölümü boþ. +'%s' sembol tablosu %lu girdi içeriyor: -%d adet yazýlým baþlýðý var, göreli konumdan baþlanýyor -Bu dosyada dinamik yer deðiþtirmeler yok. +Ä°maj için sembol tablosu: -Bu dosyada yazýlým baþlýðý yok. +.debug_loc bölümü boÅŸ. -Bu dosyada yer deðiþtirmeler yok. +.debug_str bölümü boÅŸ. -Bu dosyada bölüm yok. +%d adet yazılım baÅŸlığı var, göreli konumdan baÅŸlanıyor +Bu dosyada dinamik yer deÄŸiÅŸtirmeler yok. -Bu dosyada geri alma bölümü yok. +Bu dosyada yazılım baÅŸlığı yok. -Bu dosyada dinamik parça yok. +Bu dosyada yer deÄŸiÅŸtirmeler yok. -Geri alma bölümü -Sürüm tanýmý bölümü '%s' %ld girdi içeriyor: +Bu dosyada bölüm yok. -Sürüm gereksinimleri bölümü '%s' %ld girdi içeriyor: +Bu dosyada geri alma bölümü yok. -Sürüm sembolleri bölümü '%s' %d girdi içeriyor: +Bu dosyada dinamik parça yok. -baþlangýç adresi 0x bölümünün içeriðini karþýt-çevirir - DWARF2 hata ayýklama bölümlerinin içeriðini gösterir - Yazýlým baþlýklarýný gösterir - Bölüm baþlýklarýný gösterir - bölümünün içeriðini gösterir - DosyaBoyu BellekBoyu Seç Hiza - tanýmlý : arm[_interwork], i386, mcore[-elf]{-le|-be}, ppc, thumb - %s -M [ 'yi ihraç etmez - --export-all-symbols Bütün sembolleri .def'e ihraç eder - --no-default-excludes Öntanýmlý ihraç edilmeyecek sembol listesini boþaltýr - --no-export-all-symbols Yalnýzca listelenmiþ sembolleri ihraç eder +Geri alma bölümü +Sürüm tanımı bölümü '%s' %ld girdi içeriyor: + +Sürüm gereksinimleri bölümü '%s' %ld girdi içeriyor: + +Sürüm sembolleri bölümü '%s' %d girdi içeriyor: + +baÅŸlangıç adresi 0x DosyaBoyu BellekBoyu Seç Hiza + tanımlı : arm[_interwork], i386, mcore[-elf]{-le|-be}, ppc, thumb + %s -M [ 'yi ihraç etmez + --export-all-symbols Bütün sembolleri .def'e ihraç eder + --no-default-excludes Öntanımlı ihraç edilmeyecek sembol listesini boÅŸaltır + --no-export-all-symbols Yalnızca listelenmiÅŸ sembolleri ihraç eder + --yydebug Tarayıcıda hata ayıklamayı etkinleÅŸtirir %-18s %s - Görece Bilgi Tür Sembol Deðeri Sembol Adý - Görece Bilgi Tür Sembol Deðeri Sembol Adý Sonekleme + Görece Bilgi Tür Sembol DeÄŸeri Sembol Adı + Görece Bilgi Tür Sembol DeÄŸeri Sembol Adı + Sonek %d %ld %s [%s] - --add-indirect Dll yönlendirmelerini ihraç dosyasýna ekler. - --add-stdcall-alias Rumuzlarý @ olmaksýzýn ekler - --as Üretici olarak 'i kullanýr - --base-file Baðlayýcý tarafýndan oluþturulan temel dosyayý okur - --def Girdi .def dosyasý adý - --dllname Çýktý kitaplýðýna konulacak girdi dll adý. - --dlltool-name "dlltool"a öntanýmlý - --driver-flags Öntanýmlý ld seçeneklerinin yerine geçer - --driver-name "gcc"ye öntanýmlý - --dry-run Çalýþtýrýlmasý gerekenleri gösterir - --entry Alternatif DLL giriþ noktasý belirtir - --exclude-symbols deki sembolleri .def'e ihraç etmez - --export-all-symbols Bütün sembolleri .def'e ihraç eder - --image-base Ýmaj temel adresini belirtir - --implib <çýktý_adý> --output-lib ile eþanlamlý + --add-indirect Dll yönlendirmelerini ihraç dosyasına ekler. + --add-stdcall-alias Rumuzları @ olmaksızın ekler + --as Ãœretici olarak 'i kullanır + --base-file BaÄŸlayıcı tarafından oluÅŸturulan temel dosyayı okur + --def Girdi .def dosyası adı + --dllname Çıktı kitaplığına konulacak girdi dll adı. + --dlltool-name "dlltool"a öntanımlı + --driver-flags Öntanımlı ld seçeneklerinin yerine geçer + --driver-name "gcc"ye öntanımlı + --dry-run Çalıştırılması gerekenleri gösterir + --entry Alternatif DLL giriÅŸ noktası belirtir + --exclude-symbols deki sembolleri .def'e ihraç etmez + --export-all-symbols Bütün sembolleri .def'e ihraç eder + --image-base Ä°maj temel adresini belirtir + --implib <çıktı_adı> --output-lib ile eÅŸanlamlı --machine - --mno-cygwin Mingw DLL oluþturur - --no-default-excludes Dýþlanacak sembol öntanýmlarýný boþaltýr - --no-export-all-symbols Yalnýzca .drectve sembollerini ihraç eder - --no-idata4 idata$4 bölümünü oluþturmaz - --no-idata5 idata$5 bölümünü oluþturmaz - --nodelete Geçici dosyalarý tutar. - --output-def Çýktý .def dosyasýnýn adý - --output-exp <çýktý_adý> Ýhraç dosyasý oluþturur. - --output-lib <çýktý_adý> Girdi kitaplýðý oluþturur. - --quiet, -q Sessiz çalýþýr + --mno-cygwin Mingw DLL oluÅŸturur + --no-default-excludes Dışlanacak sembol öntanımlarını boÅŸaltır + --no-export-all-symbols Yalnızca .drectve sembollerini ihraç eder + --no-idata4 idata$4 bölümünü oluÅŸturmaz + --no-idata5 idata$5 bölümünü oluÅŸturmaz + --nodelete Geçici dosyaları tutar. + --output-def Çıktı .def dosyasının adı + --output-exp <çıktı_adı> Ä°hraç dosyası oluÅŸturur. + --output-lib <çıktı_adı> Girdi kitaplığı oluÅŸturur. + --quiet, -q Sessiz çalışır --target hedef makina, i386-cygwin32 veya i386-mingw32 - --verbose, -v Açýklamalý - --version dllwrap sürümünü yazdýrýr - -A --add-stdcall-alias Rumuzlarý @ içermeksizin ekler. - -C --compat-implib Geçmiþe uyumlu ithal kitaplýðý oluþturur. - -D --dllname Arayüz kitaplýðýna eklenecek girdi dll adý. - -F --linker-flags i baðlayýcýya geçirir. - -L --linker Baðlayýcý olarak kullanýr. - -M --mcore-elf <çýktý_adý> mcore-elf nesne dosyalarýný <çýktý_adý>'na iþler. - -S --as Üretici olarak kullanýr. + --verbose, -v Açıklamalı + --version dllwrap sürümünü yazdırır + -A --add-stdcall-alias Rumuzları @ içermeksizin ekler. + -C --compat-implib GeçmiÅŸe uyumlu ithal kitaplığı oluÅŸturur. + -D --dllname Arayüz kitaplığına eklenecek girdi dll adı. + -F --linker-flags i baÄŸlayıcıya geçirir. + -L --linker BaÄŸlayıcı olarak kullanır. + -M --mcore-elf <çıktı_adı> mcore-elf nesne dosyalarını <çıktı_adı>'na iÅŸler. + -S --as Ãœretici olarak kullanır. -U .lib'e alt-tire ekler - -U --add-underscore Arayüz kitaplýðýndaki sembollere alt-tire ekler. - -V --version Sürüm bilgilerini gösterir. - -a --add-indirect Ýhraç dosyasýna dll yönlendirmelerini ekler. - -b --base-file Baðlayýcýnýn oluþturduðu temel dosyayý okur. - -c --no-idata5 idata$5 bölümü oluþturmaz. - -d --input-def Okunacak .def dosyasýnýn adý. - -e --output-exp <çýktýadý> Ýhraç dosyasý oluþturur. - -f --as-flags Üreticiye i geçirir. - -h --help Bu yardýmý gösterir. - -k @'i ihraç edilmiþ isimlerden çýkartýr - -k --kill-at Ýhraç edilmiþ isimlerden @'da öldürür. - -l --output-lib <çýktýadý> Arayüz kitaplýðý oluþturur. - -m --machine için DLL olarak oluþtur. [öntanýmlý: %s] - -n --no-delete Geçici dosyalarý tutar (daha da koruyucu olmasý için tekrarlanabilir). - -v --verbose Açýklama verir. - -x --no-idata4 idata$4 bölümü oluþturmaz. - -z --output-def Oluþturulacak .def dosyasýnýn adý. - 0 (*yerel*) 1 (*evrensel*) Kýsaltma Basamaðý: %ld + -U --add-underscore Arayüz kitaplığındaki sembollere alt-tire ekler. + -V --version Sürüm bilgilerini gösterir. + -a --add-indirect Ä°hraç dosyasına dll yönlendirmelerini ekler. + -b --base-file BaÄŸlayıcının oluÅŸturduÄŸu temel dosyayı okur. + -c --no-idata5 idata$5 bölümü oluÅŸturmaz. + -d --input-def Okunacak .def dosyasının adı. + -e --output-exp <çıktıadı> Ä°hraç dosyası oluÅŸturur. + -f --as-flags Ãœreticiye i geçirir. + -h --help Bu yardımı gösterir. + -k @'i ihraç edilmiÅŸ isimlerden çıkartır + -k --kill-at Ä°hraç edilmiÅŸ isimlerden @'da öldürür. + -l --output-lib <çıktıadı> Arayüz kitaplığı oluÅŸturur. + -m --machine için DLL olarak oluÅŸtur. [öntanımlı: %s] + -n --no-delete Geçici dosyaları tutar (daha da koruyucu olması için tekrarlanabilir). + -v --verbose Açıklama verir. + -x --no-idata4 idata$4 bölümü oluÅŸturmaz. + -z --output-def OluÅŸturulacak .def dosyasının adı. + 0 (*yerel*) 1 (*evrensel*) Kısaltma Basamağı: %ld Uzunluk: %ld - Num: Deðer Boy Tip Bað Gör Ndx Ýsim - Num: Deðer Boy Tip Bað Gör Ndx Ýsim - Gösterge Boyu: %d - Sürüm: %d - %#06x: Ýsim endeksi: %lx %#06x: Ýsim: %s %#06x: Üst %d, isim endeksi: %ld - %#06x: Üst %d: %s - %#06x: Sür: %d Seçenek: %s %#06x: Sürüm: %d %d %s - (Bilinmeyen inline öznitelik deðeri: %lx) --help Bu yardýmý gösterir - --version Sürüm bilgisini gösterir - --yydebug Tarayýcýda hata ayýklamayý etkinleþtirir - -A veya --arch-specific (Eðer varsa) mimariye özel bilgiyi gösterir. - -D veya --use-dynamic Sembolleri gösterirken dinamik bölüm bilgisini kullanýr - -H veya --help Bu bilgiyi gösterir - -I --input-target Girdi dosyasýnýn biçeminde - olduðunu varsayar - -O --output-target Çýktý dosyasýný biçeminde - oluþturur - -B --binary-architecture Girdi ikilik biçeminde olduðu zaman çýktý - dosyasýnýn platformunu belirler. - -F --target Hem girdi, hem de çýktý biçemini + Num: DeÄŸer Boy Tip BaÄŸ Gör Ndx Ä°sim + Num: DeÄŸer Boy Tip BaÄŸ Gör Ndx Ä°sim + Gösterge Boyu: %d + Sürüm: %d + %#06x: Ä°sim endeksi: %lx %#06x: Ä°sim: %s %#06x: Ãœst %d, isim endeksi: %ld + %#06x: Ãœst %d: %s + %#06x: Sür: %d Seçenek: %s %#06x: Sürüm: %d %d %s + (Bilinmeyen inline öznitelik deÄŸeri: %lx) -I --histogram Küme listesi uzunluklarının geçmiÅŸ grafiÄŸini gösterir + -W --wide Çıktı geniÅŸliÄŸinin 80 karakteri geçmesine izin verir + -H --help Bu bilgiyi gösterir + -v --version readelf'in sürüm no'sunu gösterir + -I --input-target Girdi dosyasının biçeminde + olduÄŸunu varsayar + -O --output-target Çıktı dosyasını biçeminde + oluÅŸturur + -B --binary-architecture Girdi ikilik biçeminde olduÄŸu zaman çıktı + dosyasının platformunu belirler. + -F --target Hem girdi, hem de çıktı biçemini olarak atar - --debugging Mümkün olduðu kadar hata ayýklama - bilgisini dönüþtürür - -p --preserve-dates Çýktýya deðiþim/eriþim zaman damgalarýný + --debugging Mümkün olduÄŸu kadar hata ayıklama + bilgisini dönüştürür + -p --preserve-dates Çıktıya deÄŸiÅŸim/eriÅŸim zaman damgalarını kopyalar - -j --only-section Çýktýya yalnýzca bölümünü kopyalar - -R --remove-section Çýktýdan bölümünü çýkarýr - -S --strip-all Bütün sembol ve yer deðiþtirme bilgisini + -j --only-section Çıktıya yalnızca bölümünü kopyalar + -R --remove-section Çıktıdan bölümünü çıkarır + -S --strip-all Bütün sembol ve yer deÄŸiÅŸtirme bilgisini siler - -g --strip-debug Bütün hata ayýklama sembollerini siler - --strip-unneeded Yer deðiþtirmeler için gerekmeyen bütün + -g --strip-debug Bütün hata ayıklama sembollerini siler + --strip-unneeded Yer deÄŸiÅŸtirmeler için gerekmeyen bütün sembolleri siler - -N --strip-symbol sembolünü kopyalamaz - -K --keep-symbol Yalnýzca sembolünü kopyalar - -L --localize-symbol sembolünün yerel olarak - tanýmlanmasýný saðlar - -G --keep-global-symbol haricindeki bütün sembolleri - yerelleþtirir. - -W --weaken-symbol sembolünün zayýf olarak - tanýmlanmasýný saðlar - --weaken Bütün evrensel sembollerin zayýf olarak - tanýmlanmasýný saðlar - -x --discard-all Evrensel olmayan bütün sembolleri siler - -X --discard-locals Derleyici tarafýndan oluþturulan bütün + -N --strip-symbol sembolünü kopyalamaz + -K --keep-symbol Yalnızca sembolünü kopyalar + -L --localize-symbol sembolünün yerel olarak + tanımlanmasını saÄŸlar + -G --keep-global-symbol haricindeki bütün sembolleri + yerelleÅŸtirir. + -W --weaken-symbol sembolünün zayıf olarak + tanımlanmasını saÄŸlar + --weaken Bütün evrensel sembollerin zayıf olarak + tanımlanmasını saÄŸlar + -x --discard-all Evrensel olmayan bütün sembolleri siler + -X --discard-locals Derleyici tarafından oluÅŸturulan bütün sembolleri siler - -i --interleave Her bayttan yalnýz birini kopyalar - -b --byte Her serpiþtirilmiþ bloktan numaralý - baytý seçer - --gap-fill Bölümler arasý boþluklarý ile + -i --interleave Her bayttan yalnız birini kopyalar + -b --byte Her serpiÅŸtirilmiÅŸ bloktan numaralı + baytı seçer + --gap-fill Bölümler arası boÅŸlukları ile doldurur - --pad-to Son bölümü e kadar boþlukla doldurur - --set-start Baþlangýç adresini olarak belirtir + --pad-to Son bölümü e kadar boÅŸlukla doldurur + --set-start BaÅŸlangıç adresini olarak belirtir {--change-start|--adjust-start} - Baþlangýç adresine ekler + BaÅŸlangıç adresine ekler {--change-addresses|--adjust-vma} - LMA, VMA ve baþlangýç adreslerine + LMA, VMA ve baÅŸlangıç adreslerine ekler - {--change-section-address|--adjust-section-vma} {=|+|-} - bölümünün LMA ve VMA'sýný - kadar deðiþtirir - --change-section-lma {=|+|-} - bölümünün LMA'sýný kadar - deðiþtirir - --change-section-vma {=|+|-} - bölümünün VMA'sýný kadar - deðiþtirir + {--change-section-address|--adjust-section-vma} {=|+|-} + bölümünün LMA ve VMA'sını + kadar deÄŸiÅŸtirir + --change-section-lma {=|+|-} + bölümünün LMA'sını kadar + deÄŸiÅŸtirir + --change-section-vma {=|+|-} + bölümünün VMA'sını kadar + deÄŸiÅŸtirir {--[no-]change-warnings|--[no-]adjust-warnings} - Eðer isimli bir bölüm yok ise uyarý verir - --set-section-flags = - bölümünün özniteliklerini - e ayarlar - --add-section = içinde bulunan bölümünü - çýktýya ekler - --rename-section =[,] bölümünü olarak - yeniden adlandýrýr - --change-leading-char Çýktý biçeminin baþlangýç karakter tipini - deðiþtirir - --remove-leading-char Evrensel sembollerden baþlangýç - karakterini çýkarýr - --redefine-sym = isimli sembolü isimli olarak - yeniden tanýmlar - --srec-len Oluþturulan S kayýtlarýnýn boyutunu - kýsýtlar - --srec-forceS3 Oluþturulan S kayýtlarý tipini S3 olarak - kýsýtlar - --strip-symbols daki bütün semboller için -N uygular - --keep-symbols daki bütün semboller için -K uygular - --localize-symbols daki bütün semboller için -L uygular - --keep-global-symbols daki bütün semboller için -G uygular - --weaken-symbols daki bütün semboller için -W uygular - --alt-machine-code Çýktý için alternatif makina kodu kullanýr - -v --verbose Deðiþtirilen tüm nesne dosyalarýný listeler - -V --version Bu yazýlýmýn sürüm bilgilerini gösterir - -h --help Bu çýktýyý gösterir - -I --input-target Girdi dosyasýnýn biçeminde olduðunu varsayar - -O --output-target Çýktý dosyasýný biçeminde oluþturur - -F --target Girdi ve çýktý biçemlerini olarak atar - -p --preserve-dates Çýktýya deðiþim/eriþim zaman damgalarýný kopyalar - -R --remove-section Çýktýdan bölümünü çýkarýr - -s --strip-all Bütün sembol ve yer deðiþtirme bilgisini siler - -g -S --strip-debug Bütün hata ayýklama sembollerini siler - --strip-unneeded Yer deðiþtirmeler için gerekmeyen bütün sembolleri siler - -N --strip-symbol sembolünü kopyalamaz - -K --keep-symbol Yalnýzca sembolünü kopyalar - -x --discard-all Evrensel olmayan bütün sembolleri siler - -X --discard-locals Derleyici tarafýndan oluþturulan bütün sembolleri siler - -v --verbose Deðiþtirilen tüm nesne dosyalarýný listeler - -V --version Bu yazýlýmýn sürüm bilgilerini gösterir - -h --help Bu çýktýyý gösterir - -o Sembolleri silinmiþ çýktýyý ya yerleþtirir - -I veya --histogram Küme liste uzunluðu geçmiþ grafiðini gösterir - -S veya --section-headers veya --sections - -V veya --version-info (Eðer varsa) sürüm bölümlerini gösterir - -W veya --wide 80 sütuna sýðdýrmak için satýrlarý bölmez veya kesmez - -a veya --all Buna eþit: -h -l -S -s -r -d -V -A -I - -a, --archive-headers Arþiv baþlýk bilgilerini gösterir - -f, --file-headers Dosya baþlýk bilgilerini gösterir - -p, --private-headers Nesne biçemine özgü dosya baþlýk bilgilerini gösterir - -h, --[section-]headers Bölüm baþlýklarýný gösterir - -x, --all-headers Bütün baþlýklarý gösterir - -d, --disassemble Uygulama bölümlerinin üretici içeriðini gösterir - -D, --disassemble-all Bütün bölümlerin üretici içeriklerini gösterir - -S, --source Üretici içerikleri ile kaynak kodunu bir arada gösterir - -s, --full-contents Ýstenen bütün bölümlerin bütün içeriðini gösterir - -g, --debugging Nesne dosyasýndaki hata ayýklama bilgilerini gösterir - -G, --stabs Dosyadaki STABS bilgisini (ham hali ile) gösterir - -t, --syms Sembol tablolarýnýn içeriðini gösterir - -T, --dynamic-syms Dinamik sembol tablolarýnýn içeriðini gösterir - -r, --reloc Dosyadaki yer deðiþtirme girdilerini gösterir - -R, --dynamic-reloc Dosyadaki dinamik yer deðiþtirme bilgilerini gösterir - -V, --version Bu yazýlýmýn sürüm bilgilerini gösterir - -i, --info Desteklenen biçem ve mimarileri gösterir - -H, --help Bu bilgiyi gösterir - -b, --target=BFD_ADI Hedef nesne biçemini BFD_ADI olarak belirtir - -m, --architecture=MAKÝNA Hedef mimariyi MAKÝNA olarak belirtir - -j, --section=ÝSÝM Yalnýzca ÝSÝM bölümü için bilgi gösterir - -M, --disassembler-options=SEÇ Karþýt-çeviriciye metin SEÇeneklerini geçirir - -EB --endian=big Karþýt-çevirim esnasýnda big-endian biçemini varsayar - -EL --endian=little Karþýt-çevirim esnasýnda little-endian biçemini varsayar - --file-start-context Dosyanýn baþlangýcýndan itibaren baðlamý içerir (-S ile) - -l, --line-numbers Çýktýda dosya isimleri ve satýr numaralarý gösterir - -C, --demangle[=TARZ] Karýþtýrýlmýþ/iþlenmiþ sembol isimlerini çözümler - Tarz, eðer belirtilmiþse, `auto', 'gnu', + EÄŸer isimli bir bölüm yok ise uyarı verir + --set-section-flags = + bölümünün özniteliklerini + e ayarlar + --add-section = içinde bulunan bölümünü + çıktıya ekler + --rename-section =[,] bölümünü olarak + yeniden adlandırır + --change-leading-char Çıktı biçeminin baÅŸlangıç karakter tipini + deÄŸiÅŸtirir + --remove-leading-char Evrensel sembollerden baÅŸlangıç + karakterini çıkarır + --redefine-sym = isimli sembolü isimli olarak + yeniden tanımlar + --srec-len OluÅŸturulan S kayıtlarının boyutunu + kısıtlar + --srec-forceS3 OluÅŸturulan S kayıtları tipini S3 olarak + kısıtlar + --strip-symbols daki bütün semboller için -N uygular + --keep-symbols daki bütün semboller için -K uygular + --localize-symbols daki bütün semboller için -L uygular + --keep-global-symbols daki bütün semboller için -G uygular + --weaken-symbols daki bütün semboller için -W uygular + --alt-machine-code Çıktı için alternatif makina kodu kullanır + -v --verbose DeÄŸiÅŸtirilen tüm nesne dosyalarını listeler + -V --version Bu yazılımın sürüm bilgilerini gösterir + -h --help Bu çıktıyı gösterir + -I --input-target= Girdi dosyasının biçeminde olduÄŸunu varsayar + -O --output-target= Çıktı dosyasını biçeminde oluÅŸturur + -F --target= Girdi ve çıktı biçemlerini olarak atar + -p --preserve-dates Çıktıya deÄŸiÅŸim/eriÅŸim zaman damgalarını kopyalar + -R --remove-section= Çıktıdan bölümünü çıkarır + -s --strip-all Bütün sembol ve yer deÄŸiÅŸtirme bilgisini siler + -g -S --strip-debug Bütün hata ayıklama sembollerini siler + --strip-unneeded Yer deÄŸiÅŸtirmeler için gerekmeyen bütün sembolleri siler + -N --strip-symbol= sembolünü kopyalamaz + -K --keep-symbol= Yalnızca sembolünü kopyalar + -x --discard-all Evrensel olmayan bütün sembolleri siler + -X --discard-locals Derleyici tarafından oluÅŸturulan bütün sembolleri siler + -v --verbose DeÄŸiÅŸtirilen tüm nesne dosyalarını listeler + -V --version Bu yazılımın sürüm bilgilerini gösterir + -h --help Bu çıktıyı gösterir + -o Sembolleri silinmiÅŸ çıktıyı ya yerleÅŸtirir + -a, --archive-headers ArÅŸiv baÅŸlık bilgilerini gösterir + -f, --file-headers Dosya baÅŸlık bilgilerini gösterir + -p, --private-headers Nesne biçemine özgü dosya baÅŸlık bilgilerini gösterir + -h, --[section-]headers Bölüm baÅŸlıklarını gösterir + -x, --all-headers Bütün baÅŸlıkları gösterir + -d, --disassemble Uygulama bölümlerinin üretici içeriÄŸini gösterir + -D, --disassemble-all Bütün bölümlerin üretici içeriklerini gösterir + -S, --source Ãœretici içerikleri ile kaynak kodunu bir arada gösterir + -s, --full-contents Ä°stenen bütün bölümlerin bütün içeriÄŸini gösterir + -g, --debugging Nesne dosyasındaki hata ayıklama bilgilerini gösterir + -G, --stabs Dosyadaki STABS bilgisini (ham hali ile) gösterir + -t, --syms Sembol tablolarının içeriÄŸini gösterir + -T, --dynamic-syms Dinamik sembol tablolarının içeriÄŸini gösterir + -r, --reloc Dosyadaki yer deÄŸiÅŸtirme girdilerini gösterir + -R, --dynamic-reloc Dosyadaki dinamik yer deÄŸiÅŸtirme bilgilerini gösterir + -V, --version Bu yazılımın sürüm bilgilerini gösterir + -i, --info Desteklenen biçem ve mimarileri gösterir + -H, --help Bu bilgiyi gösterir + -b, --target=BFD_ADI Hedef nesne biçemini BFD_ADI olarak belirtir + -m, --architecture=MAKÄ°NA Hedef mimariyi MAKÄ°NA olarak belirtir + -j, --section=Ä°SÄ°M Yalnızca Ä°SÄ°M bölümü için bilgi gösterir + -M, --disassembler-options=SEÇ Karşıt-çeviriciye metin SEÇeneklerini geçirir + -EB --endian=big Karşıt-çevirim esnasında big-endian biçemini varsayar + -EL --endian=little Karşıt-çevirim esnasında little-endian biçemini varsayar + --file-start-context Dosyanın baÅŸlangıcından itibaren baÄŸlamı içerir (-S ile) + -l, --line-numbers Çıktıda dosya isimleri ve satır numaraları gösterir + -C, --demangle[=TARZ] Karıştırılmış/iÅŸlenmiÅŸ sembol isimlerini çözümler + Tarz, eÄŸer belirtilmiÅŸse, `auto', 'gnu', 'lucid', 'arm', 'hp', 'edg', veya 'gnu-new-abi' olabilir - -w, --wide Çýktýyý 80 sütundan daha geniþ olarak biçemler - -z, --disassemble-zeroes Karþýt-çevirim esnasýnda sýfýr bloklarýný atlamaz - --start-address=ADRES Yalnýzca adresi >= ADRES olan verileri iþler - --stop-address=ADRES Yalnýzca adresi <= ADRES olan verileri iþler - --prefix-addresses Tam adresi karþýt çevirim ile birlikte yazdýrýr - --[no-]show-raw-insn Onaltýlýk bilgi ile sembolik karþýt-çevrimi birlikte yazdýrýr - --adjust-vma=BASAMAK Bütün gösterilen bölüm adreslerine BASAMAK ekler - - -d veya --dynamic (Eðer varsa) dinamik bölümü gösterir - -e veya --headers Buna eþit: -h -l -S - -h veya --file-header ELF dosyasý baþlýðýný gösterir - -i veya --instruction-dump= - -l veya --program-headers veya --segments - -n veya --notes (Eðer varsa) core notlarýný gösterir - -r veya --relocs (Eðer varsa) yer deðiþtirmeleri gösterir - -s veya --syms veya --symbols Sembol tablosunu gösterir - -u veya --unwind (Eðer varsa) geri alma bilgisini gösterir - -v veya --version readelf'in sürüm numarasýný gösterir - -w[liaprmfs] veya --debug-dump[=line,=info,=abbrev,=pubnames,=ranges,=macro,=frames,=str] - -x veya --hex-dump= - ABI Sürümü: %d - Adres: 0x Satýrý %2$d'ye kadar %1$d ilerletir + -w, --wide Çıktıyı 80 sütundan daha geniÅŸ olarak biçemler + -z, --disassemble-zeroes Karşıt-çevirim esnasında sıfır bloklarını atlamaz + --start-address=ADRES Yalnızca adresi >= ADRES olan verileri iÅŸler + --stop-address=ADRES Yalnızca adresi <= ADRES olan verileri iÅŸler + --prefix-addresses Tam adresi karşıt çevirim ile birlikte yazdırır + --[no-]show-raw-insn Onaltılık bilgi ile sembolik karşıt-çevrimi birlikte yazdırır + --adjust-vma=BASAMAK Bütün gösterilen bölüm adreslerine BASAMAK ekler + + -h --help Bu yardımı gösterir + -V --version Bu sürüm bilgisini gösterir + -i --instruction-dump= + bölümünün içeriÄŸini karşıt-çevirir + ABI Sürümü: %d + Adres: 0x Satırı %2$d'ye kadar %1$d ilerletir PC'yi %2$lx'ye kadar, %1$d ilerletir PC'yi 0x%2$lx'e kadar %1$d ilerletir PC'yi 0x%2$lx'e kadar %1$d ilerletir - Sýnýf: %s - Sayý: %d + Sınıf: %s + Sayı: %d Derleme Birimi @ %lx: Kopyalar - DWARF Sürümü: %d + DWARF Sürümü: %d Veri: %s - Girdi Dizin Zaman Boy Ýsim - Girdi noktasý adresi: Ek opkod %d: Dosya: %lx Dosya: %s Seçenekler Seçenekler: 0x%lx%s - Seçenekler: %s Sürüm: %d - Genel seçenekler: - Endeks: %d Sayý: %d 'is_stmt' baþlangýç deðeri: %d + Girdi Dizin Zaman Boy Ä°sim + Girdi noktası adresi: Ek opkod %d: Dosya: %lx Dosya: %s Seçenekler Seçenekler: 0x%lx%s + Seçenekler: %s Sürüm: %d + Genel seçenekler: + Endeks: %d Sayı: %d 'is_stmt' baÅŸlangıç deÄŸeri: %d Uzunluk: %ld Uzunluk: %ld Uzunluk: %ld - Satýr Temeli: %d - Satýr Aralýðý: %d + Satır Temeli: %d + Satır Aralığı: %d Makina: %s - Sihir: Minimum Ýþlem Uzunluðu: %d - Küme Num: Deðer Boy Tip Bað Gör Ndx Ýsim - Küme Num: Deðer Boy Tip Bað Gör Ndx Ýsim - Num: Endeks Deðer Ýsim Sayý TAG - Yazýlým baþlýk sayýsý: %ld - Bölüm baþlýklarý sayýsý: %ld OS/ABI: %s -.debug_info bölümünün içine göreli konum: %ld - .debug_info'nun içine göreli konum: %lx - Basamak: %#08lx Bölüme bað: %ld (%s) - Basamak: %#08lx Bað: %lx (%s) - %d opkodunun %d seçeneði var + Sihir: Minimum Ä°ÅŸlem UzunluÄŸu: %d + Öykünüme özgü seçenekler yok + Küme Num: DeÄŸer Boy Tip BaÄŸ Gör Ndx Ä°sim + Küme Num: DeÄŸer Boy Tip BaÄŸ Gör Ndx Ä°sim + Num: Endeks DeÄŸer Ä°sim Sayı TAG + Yazılım baÅŸlık sayısı: %ld + Bölüm baÅŸlıkları sayısı: %ld OS/ABI: %s + Görece Bilgi Tür Sembol DeÄŸeri Sembol Adı + Görece Bilgi Tür Sembol DeÄŸeri Sembol Adı + Sonekleme +.debug_info bölümünün içine göreli konum: %ld + .debug_info'nun içine göreli konum: %lx + Basamak: %#08lx Bölüme baÄŸ: %ld (%s) + Basamak: %#08lx BaÄŸ: %lx (%s) + %d opkodunun %d seçeneÄŸi var Opkod Temeli: %d - Seçenekler: - %s için seçenekler: - DLLTOOL'a geçirilen seçenekler: - Sahip Veri Boyu Açýklama - Gösterge Boyu: %d - Giriþ Uzunluðu: %d - Kalanlar dil sürücüsüne deðiþtirilmeksizin geçirilir - Bölüm baþlýðý dizge tablo endeksi: %ld Parça Bölümleri... - Parça Boyu: %d - Dosya Adýný, Dosya Ýsim Tablosunda, %d numaralý girdi olarak atar - ISA'yý %d olarak atar - Temel bloðu atar - Sütunu %d olarak atar - Epilogue_begin'i doðru (true) olarak atar + %s için seçenekler: + DLLTOOL'a geçirilen seçenekler: + Sahip Veri Boyu Açıklama + Gösterge Boyu: %d + GiriÅŸ UzunluÄŸu: %d + Kalanlar dil sürücüsüne deÄŸiÅŸtirilmeksizin geçirilir + Bölüm baÅŸlığı dizge tablo endeksi: %ld Parça Bölümleri... + Parça Boyu: %d + Dosya Adını, Dosya Ä°sim Tablosunda, %d numaralı girdi olarak atar + ISA'yı %d olarak atar + Temel bloÄŸu atar + Sütunu %d olarak atar + Epilogue_begin'i doÄŸru (true) olarak atar is_stmt'i %d olarak atar - Prologue_end'i doðru (true) olarak atar -.debug_info bölümünde alan büyüklüðü: %ld - Yazýlým baþlýk boyu: %ld (bayt) - Bölüm baþlýk boyu: %ld (bayt) - Bu baþlýðýn boyu: %ld (bayt) - Özel opkod %1$d: Adresi 0x%3$lx'e kadar %2$d ilerletir Etiket Tip Ýsim/Deðer - Tip Basamak SanalAdres GerçekAdres - Tür Görece SanalAdr GerçAdrs DosyaBoy BelBoy Seç Hiza - Tip Basamak SanalAdr GerçAdrs DosyaBoyBelBoy Seç Hiza + Prologue_end'i doÄŸru (true) olarak atar +.debug_info bölümünde alan büyüklüğü: %ld + Yazılım baÅŸlık boyu: %ld (bayt) + Bölüm baÅŸlık boyu: %ld (bayt) + Bu baÅŸlığın boyu: %ld (bayt) + Özel opkod %1$d: Adresi 0x%3$lx'e kadar %2$d ilerletir Etiket Tip Ä°sim/DeÄŸer + Tip Basamak SanalAdres GerçekAdres + Tür Görece SanalAdr GerçAdrs DosyaBoy BelBoy Seç Hiza + Tip Basamak SanalAdr GerçAdrs DosyaBoyBelBoy Seç Hiza Tip: %s - Bilinmeyen %d opkodu ve iþlenenleri: Sürüm: %d - Sürüm: %d %s - Sürüm: 0x%lx - Sürüm: %d - [-X32_64] - (yok sayýlýr) - [N] - adýn [sayý] numaralý geçiþini kullanýr - [Nr] Ýsim Tip Adres Basamak - [Nr] Ýsim Tip Adres Bas Boy ES Seç Lk Inf Al - [Nr] Ýsim Tür Adres Görece Boy ES Seç Lk Inf Al - [P] - eþleþtirmede tam yol adlarýný kullanýr - [S] - sembol tablosu oluþturmaz - [V] - sürüm numarasýný gösterir - [a] - dosyalarý [üye-adý]'ndan sonra ekler - [b] - dosya(larý) [üye-adý]'ndan önce ekler ([i] ile ayný) - [c] - eðer kitaplýk oluþturulmak zorunda kalýnýrsa, uyarý vermez - [f] - eklenen dosya adlarýný kýrpar - [o] - orjinal zaman damgalarýný korur - [s] - arþiv endeksi oluþturur (ranlib) - [u] - yalnýzca þimdiki arþiv içeriðinden daha yeni olan dosyalarý deðiþtirir - [v] - açýklama verir - d - arþivden dosya(lar) siler - yeni Dosya Tablosu girdisi tanýmlar - m[ab] - arþivde dosya(larý) taþýr - p - arþivde bulunan dosya(larý) yazdýrýr - q[f] - dosya(larý) arþivin sonuna çabucak ekler - r[ab][f][u] - arþivde olan bir dosyanýn yerine yenisi koyar veya arþive yeni dosya(lar) ekler - t - arþivin içeriðini gösterir - x[o] - arþivdeki dosya(larý) açar - %lu baytlýk blok: (bayt dosya içinde) - (bayt dosya içinde) - Bölüm baþlýklarý baþlangýcý: (dolaylý dizge, görece: 0x%lx): <%d><%lx>: Kýsaltma Numarasý: %lu (%s) - Adres: Adres: 0x %s argümaný yoksayýldý DW_MACINFO_define - satýr no : %d makro : %s + Bilinmeyen %d opkodu ve iÅŸlenenleri: Sürüm: %d + Sürüm: %d %s + Sürüm: 0x%lx + Sürüm: %d + [-X32] - 64 bitlik nesneleri yok sayar + [-X32_64] - 32 ve 64 bitlik nesneleri kabul eder + [-X64] - 32 bitlik nesneleri yok sayar + [-g] - 32 bitlik küçük arÅŸiv + [N] - adın [sayı] numaralı geçiÅŸini kullanır + [Nr] Ä°sim Tip Adres Basamak + [Nr] Ä°sim Tip Adres Bas Boy ES Seç Lk Inf Al + [Nr] Ä°sim Tür Adres Görece Boy ES Seç Lk Inf Al + [P] - eÅŸleÅŸtirmede tam yol adlarını kullanır + [S] - sembol tablosu oluÅŸturmaz + [V] - sürüm numarasını gösterir + [a] - dosyaları [üye-adı]'ndan sonra ekler + [b] - dosya(ları) [üye-adı]'ndan önce ekler ([i] ile aynı) + [c] - eÄŸer kitaplık oluÅŸturulmak zorunda kalınırsa, uyarı vermez + [f] - eklenen dosya adlarını kırpar + [o] - orjinal zaman damgalarını korur + [s] - arÅŸiv endeksi oluÅŸturur (ranlib) + [u] - yalnızca ÅŸimdiki arÅŸiv içeriÄŸinden daha yeni olan dosyaları deÄŸiÅŸtirir + [v] - açıklama verir + d - arÅŸivden dosya(lar) siler + yeni Dosya Tablosu girdisi tanımlar + m[ab] - arÅŸivde dosya(ları) taşır + p - arÅŸivde bulunan dosya(ları) yazdırır + q[f] - dosya(ları) arÅŸivin sonuna çabucak ekler + r[ab][f][u] - arÅŸivde olan bir dosyanın yerine yenisi koyar veya arÅŸive yeni dosya(lar) ekler + t - arÅŸivin içeriÄŸini gösterir + x[o] - arÅŸivdeki dosya(ları) açar + %lu baytlık blok: (bayt dosya içinde) + (bayt dosya içinde) + Bölüm baÅŸlıkları baÅŸlangıcı: (dolaylı dizge, görece: 0x%lx): <%d><%lx>: Kısaltma Numarası: %lu (%s) + Adres: Adres: 0x %s argümanı yoksayıldı En azından aÅŸağıdaki seçeneklerin biri verilmelidir: + adresleri satır numarası/dosya adı çiftlerine çevirir. + Bir nesne dosyasını NetWare Yüklenebilir Modül haline getirir + Ä°kilik dosyayı, muhtemelen deÄŸiÅŸtirerek kopyalar + DW_MACINFO_define - satır no : %d makro : %s DW_MACINFO_end_file - DW_MACINFO_start_file - satýr no: %d dosya no: %d - DW_MACINFO_undef - satýr no : %d makro : %s + DW_MACINFO_start_file - satır no: %d dosya no: %d + DW_MACINFO_undef - satır no : %d makro : %s DW_MACINFO_vendor_ext - sabit : %d dizge : %s + ELF biçem dosyalarının içeriÄŸi hakkında bilgi gösterir +Nesne 'sından bilgi gösterir. + [dosya(lar)]daki yazdırılabilir dizgeleri gösterir (öntanımlı standart girdi) + Ä°kilik dosyalar içinde bölüm boylarını gösterir + ArÅŸiv eriÅŸimini hızlandırmak için indeks üretir + EÄŸer komut satırında adres belirtilmezse, standart girdiden okunur + EÄŸer girdi dosyası belirtilmezse, a.out varsayılır Length Number %% of total Coverage - Boy Numara toplam kapsamýn %% - Hiçbiri - Num: Ýsim Baðlý Seçenekler - Görece Bilgi Tür Sembol Deðeri Sembol Adý - Görece Bilgi Tür Sembol Deðeri Sembol Adý Sonekleme - Seçenekler: - ve Satýr'ý %2$d'ye kadar %1$d -göreli konum 0x%lx %lu girdi içeriyor: - komuta özgü deðiþtiriciler: + Boy Numara toplam kapsamın %% + [dosya(lar)]daki sembolleri listeler (öntanımlı a.out). + Hiçbiri + Num: Ä°sim BaÄŸlı Seçenekler + Görece Bilgi Tür Sembol DeÄŸeri Sembol Adı + Görece Bilgi Tür Sembol DeÄŸeri Sembol Adı + Sonekleme + Görece Bilgi Tür Sembol DeÄŸeri Sembol Adı + Görece Bilgi Tür Sembol DeÄŸeri Sembol Adı + Sonekleme + Seçenekler: + -a --all -h -l -S -s -r -d -V -A -I ile aynı + -h --file-header ELF dosya baÅŸlığını gösterir + -l --program-headers Yazılım baÅŸlıklarını gösterir + --segments --program-headers ile aynı + -S --section-headers Bölüm baÅŸlıklarını gösterir + --sections --section-headers ile aynı + -e --headers -h -l -S ile aynı + -s --syms Sembol tablosunu gösterir + --symbols --syms ile aynı + -n --notes EÄŸer varsa, 'core' dosyasını gösterir + -r --relocs EÄŸer varsa, yerdeÄŸiÅŸimleri gösterir + -u --unwind EÄŸer varsa, geri dönüşümleri gösterir + -d --dynamic EÄŸer varsa, dinamik bölümleri gösterir + -V --version-info EÄŸer varsa, sürüm bölümlerini gösterir + -A --arch-specific EÄŸer varsa, platforma özgü bilgileri gösterir + -D --use-dynamic Sembolleri gösterirken dinamik bölümleri kullanır + -x --hex-dump= no'lu bölümün içeriÄŸini gösterir + -w --debug-dump[=line,=info,=abbrev,=pubnames,=ranges,=macro,=frames,=str,=loc] + DWARF2 hata ayıklama bölümlerinin içeriÄŸini gösterir + SYSROFF nesne dosyasını insan tarafından okunabilir biçemde yazdırır + Dosyalardan sembol ve bölümleri çıkarır + Seçenekler: + Seçenekler: + -A|-B --format={sysv|berkeley} Çıktı tarzını belirler (%s öntanımlı) + -o|-d|-h --radix={8|10|16} Rakamları sekizlik, onluk, onaltılık + olarak gösterir + -t --totals Toplam boyları gösterir (yalnız + Berkeley'de) + --target= Ä°kilik dosya biçemini belirler + -h --help Bu bilgileri gösterir + -v --version Sürüm bilgilerini gösterir + + Seçenekler: + -I --input-target= Girdi ikilik dosya biçemini belirler + -O --output-target= Çıktı ikilik dosya biçemini belirler + -T --header-file= NLM baÅŸlık bilgilerini dan okur + -l --linker= BaÄŸlama iÅŸlemi için yı kullanır + -d --debug Standart hatada baÄŸlayıcı komut satırını gösterir + -h --help Bu bilgiyi gösterir + -v --version Program sürüm no'sunu gösterir + Seçenekler: + -a - --all Yalnız veri bölümünü deÄŸil, bütün dosyayı tarar + -f --print-file-name Her dizgeden önce dosya adını yazdırır + -n --bytes=[sayı] En az [sayı] karakterde ve NUL ile sonlanmış olan + - bütün dizgeleri yazdırır (öntanımlı 4) + -t --radix={o,x,d} Dizgenin yerini 8'lik, 10'luk veya 16'lık düzende + yazdırır + -o --radix=o ile aynı + -T --target= Ä°kilik dosya biçemini belirtir + -e --encoding={s,b,l,B,L} Karakter boyu ve sonlamayı seçtirir: + s = 8-bit, {b,l} = 16-bit, {B,L} = 32-bit + -h --help Bu bilgiyi gösterir + -v --version Yazılımın sürüm no'sunu gösterir + Seçenekler: + -a, --debug-syms Yalnızca hata ayıklamaya dair sembolleri gösterir + -A, --print-file-name Her sembolden önce girdi dosyasının adını yazdırır + -B --format=bsd ile aynı + -C, --demangle[=TARZ] Alt düzey sembol adlarını kullanıcı seviyesinde adlara çevirir + TARZ, eÄŸer belirtilirse, 'auto' (öntanımlı), + `gnu', 'lucid', 'arm', 'hp', 'edg' veya 'gnu-new-abi' olabilir + --no-demangle Alt düzey sembol adlarını çevirmez + -D, --dynamic Normal semboller yerine dinamik sembolleri gösterir + --defined-only Yalnızca tanımlanmış sembolleri gösterir + -e (yoksayılır) + -f, --format=BİÇEM Çıktı biçemi için BİÇEM'i kullanır. BİÇEM, 'bsd' (öntanımlı), + `sysv' veya `posix' olabilir + -g, --extern-only Yalnızca harici sembolleri gösterir + -l, --line-numbers Hata ayıklama bilgisini kullanarak her sembol için bir + satır numarası ve dosya adı bulur. + -n, --numeric-sort Sembolleri adres numarasına göre sıralar + -o -A ile aynı + -p, --no-sort Sembolleri sıralamaz + -P, --portability --format=posix ile aynı + -r, --reverse-sort Ters sıralar + -S, --print-size Tanımlı sembollerin boyunu gösterir + -s, --print-armap ArÅŸiv üyelerinden gelen semboller için endeks içerir + --size-sort Sembolleri büyüklüğe göre sıralar + -t, --radix=RADIX Sembol deÄŸerlerini yazdırmak için RADIX kullanır + --target=BFD_ADI Hedef nesne biçemini BFD_ADI olarak belirler + -u, --undefined-only Yalnızca tanımlanmamış sembolleri gösterir + -X 32_64 (yok sayılır) + -h, --help Bu bilgiyi gösterir + -V, --version Sürüm bilgilerini gösterir + + Seçenekler: + -b --target= Ä°kilik dosya biçemini belirtir + -e --exe=<çalıştırılabilir dosya> Girdi adını belirtir (öntanımlı: a.out) + -s --basenames Dizin adlarını soyar + -f --functions Ä°ÅŸlev adlarını gösterir + -C --demangle[=tarz] Ä°ÅŸlev adlarını düzeltir + -h --help Bu bilgiyi gösterir + -v --version Program sürüm no'sunu gösterir + + Seçenekler: + -h --help Bu yardımı gösterir + -V --version Sürüm bilgisini gösterir + Seçenekler: + -h --help Bu bilgiyi gösterir + -v --version Program sürüm no'sunu gösterir + + Seçenekler: + -h --help Bu bilgiyi gösterir + -v --version Yazılımın sürüm no'sunu gösterir +Seçenekler: + -i --input= Girdi dosyası ismi + -o --output= Çıktı dosyası ismi + -I --input-format= Girdi biçemini belirtir + -O --output-format= Çıktı biçemini belirtir + -F --target= COFF hedefini belirtir + --preprocessor= rc dosyasını öniÅŸlemek için kullanılacak yazılım + --include-dir= rc dosyası öniÅŸlenirken dizini dahil et + -D --define SYM[=DEÄžER] rc dosyası öniÅŸlenirken SYM'i tanımlar + -v --verbose Açıklamalı - ne yapıldığını anlatır + --language= rc dosyası okunurken dili belirtir + --use-temp-file ÖniÅŸlemci çıktısını okumak için popen yerine + geçici dosya kullanır + --no-use-temp-file (öntanımlı) popen kullanır + Seçenekler: + -q --quick (Eski - yoksayılır) + -n --noprescan common'ları def'lere çevirmek için taramaz + -d --debug Ne yapıldığı hakkında bilgi verir + -h --help Bu bilgiyi gösterir + -v --version Sürüm numarasını gösterir + ve Satır'ı %2$d'ye kadar %1$d +göreli konum 0x%lx %lu girdi içeriyor: + komuta özgü deÄŸiÅŸtiriciler: komutlar: - genel deðiþtiriciler: - yazýlým yorumlayýcýsý#satýrlar %d %ld: öncesinde iþlev olmadan .bf%ld: beklenmeyen .ef + öykünüm seçenekleri: + genel deÄŸiÅŸtiriciler: + yazılım yorumlayıcısı tür: %x, isimboyu: %08lx, tanımboyu: %08lx +#satırlar %d %ld: öncesinde iÅŸlev olmadan .bf%ld: beklenmeyen .ef %lu %s %s -%s %s%c0x%s hiç kullanýlmadý%s %s: %s%s hem kopyalandý hem silindi%s %d durumu ile çýktý%s %s bölümü yok%s geçerli bir arþiv deðil%s bir arþiv deðil%s: %s: adres sýnýrlarýn dýþýnda%s: Girdi arþivi %s açýlamadý -%s: Çýktý arþivi %s açýlamadý -%s: Bir COFF nesne dosyasýný SYSROFF nesne dosyasýna çevirir -%s: Bir nesne dosyasýný NetWare Yüklenebilir Modül haline getirir -%s: Hata: %s: Dosya baþlýðý okunamadý -%s: Eþleþen biçemler:%s: "%s" sembolü tekrar tanýmlanmýþ%s: Dinamik sembol yok%s: SYSROFF nesne dosyasýný insan tarafýndan okunabilir biçemde yazdýrýr -%s: "%s" sembolü birden fazla yeniden tanýmlamanýn hedefi%s: Uyarý: %s: hatalý sayý: %s%s: arþivden adresler alýnamadý%s: hata ayýklama bölümü oluþturulamadý: %s%s: modül dosyasý %s bulunamadý -%s: %s dosyasý açýlamadý -%s: hata ayýklama bölüm içeriði atanamadý: %s%s: zaman atanamadý: %s%s: durumlanamadý: %s%s: %s için hata ayýklama bilgisinin nasýl yazýlacaðý bilinmiyor%s: özel BFD verisi kopyalanýrken hata: %s%s: %s'in çalýþtýrýlmasý baþarýsýz oldu: %s: %s dosyasý bir arþiv deðil -%s: fread baþarýsýz%s: %lu'ya fseek baþarýsýz: %s%s: geçersiz çýktý biçemi%s: geçersiz radix%s: güncellenecek arþiv eþlemesi yok%s: açýk arþiv yok -%s: açýk çýktý arþivi yok -%s: henüz bir çýktý arþivi belirtilmedi -%s: tanýnan hata ayýklama bilgisi yok%s: kaynak bölümü yok%s: sembol yok%s: dinamik nesne deðil%s: yeterli ikilik veri yok%s: hata ayýklama bilgisinin yazdýrýlmasý baþarýsýz%s: %lu'nun okunmasý %lu döndürdü%s: okundu: %s%s: yeniden adlandýrma: %s%s: bölüm `%s': %s'da hata: %s%s: simple_copy: %s%s: desteklenen platformlar:%s: desteklenen biçemler:%s: desteklenen hedefler:%s: beklenmeyen dosya sonu%s: uyarý: %s: uyarý: paylaþýmlý kitaplýklar öndeðer atanmamýþ veri kapsayamaz%s: uyarý: Yapý içinde `%s' alaný için bilinmeyen boy%s:%d: %s -(Bilinmeyen yer yönergesi)(Kullanýcý tanýmlý yer yönergesi)(inline olarak tanýmlandý ve inline'landý)(inline olarak tanýmlandý ama yoksayýldý)(inline'landý)(inline'lanamadý)2's complement, big endian2's complement, little endian64 bitlik DWARF a-aralýklarý henüz desteklenmiyor. -64 bitlik DWARF hata ayýklama bilgisi henüz desteklenmiyor. -64 bitlik DWARF biçem çerçeveleri henüz desteklenmiyor. -64 bitlik DWARF satýr bilgisi henüz desteklenmiyor. -64 bitlik DWARF genel isimleri henüz desteklenmiyor -: çift deðer +%s %s%c0x%s hiç kullanılmadı%s %s: %s%s hem kopyalandı hem silindi%s %d durumu ile çıktı%s %s bölümü yok%s geçerli bir arÅŸiv deÄŸil%s bir arÅŸiv deÄŸil%s: %s: adres sınırların dışında%s: Girdi arÅŸivi %s açılamadı +%s: Çıktı arÅŸivi %s açılamadı +%s: Hata: %s: Dosya baÅŸlığı okunamadı +%s: EÅŸleÅŸen biçemler:%s: "%s" sembolü tekrar tanımlanmış%s: Dinamik sembol yok%s: "%s" sembolü birden fazla yeniden tanımlamanın hedefi%s: Uyarı: %s: hatalı sayı: %s%s: arÅŸivden adresler alınamadı%s: hata ayıklama bölümü oluÅŸturulamadı: %s%s: modül dosyası %s bulunamadı +%s: %s dosyası açılamadı +%s: hata ayıklama bölüm içeriÄŸi atanamadı: %s%s: zaman atanamadı: %s%s: durumlanamadı: %s%s: %s için hata ayıklama bilgisinin nasıl yazılacağı bilinmiyor%s: özel BFD verisi kopyalanırken hata: %s%s: %s'in çalıştırılması baÅŸarısız oldu: %s: %s dosyası bir arÅŸiv deÄŸil +%s: fread baÅŸarısız%s: %lu'ya fseek baÅŸarısız: %s%s: geçersiz çıktı biçemi%s: geçersiz radix%s: güncellenecek arÅŸiv eÅŸlemesi yok%s: açık arÅŸiv yok +%s: açık çıktı arÅŸivi yok +%s: henüz bir çıktı arÅŸivi belirtilmedi +%s: tanınan hata ayıklama bilgisi yok%s: kaynak bölümü yok%s: sembol yok%s: dinamik nesne deÄŸil%s: yeterli ikilik veri yok%s: hata ayıklama bilgisinin yazdırılması baÅŸarısız%s: %lu'nun okunması %lu döndürdü%s: okundu: %s%s: yeniden adlandırma: %s%s: bölüm `%s': %s'da hata: %s%s: simple_copy: %s%s: desteklenen platformlar:%s: desteklenen biçemler:%s: desteklenen hedefler:%s: beklenmeyen dosya sonu%s: uyarı: %s: uyarı: paylaşımlı kitaplıklar öndeÄŸer atanmamış veri kapsayamaz%s: uyarı: Yapı içinde `%s' alanı için bilinmeyen boy%s:%d: %s +'%s'(Bilinmeyen yer yönergesi)(Kullanıcı tanımlı yer yönergesi)(inline olarak tanımlandı ve inline'landı)(inline olarak tanımlandı ama yoksayıldı)(inline'landı)(inline'lanamadı)2's complement, big endian2's complement, little endian64 bitlik DWARF a-aralıkları henüz desteklenmiyor. +64 bitlik DWARF hata ayıklama bilgisi henüz desteklenmiyor. +64 bitlik DWARF biçem çerçeveleri henüz desteklenmiyor. +64 bitlik DWARF satır bilgisi henüz desteklenmiyor. +64 bitlik DWARF genel isimleri henüz desteklenmiyor +: çift deÄŸer : dizin beklendi : yaprak beklendi -<ÝS'e özel>: %d<.debug_str bölümü yok>: %d: %d: %lx: %xÇýktý dosyasýna ihraçlar eklendiÇýktý dosyasýna ihraçlar ekleniyorDenetim kitaplýðýYardýmcý kitaplýkBCD gerçel tipi desteklenmiyorBFD baþlýk dosyasý sürümü %s -Kötü stab: %s -C++ temel sýnýfý tanýmlanmamýþC++ temel sýnýfý taþýyýcý içinde bulunamadýC++ veri üyesi taþýyýcý içinde bulunamadýC++ öntanýmlý deðerleri iþlev içerisinde deðilC++ nesnesinde hiç alan yokC++ referansý imleyici deðilC++ referansý bulunamadýC++ statik sanal yöntemCORE (Core dosyasý)%s'ye dolgu eklenemedi: %s%s mimarisi için karþýt çevirim yapýlamadý -%s'den sonraki boþluk doldurulamadý: %sKÝTAPLIK ve ÝSÝM beraber olamaz.lib dosyasý açýlamadý: %sTaným dosyasý açýlamadý: %s%s dosyasý açýlamadý -Verilen makina %s kullanýlamadýArþiv dosyasýndan mcore-elf dll oluþturulamadý: %s%s girdi dosyasý durumlanamadý. -Durumlanamadý: %s: %sAyar dosyasý%s bölümünün içeriði: - -%s bölümünün içeriði: -%s bölümünün içeriði: - -.debug_str bölümünün içeriði: - -Telif Hakký (c) 2001 Free Software Foundation, Inc. -Lib dosyasý oluþturulduKitaplýk dosyasý açýlamadý: %sKoçan dosyasý oluþturuluyor: %sÞimdiki açýk arþiv %s -DLLTOOL adý : %s -DLLTOOL seçenekleri : %s -SÜRÜCÜ adý : %s -SÜRÜCÜ seçenekleri : %s -DÝN (Paylaþýmlý nesne dosyasý)Geçici temel dosya %s silindiGeçici taným dosyasý %s silindiGeçici ihraç dosyasý %s silindiBaðýmlýlýk denetim kitaplýðý%s bölümünün karþýt çevrimi: -Nesne DOSYA'sýndan bilgi gösterir. -%s bölümünün hata ayýklama içerik bilgilerini göstermek henüz desteklenmiyor. -Bu makina mimarisi üzerinde yer deðiþtirmeler konusunda bilgi yok -%s okunduELF Baþlýðý: -UYGU (Uygulama dosyasý)Dizi Sonu - -Giriþ noktasý Hata, orjinal hali ile EXPORT tekrarý: %sSembol dýþlandý: %s%s'in çalýþtýrýlmasý baþarýsýz olduBÝÇEM rc, res, veya coff deðerlerinden biri olup, eðer belirtilmezse dosya ismi sonekinden bulunur. Tek bir dosya ismi bir girdi dosyasý kabul edilir -Girdi dosya ismi verilmezse standart girdi, öntanýmlý rc okunur. -Çýktý dosya ismi verilmezse standart çýktý, öntanýmlý rc okunur. -Küme sayýsý okunamadý -Zincir sayýsý okunamadý +<Ä°S'e özel>: %d<.debug_str bölümü yok>: %d: %d: %lx: %xÇıktı dosyasına ihraçlar eklendiÇıktı dosyasına ihraçlar ekleniyorDenetim kitaplığıYardımcı kitaplıkBCD gerçel tipi desteklenmiyorBFD baÅŸlık dosyası sürümü %s +Kötü stab: %s +C++ temel sınıfı tanımlanmamışC++ temel sınıfı taşıyıcı içinde bulunamadıC++ veri üyesi taşıyıcı içinde bulunamadıC++ öntanımlı deÄŸerleri iÅŸlev içerisinde deÄŸilC++ nesnesinde hiç alan yokC++ referansı imleyici deÄŸilC++ referansı bulunamadıC++ statik sanal yöntemCORE (Core dosyası)%s'ye dolgu eklenemedi: %s%s mimarisi için karşıt çevirim yapılamadı +%s'den sonraki boÅŸluk doldurulamadı: %sKÄ°TAPLIK ve Ä°SÄ°M beraber olamaz.lib dosyası açılamadı: %sTanım dosyası açılamadı: %s%s dosyası açılamadı +Verilen makina %s kullanılamadıArÅŸiv dosyasından mcore-elf dll oluÅŸturulamadı: %s%s girdi dosyası durumlanamadı. +Durumlanamadı: %s: %sAyar dosyası%s bölümünün içeriÄŸi: + +%s bölümünün içeriÄŸi: +%s bölümünün içeriÄŸi: + +.debug_loc bölümünün içeriÄŸi: + +.debug_str bölümünün içeriÄŸi: + +Bir COFF nesne dosyasını SYSROFF nesne dosyasına çevirir +Telif Hakkı (c) 2002 Free Software Foundation, Inc. +Lib dosyası oluÅŸturulduKitaplık dosyası açılamadı: %sKoçan dosyası oluÅŸturuluyor: %sÅžimdiki açık arÅŸiv %s +DLLTOOL adı : %s +DLLTOOL seçenekleri : %s +SÃœRÃœCÃœ adı : %s +SÃœRÃœCÃœ seçenekleri : %s +DÄ°N (Paylaşımlı nesne dosyası)Geçici temel dosya %s silindiGeçici tanım dosyası %s silindiGeçici ihraç dosyası %s silindiBağımlılık denetim kitaplığı%s bölümünün karşıt çevrimi: +%s bölümünün hata ayıklama içerik bilgilerini göstermek henüz desteklenmiyor. +Bu makina mimarisi üzerinde yer deÄŸiÅŸtirmeler konusunda bilgi yok +%s okunduELF BaÅŸlığı: +UYGU (Uygulama dosyası)Dizi Sonu + +GiriÅŸ noktası Hata, orjinal hali ile EXPORT tekrarı: %sSembol dışlandı: %s%s'in çalıştırılması baÅŸarısız olduBİÇEM rc, res, veya coff deÄŸerlerinden biri olup, eÄŸer belirtilmezse dosya ismi sonekinden bulunur. Tek bir dosya ismi bir girdi dosyası kabul edilir +Girdi dosya ismi verilmezse standart girdi, öntanımlı rc okunur. +Çıktı dosya ismi verilmezse standart çıktı, öntanımlı rc okunur. +Küme sayısı okunamadı +Zincir sayısı okunamadı Dosyada birden fazla dinamik dizge tablosu var Dosyada birden fazla dinamik sembol tablosu var Dosyada birden fazla symtab shndx tablosu var -Filtre kitaplýðýSeçenekler:Ýhraç dosyasý oluþturulduÝhraç dosyasý oluþturuluyor: %sID dizin girdisiID kaynaðýID altdiziniIEEE sayýsal taþma: 0xIEEE dizge uzunluk taþmasý: %u -IEEE desteklenmeyen karmaþýk tip boyu %u -IEEE desteklenmeyen gerçel tip boyu %u -IEEE desteklenmeyen tamsayý tip boyu %u -Idx Adý Boy VMA LMA Dosya of HizaIdx Adý Boy VMA LMA Dosya of Hiza%2$s içinde %1$d satýrýnda bulunan bozukluk yoksayýldý%s arþivi içinde: -Girdi dosyasý %s bulunamadý. -Ýç hata: Bilinmeyen makina tipi: %dGeçersiz seçenek '-%c' -Geçersiz radix: %s -Geçici temel dosya %s tutulduGeçici taným dosyasý %s tutulduGeçici ihraç dosyasý %s tutulduSeçenekler: - W (yazdýrýr), A (ayýrýr), X (uygular), M (birleþtirir), S (dizgeler) - I (bilgi), L (bað sýrasý), G (grup), x (bilinmeyen) - O (daha fazla OS iþlemesi gerekli) o (OS'e özgü), p (iþlemciye özgü) -KÝTAPLIK: %s temel: %xHata öncesi son stabs girdileri: -Kitaplýk r_yolu: [%s]Kitaplýk çalýþým yolu: [%s]Kitaplýk so_adý: [%s]DOSYAlardaki sembolleri listeler (öntanýmlý a.out). -'%s' makinasý desteklenmiyor%s bölümünde birden fazla yeniden isimleme-o veya --dllname (dll adý) seçeneklerinin en azýndan bir tanesi belirtilmelidirÝSÝM: %s temel: %xHÝÇBÝRÝ (Hiçbiri)NT_FPREGS (kayan nokta yazmaçlarý)NT_FPREGSET (kayan nokta yazmaçlarý)NT_LWPSINFO (lwpsinfo_t yapýsý)NT_LWPSTATUS (lwpstatus_t yapýsý)NT_PRPSINFO (prpsinfo yapýsý)NT_PRSTATUS (prstatus yapýsý)NT_PRXFPREG (user_xfpregs yapýsý)NT_PSINFO (psinfo yapýsý)NT_PSTATUS (pstatus yapýsý)NT_TASKSTRUCT (görev yapýsý)NT_WIN32PSTATUS (win32_pstatus yapýsý)N_LBRAC iþlev içerisinde deðil -Name Value Class Type Size Line Section - -Ýsim Deðer Sýnýf Tip Boy Satýr Bölüm - -Ýsim Endeksi: %ld -Ýsim: %s -NetBSD procinfo yapýsý%s bölümü yok - -Arþiv içinde %s girdisi yok. -"%s" için karýþtýrma yok -`%s' adýnda bir üye yok -Core dosyasýnda not parçalarý yok. -HiçbiriELF dosyasý deðil - baþlangýçta yanlýþ sihirli baytlar var +Filtre kitaplığıSeçenekler:Ä°hraç dosyası oluÅŸturulduÄ°hraç dosyası oluÅŸturuluyor: %sID dizin girdisiID kaynağıID altdiziniIEEE sayısal taÅŸma: 0xIEEE dizge uzunluk taÅŸması: %u +IEEE desteklenmeyen karmaşık tip boyu %u +IEEE desteklenmeyen gerçel tip boyu %u +IEEE desteklenmeyen tamsayı tip boyu %u +Idx Adı Boy VMA LMA Dosya of HizaIdx Adı Boy VMA LMA Dosya of Hiza%2$s içinde %1$d satırında bulunan bozukluk yoksayıldı%s arÅŸivi içinde: +Girdi dosyası %s bulunamadı. +İç hata: Bilinmeyen makina tipi: %dGeçersiz seçenek '-%c' +Geçersiz radix: %s +Geçici temel dosya %s tutulduGeçici tanım dosyası %s tutulduGeçici ihraç dosyası %s tutulduSeçenekler: + W (yazdırır), A (ayırır), X (uygular), M (birleÅŸtirir), S (dizgeler) + I (bilgi), L (baÄŸ sırası), G (grup), x (bilinmeyen) + O (daha fazla OS iÅŸlemesi gerekli) o (OS'e özgü), p (iÅŸlemciye özgü) +KÄ°TAPLIK: %s temel: %xHata öncesi son stabs girdileri: +Kitaplık r_yolu: [%s]Kitaplık çalışım yolu: [%s]Kitaplık so_adı: [%s]'%s' makinası desteklenmiyor%s bölümünde birden fazla yeniden isimleme-o veya --dllname (dll adı) seçeneklerinin en azından bir tanesi belirtilmelidirÄ°SÄ°M: %s temel: %xHİÇBÄ°RÄ° (Hiçbiri)NT_FPREGS (kayan nokta yazmaçları)NT_FPREGSET (kayan nokta yazmaçları)NT_LWPSINFO (lwpsinfo_t yapısı)NT_LWPSTATUS (lwpstatus_t yapısı)NT_PRPSINFO (prpsinfo yapısı)NT_PRSTATUS (prstatus yapısı)NT_PRXFPREG (user_xfpregs yapısı)NT_PSINFO (psinfo yapısı)NT_PSTATUS (pstatus yapısı)NT_TASKSTRUCT (görev yapısı)NT_WIN32PSTATUS (win32_pstatus yapısı)N_LBRAC iÅŸlev içerisinde deÄŸil +Ä°sim DeÄŸer Sınıf Tip Boy Satır Bölüm + +Ä°sim DeÄŸer Sınıf Tip Boy Satır Bölüm + +Ä°sim Endeksi: %ld +Ä°sim: %s +NetBSD procinfo yapısı%s bölümü yok + +ArÅŸiv içinde %s girdisi yok. +"%s" için karıştırma yok +`%s' adında bir üye yok +Core dosyasında not parçaları yok. +HiçbiriELF dosyası deÄŸil - baÅŸlangıçta yanlış sihirli baytlar var Gereksiz nesne: [%s] -Yapýlacak bir þey yok. -Ýþletim Sistemine Özel: (%x)Yalnýz -X 32_64 destekleniyorÞimdilik yalnýzca DWARF 2 a-aralýklarý destekleniyor. -Þimdilik yalnýz DWARF 2 genel isimleri destekleniyor -Þimdilik yalnýzca DWARF sürüm 2 satýr bilgisi destekleniyor. -Þimdilik yalnýzca DWARF Sürüm 2 hata ayýklama bilgisi destekleniyor. -Geçici dosya açýldý: %sÝþletim Sistemine Özel: %lxSeçenekler: - -i DOSYA, --input DOSYA Girdi dosyasý ismi - -o DOSYA, --output DOSYA Çýktý dosyasý ismi - -I BÝÇEM, --input-format BÝÇEM - Girdi biçemini belirtir - -O BÝÇEM, --output-format BÝÇEM - Çýktý biçemini belirtir - -F HEDEF, --target HEDEF COFF hedefini belirtir - --preprocessor YAZILIM rc dosyasýný öniþlemek için kullanýlacak yazýlým - --include-dir DÝZÝN rc dosyasý öniþlenirken dizini dahil et - -DSYM[=DEÐER], --define SYM[=DEÐER] - rc dosyasý öniþlenirken SYM'i tanýmlar - -v Açýklamalý - ne yapýldýðýný anlatýr - --language DEÐER rc dosyasý okunurken dili belirtir - --use-temp-file Öniþlemci çýktýsýný okumak için popen yerine geçici dosya kullanýr - --no-use-temp-file (öntanýmlý) popen kullanýr -Bellek yetersizBellek tükendi -%2$s için %1$d bayt ayrýlýrken bellek tükendi -Döküm istek tablosu ayrýlýrken bellek tükendi.Sanal bellek tükendiPT_FIRSTMACH+%dPT_GETFPREGS (kayan nokta yazmaç yapýsý)PT_GETREGS (yazmaç yapýsý)Pascal dosya adý desteklenmiyorTaným dosyasý iþlendiTanýmlar iþlendiTaným dosyasý iþleniyor: %sTanýmlar iþleniyorÝþlemciye Özel: %lxÝþlemciye Özel: (%x)YER (Yer deðiþtirebilen dosya)%2$s'nin %1$s bölümünün okunmasý baþarýsýz: %3$s%2$s'nin %1$s bölümünün okunmasý baþarýsýz: %3$s -Yazýlým hatalarýný %s adresine, çeviri hatalarýný adresine gönderin -Hatalarý %s adresine, -çeviri hatalarýný adresine bildiriniz. -Nesne dosyasý %s taranýyorBölümler: -Paylaþýmlý kitaplýk: [%s]beklenmeyen yerdeðiþim türü %s atlanýyor -beklenmeyen sembol türü %u atlanýyor -Bazý bölümler dökülmedi çünkü mevcut deðiller! -Tekbaþýna Uygulama%2$s'in %1$s bölümünden bilgi emiliyorDesteklenen platformlar:Desteklenen hedefler:Taným dosyasý %s'nda sözdizim hatasý:%dSatýr bilgisi bozuk - bölüm çok küçük -%s bölümü içeriyor: -%s bölümü içeriyor: - -%d adet bölüm baþlýðý mevcut, göreli konum 0x%lx'dan baþlanýyor: -Bu readelf, 64 bitlik veri türü desteði olmaksýzýn derlenmiþtir ve -64 bitlik ELF dosyalarýný okuyamaz. -Bu, bir serbest yazýlýmdýr; GNU Genel Kamu Lisansý koþullarý altýnda deðiþiklik -yapabilir ve/veya yeniden daðýtabilirsiniz. -Bu yazýlýmýn herhangi bir garantisi yoktur. -Fazla sayýda N_RBRAC +Yapılacak bir ÅŸey yok. +Ä°ÅŸletim Sistemine Özel: (%x)Yalnız -X 32_64 destekleniyorÅžimdilik yalnızca DWARF 2 a-aralıkları destekleniyor. +Åžimdilik yalnız DWARF 2 genel isimleri destekleniyor +Åžimdilik yalnızca DWARF sürüm 2 satır bilgisi destekleniyor. +Åžimdilik yalnızca DWARF Sürüm 2 hata ayıklama bilgisi destekleniyor. +Geçici dosya açıldı: %sÄ°ÅŸletim Sistemine Özel: %lxBellek yetersizBellek tükendi +%2$s için %1$d bayt ayrılırken bellek tükendi +Döküm istek tablosu ayrılırken bellek tükendi.Sanal bellek tükendiPT_FIRSTMACH+%dPT_GETFPREGS (kayan nokta yazmaç yapısı)PT_GETREGS (yazmaç yapısı)Pascal dosya adı desteklenmiyorSYSROFF nesne dosyasını insan tarafından okunabilir biçemde yazdırır +Tanım dosyası iÅŸlendiTanımlar iÅŸlendiTanım dosyası iÅŸleniyor: %sTanımlar iÅŸleniyorÄ°ÅŸlemciye Özel: %lxÄ°ÅŸlemciye Özel: (%x)YER (Yer deÄŸiÅŸtirebilen dosya)%2$s'nin %1$s bölümünün okunması baÅŸarısız: %3$s%2$s'nin %1$s bölümünün okunması baÅŸarısız: %3$s +Yazılım hatalarını %s adresine, çeviri hatalarını adresine gönderin +Hataları %s adresine, +çeviri hatalarını adresine bildiriniz. +Nesne dosyası %s taranıyorBölümler: +Paylaşımlı kitaplık: [%s]beklenmeyen yerdeÄŸiÅŸim türü %s atlanıyor +beklenmeyen sembol türü %u atlanıyor +Bazı bölümler dökülmedi çünkü mevcut deÄŸiller! +Tekbaşına Uygulama%2$s'in %1$s bölümünden bilgi emiliyorDesteklenen platformlar:Desteklenen hedefler:Tanım dosyası %s'nda sözdizim hatası:%dSatır bilgisi bozuk - bölüm çok küçük +%s bölümü içeriyor: +%s bölümü içeriyor: + +%d adet bölüm baÅŸlığı mevcut, göreli konum 0x%lx'dan baÅŸlanıyor: +Bu readelf, 64 bitlik veri türü desteÄŸi olmaksızın derlenmiÅŸtir ve +64 bitlik ELF dosyalarını okuyamaz. +Bu, bir serbest yazılımdır; GNU Genel Kamu Lisansı koÅŸulları altında deÄŸiÅŸiklik +yapabilir ve/veya yeniden dağıtabilirsiniz. +Bu yazılımın herhangi bir garantisi yoktur. +Fazla sayıda N_RBRAC `%s' denendi -Dosya denendi: %sTip dosya numarasý %d aralýk dýþý -Tip endeks numarasý %d aralýk dýþý +Dosya denendi: %sTip dosya numarası %d aralık dışı +Tip endeks numarası %d aralık dışı TANIMSIZ: uzunluk %d -Girdi dosyanýn küçük/büyük sonluluðu deðiþtirilemediDinamik dizge tablosunun uzunluðu belirlenemedi -Yüklenecek sembol sayýsý belirlenemedi -Yazýlým yorumlayýcýsý adý bulunamadý -.debug_abbrev bölümü bulunamadý! -Kýsaltma tablosunda %lu girdisi bulunamadý -Temel-dosyasý açýlamadý: %sNesne dosyasý açýlamadý: %sGeçiçi üretici dosyasý açýlamadý: %s%2$s'in %1$d baytý okunamadý -Dinamik veri okunamadý -%2$s için %1$x'e kadar arama yapýlamadý -Dosyanýn sonuna kadar aranamadý -Dosya sonuna kadar aranamýyor!Dinamik bilginin baþlangýcýna kadar aranamadýN_EXCL tanýmsýzDesteklenmeyen veri uzunluðu: %d -Bilinmeyen AT deðeri: %lxBilinmeyen FORM deðeri: %lxBilinmeyen TAG deðeri: %lxBilinmeyen not tipi: (0x%08x)Tanýnmayan hata ayýklama seçeneði '%s' -Tanýnmayan hata ayýklama bölümü: %s +Girdi dosyanın küçük/büyük sonluluÄŸu deÄŸiÅŸtirilemediDinamik dizge tablosunun uzunluÄŸu belirlenemedi +Yüklenecek sembol sayısı belirlenemedi +Yazılım yorumlayıcısı adı bulunamadı +.debug_abbrev bölümü bulunamadı! +Kısaltma tablosunda %lu girdisi bulunamadı +Temel-dosyası açılamadı: %sNesne dosyası açılamadı: %sGeçiçi üretici dosyası açılamadı: %s%2$s'in %1$d baytı okunamadı +Dinamik veri okunamadı +%2$s için %1$x'e kadar arama yapılamadı +Dosyanın sonuna kadar aranamadı +Dosya sonuna kadar aranamıyor!Dinamik bilginin baÅŸlangıcına kadar aranamadıN_EXCL tanımsızDesteklenmeyen veri uzunluÄŸu: %d +Bilinmeyen AT deÄŸeri: %lxBilinmeyen FORM deÄŸeri: %lxBilinmeyen TAG deÄŸeri: %lxBilinmeyen not tipi: (0x%08x)Bilinmeyen XCOFF tipi %d +Tanınmayan hata ayıklama seçeneÄŸi '%s' +Tanınmayan hata ayıklama bölümü: %s Bilinmeyen form: %d -Bilinmeyen XCOFF tipi %d -Kullaným %s -Kullaným: %s girdi-dosyasý [çýktý-dosyasý] -Kullaným: %s girdi-dosya(larý) -Kullaným: %s SEÇENEK... DOSYA... -Kullaným: %s [-A | --format=sysv | -B | --format=berkeley] Biçem - [-o | --radix=8 | -d | --radix=10 | -h | --radix=16] - [-V | --version] Sürüm - [--target=bfd_adý] Hedef - [--help] Yardým - [dosya...] [dosya] -Kullaným: %s [-CfsHV] [-b bfd_adý] - [--target=bfd_adý] hedef - [-e uygulama] [--exe=uygulama] - [--demangle[=tarz]] düzeltme tarzý - [--basenames] temel isimler - [--functions] [adres adres ...] iþlevler -Kullaným: %s [-X32_64] [-]{dmpqrstx}[abcfilNoPsSuvV] [üye-adý] [sayý] arþiv-dosyasý dosya... -Kullaným: %s [-afov] [-n min-uzun] [-min-len] En az uzunluk - [-t {o,x,d}] [-e {s,b,l,B,L}] [-] - [--all] Hepsi - [--print-file-name] Dosya adýný yazdýrýr - [--bytes=min-uzun] En az bayt - [--radix={o,x,d}] - [--target=bfd_adý] Hedef - [--encoding {s,b,l,B,L}] Kodlama - [--help] Yardým - [--version] Sürüm bilgisi - dosya... -Kullaným: %s [-dhV] [-I bfd_adý] [-O bfd_adý] [-T baþlýk-dosyasý] - [-l baðlayýcý] - [--input-target=bfd_adý] girdi dosyasý adý - [--output-target=bfd_adý] çýktý dosyasý adý - [--header-file=dosya] baþlýk dosyasý adý - [--linker=baðlayýcý] baðlayýcý yazýlým adý - [--debug] hata ayýklama kipi - [--help] bu yardýmý gösterir - [--version] sürüm bilgisini gösterir - [girdi-dosyasý [çýktý-dosyasý]] -Kullaným: %s [-dhVq] girdi-dosyasý [çýktý-dosyasý] -Kullaným: %s [-hV] girdi-dosyasý -Kullaným: %s [-vV] arþiv -Kullaným: %s [SEÇENEK]... [DOSYA]... -Kullaným: %s [seçenekler] [girdi-dosyasý] [çýktý-dosyasý] -Kullaným: readelf {seçenekler} elf-dosya(larý) -`%s' kullanýlýyor -Dosya kullanýlýyor: %sÖniþlemci çýktýsý popen ile okunuyor -`%s' geçici dosyasý öniþlemci çýktýsýný okumak için kullanýlýyor -`N' deðeri pozitif olmalý.Uyarý, EXPORT tekrarý %s %d,%d yoksayýldýUyarý: %s: %s -Uyarý: Çýktý dosyasý %s mimarisini temsil edemezUyarý: tip boyutu %d'den %d'ye deðiþtirildi -Uyarý: ikilik platform parametresi için ikilik (`binary') girdi hedefi gerekli.Uyarý: dolgu, 0x%s'dan 0x%x'ya kýrpýldý`N' yalnýzca `x' ve `d' seçenekleri ile anlamlýdýr.`u' yalnýzca `r' seçeneði ile anlamlýdýr.hýzlandýrýcýhizalamaalternatif makina kodu indeksi pozitif olmalý%s platformu bilinmiyormimari: %s,hatalý ATN65 kaydýhatalý C++ alan biti konum veya boyuhatalý dinamik sembol%s için hatalý biçemkötü karýþtýrýlmýþ isim '%s' -hatalý misc kaydýC++ yöntem iþlevi için hatalý tiphatalý oluþturulmuþ uzun satýr iþlevi bulundu! -bfd_coff_get_auxent baþarýsýz: %sbfd_coff_get_syment baþarýsýz: %skoçan dosyasý bfd_open ile açýlamadý: %syýðýt üzerinde bloklar kaldýbayt numarasý serpiþtirmeden daha küçük olmalýbayt numarasý negatif olmamalý`%s' dosyasýnýn tipi belirlenemedi; -I seçeneðini kullanýn`%s' bölümü oluþturulamadý: %s`%s' çalýþtýrýlamýyor: %sBFD_RELOC_RVA yer deðiþtirme tipi alýnamýyor%s `%s' açýlamadý: %s'%s' çýktý için açýlamadý: %s`%s' geçici dosyasý açýlamýyor: %s`%s' popen yapýlamýyor: %skaynak bölümü okunamýyorstandart çýktý yönlendirilemiyor: `%s': %sBFD öntanýmlý hedef `%s' olarak atanamadý: %s%s silinemedi: %sarþiv kopyalamasý için mkdir %s baþarýlý olamadý (hata: %s)%s girdi dosyasý açýlamadýaçýlamadý: %s: %sdurumlanamadý: %s: %sçakýþmatablolu ve tablosuz çeliþki listesisabit/deðiþken belirteci eksikkontrol verisi için DIALOGEX gerekli%s(%s)'dan %s(%s)'a kopyalar -%s oluþturuluyorgöstergegösterge dosyasý '%s' gösterge verisi içermiyorözel bölümveri girdisiveri büyüklüðü %ldhata ayýklama bölüm verisidebug_abbrev bölüm verisihata_ayýkla_mevcut_isim_uzayýna_ekle: mevcut dosya yokhata_ayýkla_son_blok: tepe seviye bloðu kapama denemesihata_ayýkla_son_blok: mevcut blok yokhata_ayýkla_ortak_blok_son: henüz tamamlanmamýþhata_ayýkla_son_iþlev: mevcut iþlev yokhata_ayýkla_son_iþlev: bazý bloklar kapatýlmamýþhata_ayýkla_isimli_tipi_bul: mevcut derleme birimi yokhata_ayýkla_gerçek_tipi_al: %s için çevrimsel hata ayýklama bilgisi -hata_ayýkla_tanýmlanmamýþ_tip: desteklenmeyen tiphata_ayýkla_isim_tipi: mevcut dosya yokhata_ayýkla_kayýt_iþlevi: hata_ayýkla_dosya_adý_ata çaðrýlmadýhata_ayýkla_kayýt_etiket: henüz tamamlanmamýþhata_ayýkla_kayýt_satýr: mevcut birim yokhata_ayýkla_kayýt_parametresi: mevcut iþlev yokhata_ayýkla_kayýt_deðiþken: mevcut blok yokhata_ayýkla_kayýt_deðiþken: mevcut dosya yokhata_ayýkla_baþla_blok: mevcut blok yokhata_ayýkla_ortak_blok_baþla: henüz tamamlanmamýþhata_ayýkla_kaynak: hata_ayýkla_dosya_adý_ata çaðrýlmadýdebug_str bölüm verisihata_ayýkla_etiket_tipi: fazla etiketleme denendihata_ayýkla_etiket_tipi: mevcut dosya yokhata_ayýkla_yaz_tipi: geçersiz tip bulundu--format=berkeley öntanýmlý ---format=sysv öntanýmlý -diyalog kontrolüdiyalog kontrol verisidiyalog kontrol sonudiyalog yazýtipi büyüklüðüdiyalog baþlýðýdialogex kontrolüdialogex yazýtipi bilgisidizindizin girdi ismidinamik bölümdinamik dizge tablosudinamik dizgelerifade yýðýtý uyumsuzluðuifade yýðýtýnda taþmaifade yýðýt taþmasýgeçici baþlýk dosyasý açýlamadý: %sgeçici kuyruk dosyasý açýlamadý: %sCOFF girdisi için dosya adý gerekliCOFF çýktý için dosya adý gereklisabit sürüm bilgisiseçeneklerseçenekler 0x%08x: -yazýtipi diziniyazýtipi aygýt adýyazýtipi dizini aile ismiyazýtipi dizin baþlýðýgrup göstergesigrup gösterge baþlýðýgrup ikonugrup ikon baþlýðýastlarý varyardým ID için DIALOGEX gerekliyardým bölümüikon dosyasý '%s' ikon verisi içermiyorgeçersiz seçenek -- %cgeçersiz tip endeksigeçersiz deðiþken endeksigirdi ve çýktý dosyalarý farklý olmalýgirdi dosyasý ismi hem komut satýrýnda hem INPUT olarak verilmiþserpiþtirme pozitif olmalýiç hata -- bu seçenek henüz yazýlmadý%s üzerinde iç durumlama hatasý--format'a geçersiz seçenek: %sgeçersiz tamsayý argümaný %sgeçersiz sayýgeçersiz sayý %sgeçersiz dizge uzunluðuliblist.bss bölümü oluþtur.nlmsections bölümü oluþturbölüm oluþturoluþturuluyormenü baþlýðýmenuex baþlýðýmenuex basamaðýmenü üyesimenü üyesi baþlýðýileti bölümüeksik endeks tipiGerekli ASN yokGerekli ATN65 yokmodül bölümübir dinamik parçadan fazla -isimli dizin girdisiisimli kaynakisimli altdizinkarýþtýrýlmýþ dizgede argüman tipi yok -astlarý yokarþivde %s girdisi yok -arþiv %2$s içerisinde %1$s girdisi yok!ihraç taným dosyasý verilmemiþ. -Bir tane oluþturuluyor fakat istediðiniz bu olmayabilirgirdi dosyasý yokgirdi dosyasý belirtilmediçýktý dosyasý için isim yokiþlev belirtilmemiþkaynak yokC++ yöntem iþlevi için tip bilgisi yokyoknotlarboþ deðerle sonlanmýþ unicode dizgesisayýsal taþmaseçenekleryer deðiþtirmeleri tararken bellek tükendi%s'e göreli yer deðiþtirme ayarlanýrken taþma oluþtuparse_coff_type: Kötü tip kodu 0x%xözel veriYazýlým Baþlýklarýreferans parametresi imleyici deðilyerdeðiþimlerkaynak IDkaynak verisikaynak veri boyukaynak tipi bilinmiyorrpc bölümübölüm verisiBölüm Baþlýklarý.bss vma atar.data boyu atar.nlmsection içeriðini atar.nlmsections seçenekleri atar.nlmsections boyunu atarAdresi 0x%lx olarak atar -bölüm hizalanmasý atarbölüm seçeneklerini atarbölüm boyu belirtirbaþlangýç adresini atarpaylaþýmlý bölümboyutstab_int_type: hatalý boy %uyýðýt taþmasýyýðýt alt taþmasý`%s' bitmap dosyasý durumlanamadý: %sstat komutu, %s için negatif büyüklük gösteriyordizge tablosustring_hash_lookup baþarýsýz: %sdizgetablosu dizgesidizgetablosu dizge uzunluðukoçan bölüm boylarýAst-iþlem %d ölümcül sinyalini aldý%s için destek derlenmemiþdesteklenen seçenekler: %ssembol bilgisisembollersymtab shndxiki farklý iþlev seçeneði belirtilmiþçýktý dosyasý %s açýlamadýtanýmlanmamýþ C++ nesnesitanýmlanmamýþ C++ vtablosuATN'de tanýmsýz deðiþkenTY'de tanýmsýz deðiþkenbeklenmeyen diyalog imzasý %dhata ayýklama bilgilerinde beklenmeyen sonbeklenmeyen sabit sürüm bilgisi sürümü %lubeklenmeyen sabit sürüm bilgi uzunluðu %dbeklenmeyen sabit sürüm imzasý %lubeklenmeyen grup gösterge tipi %dbeklenmeyen grup ikon tipi %dbeklenmeyen sayýbeklenmeyen kayýt tipiC++ misc içinde beklenmeyen dizgebeklenmeyen dizge dosya bilgi deðer uzunluðu %dbeklenmeyen deðiþken dosya bilgi deðer uzunluðu %ddizgenin beklenmeyen sürümübeklenmeyen sürüm dizge uzunluðu %d != %d + %dbeklenmeyen sürüm dizge uzunluðu %d < %dbeklenmeyen sürüm dizge tablo deðer uzunluðu %dbeklenmeyen sürüm tipi %dbeklenmeyen sürüm deðer uzunluðu %dbilinmeyen ATN tipibilinmeyen BB tipiBilinmeyen C++ þifreli ismibilinmeyen C++ görünürlüðübilinmeyen TY kodubilinmeyen alternatif makina kodu, yoksayýldýbilinmeyen oluþumiçi tipbilinmeyen düzeltme tarzý '%s'bilinmeyen biçem tipi `%s'bilinmeyen bölümtemel sýnýf için bilinmeyen sanal karaktertemel sýnýf için bilinmeyen görünebilirlik karakterialan için bilinmeyen görünürlük karakteriisimlenmemiþ $vb tipibilinmeyen: %-7lxtanýnmayan --endian tipi `%s'tanýnmayan -E seçeneðitanýnmayan C++ kýsaltmasýbilinmeyen öntanýmlý C++ tipibilinmeyen C++ misc kaydýbilinmeyen C++ nesne masraf tanýmýbilinmeyen C++ nesne tanýmýbilinmeyen C++ referans tipitanýnmayan çapraz baþvuru tipibilinmeyen bölüm seçeneði `%s'%s'e göreli PC yer deðiþtirme çözümlenemedidesteklenmeyen ATN11desteklenmeyen ATN12desteklenmeyen C++ nesne tipidesteklenmeyen IEEE ifade iþlemimidesteklenmeyen menü sürümü %ddesteklenmeyen niteleyicigeri alma bilgisigeri alma tablosusürüm verisisürüm tanýmýSürüm yardýmcý tanýmýsürüm tanýmý bölümüsürüm uzunluðu %d, kaynak uzunluðu %lu ile eþleþmiyorSürüm GereksinimSürüm Gereksinim Yardýmcý (2)Sürüm Gereksinim Yardýmcý (3)Sürüm Gereksinim BölümSürüm Dizge TabloSürüm Sembol Verisürüm deðiþken bilgisideðiþken dosya bilgi sürümüvmabekle: %swarning: CHECK altyordamý %s tanýmsýzuyarý: EXIT altyordamý %s tanýmsýzuyarý: MAP ve FULLMAP desteklenmiyor; ld -M komutunu deneyinuyarý: Sürüm numarasý verilmemiþuyarý: START altyordamý %s tanýmsýzuyarý: girdi ve çýktý biçemleri uyumlu deðiluyarý: %s sembolü ithal edildi ama ithal listesinde deðilkoçan yazýlýyor \ No newline at end of file +Kullanım %s +Kullanım: %s +Kullanım: %s girdi-dosya(ları) +Kullanım: %s [öykünüm seçenekleri] [-]{dmpqrstx}[abcfilNoPsSuvV] [üye-adı] [sayı] arÅŸiv-dosyası dosya... +Kullanım: %s [seçenekler] [adresler] +Kullanım: %s [seçenekler] [dosya(lar)] +Kullanım: %s [seçenekler] [girdi-dosyası [çıktı-dosyası]] +Kullanım: %s [seçenekler] [girdi-dosyası] [çıktı-dosyası] +Kullanım: %s girdi-dosya(ları) +Kullanım: %s [seçenekler] girdi-dosyası [çıktı-dosyası] +Kullanım: %s [seçenekler] arÅŸiv +Kullanım: readelf elf-dosya(ları) +`%s' kullanılıyor +Dosya kullanılıyor: %sÖniÅŸlemci çıktısı popen ile okunuyor +`%s' geçici dosyası öniÅŸlemci çıktısını okumak için kullanılıyor +`N' deÄŸeri pozitif olmalı.Uyarı, EXPORT tekrarı %s %d,%d yoksayıldıUyarı: %s: %s +Uyarı: Çıktı dosyası %s mimarisini temsil edemezUyarı: tip boyutu %d'den %d'ye deÄŸiÅŸtirildi +Uyarı: ikilik platform parametresi için ikilik (`binary') girdi hedefi gerekli.Uyarı: dolgu, 0x%s'dan 0x%x'ya kırpıldı`N' yalnızca `x' ve `d' seçenekleri ile anlamlıdır.`u' yalnızca `r' seçeneÄŸi ile anlamlıdır.hızlandırıcıhizalamaalternatif makina kodu indeksi pozitif olmalı%s platformu bilinmiyormimari: %s,hatalı ATN65 kaydıhatalı C++ alan biti konum veya boyuhatalı dinamik sembol%s için hatalı biçemkötü karıştırılmış isim '%s' +hatalı misc kaydıC++ yöntem iÅŸlevi için hatalı tiphatalı oluÅŸturulmuÅŸ uzun satır iÅŸlevi bulundu! +bfd_coff_get_auxent baÅŸarısız: %sbfd_coff_get_syment baÅŸarısız: %skoçan dosyası bfd_open ile açılamadı: %syığıt üzerinde bloklar kaldıbayt numarası serpiÅŸtirmeden daha küçük olmalıbayt numarası negatif olmamalı`%s' dosyasının tipi belirlenemedi; -I seçeneÄŸini kullanın`%s' bölümü oluÅŸturulamadı: %s`%s' çalıştırılamıyor: %sBFD_RELOC_RVA yer deÄŸiÅŸtirme tipi alınamıyor%s `%s' açılamadı: %s'%s' çıktı için açılamadı: %s`%s' geçici dosyası açılamıyor: %s`%s' popen yapılamıyor: %skaynak bölümü okunamıyorstandart çıktı yönlendirilemiyor: `%s': %sBFD öntanımlı hedef `%s' olarak atanamadı: %s%s silinemedi: %sarÅŸiv kopyalaması için mkdir %s baÅŸarılı olamadı (hata: %s)%s girdi dosyası açılamadıaçılamadı: %s: %sdurumlanamadı: %s: %sçakışmadinamik sembol tablosu olmayan çeliÅŸki listesi bulundusabit/deÄŸiÅŸken belirteci eksikkontrol verisi için DIALOGEX gerekli%s(%s)'dan %s(%s)'a kopyalar +'core' notlarının içinde, %x görecesinde bozuk not bulundu +%s oluÅŸturuluyorgöstergegösterge dosyası '%s' gösterge verisi içermiyorözel bölümveri girdisiveri büyüklüğü %ldhata ayıklama bölüm verisidebug_abbrev bölüm verisihata_ayıkla_mevcut_isim_uzayına_ekle: mevcut dosya yokhata_ayıkla_son_blok: tepe seviye bloÄŸu kapama denemesihata_ayıkla_son_blok: mevcut blok yokhata_ayıkla_ortak_blok_son: henüz tamamlanmamışhata_ayıkla_son_iÅŸlev: mevcut iÅŸlev yokhata_ayıkla_son_iÅŸlev: bazı bloklar kapatılmamışhata_ayıkla_isimli_tipi_bul: mevcut derleme birimi yokhata_ayıkla_gerçek_tipi_al: %s için çevrimsel hata ayıklama bilgisi +hata ayıklama bölüm verisihata_ayıkla_tanımlanmamış_tip: desteklenmeyen tiphata_ayıkla_isim_tipi: mevcut dosya yokhata_ayıkla_kayıt_iÅŸlevi: hata_ayıkla_dosya_adı_ata çaÄŸrılmadıhata_ayıkla_kayıt_etiket: henüz tamamlanmamışhata_ayıkla_kayıt_satır: mevcut birim yokhata_ayıkla_kayıt_parametresi: mevcut iÅŸlev yokhata_ayıkla_kayıt_deÄŸiÅŸken: mevcut blok yokhata_ayıkla_kayıt_deÄŸiÅŸken: mevcut dosya yokhata_ayıkla_baÅŸla_blok: mevcut blok yokhata_ayıkla_ortak_blok_baÅŸla: henüz tamamlanmamışhata_ayıkla_kaynak: hata_ayıkla_dosya_adı_ata çaÄŸrılmadıdebug_str bölüm verisihata_ayıkla_etiket_tipi: fazla etiketleme denendihata_ayıkla_etiket_tipi: mevcut dosya yokhata_ayıkla_yaz_tipi: geçersiz tip bulundudiyalog kontrolüdiyalog kontrol verisidiyalog kontrol sonudiyalog yazıtipi büyüklüğüdiyalog baÅŸlığıdialogex kontrolüdialogex yazıtipi bilgisidizindizin girdi ismidinamik bölümdinamik dizge tablosudinamik dizgelerifade yığıtı uyumsuzluÄŸuifade yığıtında taÅŸmaifade yığıt taÅŸmasıgeçici baÅŸlık dosyası açılamadı: %sgeçici kuyruk dosyası açılamadı: %sCOFF girdisi için dosya adı gerekliCOFF çıktı için dosya adı gereklisabit sürüm bilgisiseçeneklerseçenekler 0x%08x: +yazıtipi diziniyazıtipi aygıt adıyazıtipi dizini aile ismiyazıtipi dizin baÅŸlığıgrup göstergesigrup gösterge baÅŸlığıgrup ikonugrup ikon baÅŸlığıastları varyardım ID için DIALOGEX gerekliyardım bölümüikon dosyası '%s' ikon verisi içermiyorgeçersiz seçenek -- %cgeçersiz tip endeksigeçersiz deÄŸiÅŸken endeksigirdi ve çıktı dosyaları farklı olmalıgirdi dosyası ismi hem komut satırında hem INPUT olarak verilmiÅŸserpiÅŸtirme pozitif olmalıiç hata -- bu seçenek henüz yazılmadı%s üzerinde iç durumlama hatası--format'a geçersiz seçenek: %sgeçersiz tamsayı argümanı %sgeçersiz sayıgeçersiz sayı %sgeçersiz dizge uzunluÄŸuliblistliblist dizge tablosu.bss bölümü oluÅŸtur.nlmsections bölümü oluÅŸturbölüm oluÅŸturoluÅŸturuluyormenü baÅŸlığımenuex baÅŸlığımenuex basamağımenü üyesimenü üyesi baÅŸlığıileti bölümüeksik endeks tipiGerekli ASN yokGerekli ATN65 yokmodül bölümübir dinamik parçadan fazla +isimli dizin girdisiisimli kaynakisimli altdizinkarıştırılmış dizgede argüman tipi yok +astları yokarÅŸivde %s girdisi yok +arÅŸiv %2$s içerisinde %1$s girdisi yok!ihraç tanım dosyası verilmemiÅŸ. +Bir tane oluÅŸturuluyor fakat istediÄŸiniz bu olmayabilirgirdi dosyası yokgirdi dosyası belirtilmediçıktı dosyası için isim yokiÅŸlev belirtilmemiÅŸkaynak yokC++ yöntem iÅŸlevi için tip bilgisi yokyoknotlarboÅŸ deÄŸerle sonlanmış unicode dizgesisayısal taÅŸmaseçenekleryer deÄŸiÅŸtirmeleri tararken bellek tükendi%s'e göreli yer deÄŸiÅŸtirme ayarlanırken taÅŸma oluÅŸtuparse_coff_type: Kötü tip kodu 0x%xözel veriYazılım BaÅŸlıklarıreferans parametresi imleyici deÄŸilyerdeÄŸiÅŸimlerkaynak IDkaynak verisikaynak veri boyukaynak tipi bilinmiyorrpc bölümübölüm verisiBölüm BaÅŸlıkları.bss vma atar.data boyu atar.nlmsection içeriÄŸini atar.nlmsections seçenekleri atar.nlmsections boyunu atarAdresi 0x%lx olarak atar +bölüm hizalanması atarbölüm seçeneklerini atarbölüm boyu belirtirbaÅŸlangıç adresini atarpaylaşımlı bölümboyutstab_int_type: hatalı boy %uyığıt taÅŸmasıyığıt alt taÅŸması`%s' bitmap dosyası durumlanamadı: %sstat komutu, %s için negatif büyüklük gösteriyordizge tablosustring_hash_lookup baÅŸarısız: %sdizgetablosu dizgesidizgetablosu dizge uzunluÄŸukoçan bölüm boylarıAst-iÅŸlem %d ölümcül sinyalini aldı%s için destek derlenmemiÅŸdesteklenen seçenekler: %ssembol bilgisisembollersymtab shndxiki farklı iÅŸlev seçeneÄŸi belirtilmişçıktı dosyası %s açılamadıtanımlanmamış C++ nesnesitanımlanmamış C++ vtablosuATN'de tanımsız deÄŸiÅŸkenTY'de tanımsız deÄŸiÅŸkenbeklenmeyen DIALOGEX sürümü %dhata ayıklama bilgilerinde beklenmeyen sonbeklenmeyen sabit sürüm bilgisi sürümü %lubeklenmeyen sabit sürüm bilgi uzunluÄŸu %dbeklenmeyen sabit sürüm imzası %lubeklenmeyen grup gösterge tipi %dbeklenmeyen grup ikon tipi %dbeklenmeyen sayıbeklenmeyen kayıt tipiC++ misc içinde beklenmeyen dizgebeklenmeyen dizge dosya bilgi deÄŸer uzunluÄŸu %dbeklenmeyen deÄŸiÅŸken dosya bilgi deÄŸer uzunluÄŸu %ddizgenin beklenmeyen sürümübeklenmeyen sürüm dizge uzunluÄŸu %d != %d + %dbeklenmeyen sürüm dizge uzunluÄŸu %d < %dbeklenmeyen sürüm dizge tablo deÄŸer uzunluÄŸu %dbeklenmeyen sürüm tipi %dbeklenmeyen sürüm deÄŸer uzunluÄŸu %dbilinmeyen ATN tipibilinmeyen BB tipiBilinmeyen C++ ÅŸifreli ismibilinmeyen C++ görünürlüğübilinmeyen TY kodubilinmeyen alternatif makina kodu, yoksayıldıbilinmeyen oluÅŸumiçi tipbilinmeyen düzeltme tarzı '%s'bilinmeyen biçem tipi `%s'bilinmeyen bölümtemel sınıf için bilinmeyen sanal karaktertemel sınıf için bilinmeyen görünebilirlik karakterialan için bilinmeyen görünürlük karakteriisimlenmemiÅŸ $vb tipitanınmayan --endian tipi `%s'tanınmayan -E seçeneÄŸitanınmayan C++ kısaltmasıbilinmeyen öntanımlı C++ tipibilinmeyen C++ misc kaydıbilinmeyen C++ nesne masraf tanımıbilinmeyen C++ nesne tanımıbilinmeyen C++ referans tipitanınmayan çapraz baÅŸvuru tipibilinmeyen bölüm seçeneÄŸi `%s'bilinmeyen: %-7lx%s'e göreli PC yer deÄŸiÅŸtirme çözümlenemedidesteklenmeyen ATN11desteklenmeyen ATN12desteklenmeyen C++ nesne tipidesteklenmeyen IEEE ifade iÅŸlemimidesteklenmeyen menü sürümü %ddesteklenmeyen niteleyicigeri alma bilgisigeri alma tablosusürüm verisisürüm tanımıSürüm yardımcı tanımısürüm tanımı bölümüsürüm uzunluÄŸu %d, kaynak uzunluÄŸu %lu ile eÅŸleÅŸmiyorSürüm GereksinimSürüm Gereksinim Yardımcı (2)Sürüm Gereksinim Yardımcı (3)Sürüm Gereksinim BölümSürüm Dizge TabloSürüm Sembol Verisürüm deÄŸiÅŸken bilgisideÄŸiÅŸken dosya bilgi sürümüvmabekle: %swarning: CHECK altyordamı %s tanımsızuyarı: EXIT altyordamı %s tanımsızuyarı: MAP ve FULLMAP desteklenmiyor; ld -M komutunu deneyinuyarı: Sürüm numarası verilmemiÅŸuyarı: START altyordamı %s tanımsızuyarı: girdi ve çıktı biçemleri uyumlu deÄŸiluyarı: %s sembolü ithal edildi ama ithal listesinde deÄŸilkoçan yazılıyor \ No newline at end of file diff -Nurpa binutils-2.13/binutils/po/tr.po binutils-2.13.1/binutils/po/tr.po --- binutils-2.13/binutils/po/tr.po 2002-02-05 05:25:59.000000000 -0500 +++ binutils-2.13.1/binutils/po/tr.po 2002-09-23 18:13:12.000000000 -0400 @@ -4,297 +4,346 @@ # msgid "" msgstr "" -"Project-Id-Version: binutils 2.12-pre020121\n" -"POT-Creation-Date: 2002-01-17 13:58+0000\n" -"PO-Revision-Date: 2002-02-04 21:49EET\n" +"Project-Id-Version: binutils 2.12.91\n" +"POT-Creation-Date: 2002-07-23 15:55-0400\n" +"PO-Revision-Date: 2002-08-10 21:49EET\n" "Last-Translator: Deniz Akkus Kanca \n" "Language-Team: Turkish \n" "MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=ISO-8859-9\n" +"Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" "X-Generator: KBabel 0.9.5\n" -#: addr2line.c:73 +#: addr2line.c:74 #, c-format +msgid "Usage: %s [option(s)] [addr(s)]\n" +msgstr "Kullanım: %s [seçenekler] [adresler]\n" + +#: addr2line.c:75 +msgid " Convert addresses into line number/file name pairs.\n" +msgstr " adresleri satır numarası/dosya adı çiftlerine çevirir.\n" + +#: addr2line.c:76 +msgid " If no addresses are specified on the command line, they will be read from stdin\n" +msgstr " EÄŸer komut satırında adres belirtilmezse, standart girdiden okunur\n" + +#: addr2line.c:77 msgid "" -"Usage: %s [-CfsHV] [-b bfdname] [--target=bfdname]\n" -" [-e executable] [--exe=executable] [--demangle[=style]]\n" -" [--basenames] [--functions] [addr addr ...]\n" -msgstr "" -"Kullaným: %s [-CfsHV] [-b bfd_adý] \n" -" [--target=bfd_adý] hedef\n" -" [-e uygulama] [--exe=uygulama] \n" -" [--demangle[=tarz]] düzeltme tarzý\n" -" [--basenames] temel isimler\n" -" [--functions] [adres adres ...] iþlevler\n" +" The options are:\n" +" -b --target= Set the binary file format\n" +" -e --exe= Set the input file name (default is a.out)\n" +" -s --basenames Strip directory names\n" +" -f --functions Show function names\n" +" -C --demangle[=style] Demangle function names\n" +" -h --help Display this information\n" +" -v --version Display the program's version\n" +"\n" +msgstr "" +" Seçenekler:\n" +" -b --target= Ä°kilik dosya biçemini belirtir\n" +" -e --exe=<çalıştırılabilir dosya> Girdi adını belirtir (öntanımlı: a.out)\n" +" -s --basenames Dizin adlarını soyar\n" +" -f --functions Ä°ÅŸlev adlarını gösterir\n" +" -C --demangle[=tarz] Ä°ÅŸlev adlarını düzeltir\n" +" -h --help Bu bilgiyi gösterir\n" +" -v --version Program sürüm no'sunu gösterir\n" +"\n" -#: addr2line.c:80 ar.c:289 nlmconv.c:1121 objcopy.c:423 objcopy.c:455 -#: readelf.c:2181 size.c:91 strings.c:655 windres.c:737 +#: addr2line.c:89 ar.c:297 coffdump.c:479 nlmconv.c:1119 objcopy.c:424 +#: objcopy.c:457 readelf.c:2310 size.c:104 srconv.c:1962 strings.c:666 +#: sysdump.c:774 windres.c:733 #, c-format msgid "Report bugs to %s\n" -msgstr "Yazýlým hatalarýný %s adresine, çeviri hatalarýný adresine gönderin\n" +msgstr "Yazılım hatalarını %s adresine, çeviri hatalarını adresine gönderin\n" -#: addr2line.c:240 +#: addr2line.c:248 #, c-format msgid "%s: can not get addresses from archive" -msgstr "%s: arþivden adresler alýnamadý" +msgstr "%s: arÅŸivden adresler alınamadı" -#: addr2line.c:312 nm.c:447 objdump.c:2800 +#: addr2line.c:320 nm.c:395 objdump.c:2782 #, c-format msgid "unknown demangling style `%s'" -msgstr "bilinmeyen düzeltme tarzý '%s'" +msgstr "bilinmeyen düzeltme tarzı '%s'" -#: ar.c:237 +#: ar.c:238 #, c-format msgid "no entry %s in archive\n" -msgstr "arþivde %s girdisi yok\n" +msgstr "arÅŸivde %s girdisi yok\n" -#: ar.c:254 +#: ar.c:255 #, c-format -msgid "Usage: %s [-X32_64] [-]{dmpqrstx}[abcfilNoPsSuvV] [member-name] [count] archive-file file...\n" -msgstr "Kullaným: %s [-X32_64] [-]{dmpqrstx}[abcfilNoPsSuvV] [üye-adý] [sayý] arþiv-dosyasý dosya...\n" +msgid "Usage: %s [emulation options] [-]{dmpqrstx}[abcfilNoPsSuvV] [member-name] [count] archive-file file...\n" +msgstr "Kullanım: %s [öykünüm seçenekleri] [-]{dmpqrstx}[abcfilNoPsSuvV] [üye-adı] [sayı] arÅŸiv-dosyası dosya...\n" -#: ar.c:257 +#: ar.c:258 #, c-format msgid " %s -M [\n\n" -msgstr "\n<üye %s>\n\n" +msgid "" +"\n" +"\n" +"\n" +msgstr "" +"\n" +"<üye %s>\n" +"\n" -#: ar.c:850 ar.c:918 +#: ar.c:857 ar.c:925 #, c-format msgid "%s is not a valid archive" -msgstr "%s geçerli bir arþiv deðil" +msgstr "%s geçerli bir arÅŸiv deÄŸil" -#: ar.c:886 +#: ar.c:893 #, c-format msgid "stat returns negative size for %s" -msgstr "stat komutu, %s için negatif büyüklük gösteriyor" +msgstr "stat komutu, %s için negatif büyüklük gösteriyor" -#: ar.c:1013 +#: ar.c:1020 #, c-format msgid "%s is not an archive" -msgstr "%s bir arþiv deðil" +msgstr "%s bir arÅŸiv deÄŸil" -#: ar.c:1020 +#: ar.c:1027 #, c-format msgid "creating %s" -msgstr "%s oluþturuluyor" +msgstr "%s oluÅŸturuluyor" -#: ar.c:1226 +#: ar.c:1233 #, c-format msgid "No member named `%s'\n" -msgstr "`%s' adýnda bir üye yok\n" +msgstr "`%s' adında bir üye yok\n" -#: ar.c:1278 +#: ar.c:1285 #, c-format msgid "no entry %s in archive %s!" -msgstr "arþiv %2$s içerisinde %1$s girdisi yok!" +msgstr "arÅŸiv %2$s içerisinde %1$s girdisi yok!" -#: ar.c:1439 +#: ar.c:1422 #, c-format msgid "%s: no archive map to update" -msgstr "%s: güncellenecek arþiv eþlemesi yok" +msgstr "%s: güncellenecek arÅŸiv eÅŸlemesi yok" -#: arsup.c:88 +#: arsup.c:86 #, c-format msgid "No entry %s in archive.\n" -msgstr "Arþiv içinde %s girdisi yok.\n" +msgstr "ArÅŸiv içinde %s girdisi yok.\n" -#: arsup.c:120 +#: arsup.c:117 #, c-format msgid "Can't open file %s\n" -msgstr "%s dosyasý açýlamadý\n" +msgstr "%s dosyası açılamadı\n" -#: arsup.c:171 +#: arsup.c:172 #, c-format msgid "%s: Can't open output archive %s\n" -msgstr "%s: Çýktý arþivi %s açýlamadý\n" +msgstr "%s: Çıktı arÅŸivi %s açılamadı\n" -#: arsup.c:183 +#: arsup.c:189 #, c-format msgid "%s: Can't open input archive %s\n" -msgstr "%s: Girdi arþivi %s açýlamadý\n" +msgstr "%s: Girdi arÅŸivi %s açılamadı\n" -#: arsup.c:189 +#: arsup.c:198 #, c-format msgid "%s: file %s is not an archive\n" -msgstr "%s: %s dosyasý bir arþiv deðil\n" +msgstr "%s: %s dosyası bir arÅŸiv deÄŸil\n" -#: arsup.c:230 +#: arsup.c:241 #, c-format msgid "%s: no output archive specified yet\n" -msgstr "%s: henüz bir çýktý arþivi belirtilmedi\n" +msgstr "%s: henüz bir çıktı arÅŸivi belirtilmedi\n" -#: arsup.c:250 arsup.c:285 arsup.c:321 arsup.c:341 arsup.c:399 +#: arsup.c:262 arsup.c:301 arsup.c:343 arsup.c:364 arsup.c:430 #, c-format msgid "%s: no open output archive\n" -msgstr "%s: açýk çýktý arþivi yok\n" +msgstr "%s: açık çıktı arÅŸivi yok\n" -#: arsup.c:258 arsup.c:359 arsup.c:379 +#: arsup.c:273 arsup.c:385 arsup.c:411 #, c-format msgid "%s: can't open file %s\n" -msgstr "%s: %s dosyasý açýlamadý\n" +msgstr "%s: %s dosyası açılamadı\n" -#: arsup.c:306 arsup.c:375 arsup.c:454 +#: arsup.c:328 arsup.c:407 arsup.c:489 #, c-format msgid "%s: can't find module file %s\n" -msgstr "%s: modül dosyasý %s bulunamadý\n" +msgstr "%s: modül dosyası %s bulunamadı\n" -#: arsup.c:406 +#: arsup.c:439 #, c-format msgid "Current open archive is %s\n" -msgstr "Þimdiki açýk arþiv %s\n" +msgstr "Åžimdiki açık arÅŸiv %s\n" + +#: arsup.c:464 +#, c-format +msgid "%s: no open archive\n" +msgstr "%s: açık arÅŸiv yok\n" + +#: binemul.c:39 +#, c-format +msgid " No emulation specific options\n" +msgstr " Öykünüme özgü seçenekler yok\n" -#: arsup.c:433 +#. Macros for common output. +#: binemul.h:42 #, c-format -msgid "%s: no open archive\n" -msgstr "%s: açýk arþiv yok\n" +msgid " emulation options: \n" +msgstr " öykünüm seçenekleri: \n" #: bucomm.c:106 #, c-format msgid "can't set BFD default target to `%s': %s" -msgstr "BFD öntanýmlý hedef `%s' olarak atanamadý: %s" +msgstr "BFD öntanımlı hedef `%s' olarak atanamadı: %s" #: bucomm.c:118 #, c-format msgid "%s: Matching formats:" -msgstr "%s: Eþleþen biçemler:" +msgstr "%s: EÅŸleÅŸen biçemler:" #: bucomm.c:135 msgid "Supported targets:" @@ -317,686 +366,719 @@ msgstr "%s: desteklenen platformlar:" #: bucomm.c:262 #, c-format msgid "%s: bad number: %s" -msgstr "%s: hatalý sayý: %s" +msgstr "%s: hatalı sayı: %s" -#: coffdump.c:106 +#: coffdump.c:107 #, c-format msgid "#lines %d " -msgstr "#satýrlar %d " +msgstr "#satırlar %d " -#: coffdump.c:468 sysdump.c:740 +#: coffdump.c:471 sysdump.c:767 #, c-format -msgid "%s: Print a human readable interpretation of a SYSROFF object file\n" -msgstr "%s: SYSROFF nesne dosyasýný insan tarafýndan okunabilir biçemde yazdýrýr\n" +msgid "Usage: %s [option(s)] in-file\n" +msgstr "Kullanım: %s girdi-dosya(ları)\n" + +#: coffdump.c:472 +msgid " Print a human readable interpretation of a SYSROFF object file\n" +msgstr " SYSROFF nesne dosyasını insan tarafından okunabilir biçemde yazdırır\n" -#: coffdump.c:531 srconv.c:2029 sysdump.c:799 +#: coffdump.c:473 +msgid "" +" The options are:\n" +" -h --help Display this information\n" +" -v --version Display the program's version\n" +"\n" +msgstr "" +" Seçenekler:\n" +" -h --help Bu bilgiyi gösterir\n" +" -v --version Program sürüm no'sunu gösterir\n" +"\n" + +#: coffdump.c:541 srconv.c:2052 sysdump.c:831 msgid "no input file specified" -msgstr "girdi dosyasý belirtilmedi" +msgstr "girdi dosyası belirtilmedi" #: debug.c:653 msgid "debug_add_to_current_namespace: no current file" -msgstr "hata_ayýkla_mevcut_isim_uzayýna_ekle: mevcut dosya yok" +msgstr "hata_ayıkla_mevcut_isim_uzayına_ekle: mevcut dosya yok" #: debug.c:736 msgid "debug_start_source: no debug_set_filename call" -msgstr "hata_ayýkla_kaynak: hata_ayýkla_dosya_adý_ata çaðrýlmadý" +msgstr "hata_ayıkla_kaynak: hata_ayıkla_dosya_adı_ata çaÄŸrılmadı" #: debug.c:795 msgid "debug_record_function: no debug_set_filename call" -msgstr "hata_ayýkla_kayýt_iþlevi: hata_ayýkla_dosya_adý_ata çaðrýlmadý" +msgstr "hata_ayıkla_kayıt_iÅŸlevi: hata_ayıkla_dosya_adı_ata çaÄŸrılmadı" #: debug.c:851 msgid "debug_record_parameter: no current function" -msgstr "hata_ayýkla_kayýt_parametresi: mevcut iþlev yok" +msgstr "hata_ayıkla_kayıt_parametresi: mevcut iÅŸlev yok" #: debug.c:885 msgid "debug_end_function: no current function" -msgstr "hata_ayýkla_son_iþlev: mevcut iþlev yok" +msgstr "hata_ayıkla_son_iÅŸlev: mevcut iÅŸlev yok" #: debug.c:891 msgid "debug_end_function: some blocks were not closed" -msgstr "hata_ayýkla_son_iþlev: bazý bloklar kapatýlmamýþ" +msgstr "hata_ayıkla_son_iÅŸlev: bazı bloklar kapatılmamış" #: debug.c:921 msgid "debug_start_block: no current block" -msgstr "hata_ayýkla_baþla_blok: mevcut blok yok" +msgstr "hata_ayıkla_baÅŸla_blok: mevcut blok yok" #: debug.c:959 msgid "debug_end_block: no current block" -msgstr "hata_ayýkla_son_blok: mevcut blok yok" +msgstr "hata_ayıkla_son_blok: mevcut blok yok" #: debug.c:966 msgid "debug_end_block: attempt to close top level block" -msgstr "hata_ayýkla_son_blok: tepe seviye bloðu kapama denemesi" +msgstr "hata_ayıkla_son_blok: tepe seviye bloÄŸu kapama denemesi" #: debug.c:992 msgid "debug_record_line: no current unit" -msgstr "hata_ayýkla_kayýt_satýr: mevcut birim yok" +msgstr "hata_ayıkla_kayıt_satır: mevcut birim yok" #. FIXME #: debug.c:1046 msgid "debug_start_common_block: not implemented" -msgstr "hata_ayýkla_ortak_blok_baþla: henüz tamamlanmamýþ" +msgstr "hata_ayıkla_ortak_blok_baÅŸla: henüz tamamlanmamış" #. FIXME #: debug.c:1058 msgid "debug_end_common_block: not implemented" -msgstr "hata_ayýkla_ortak_blok_son: henüz tamamlanmamýþ" +msgstr "hata_ayıkla_ortak_blok_son: henüz tamamlanmamış" #. FIXME. #: debug.c:1152 -msgid "debug_record_label not implemented" -msgstr "hata_ayýkla_kayýt_etiket: henüz tamamlanmamýþ" +msgid "debug_record_label: not implemented" +msgstr "hata_ayıkla_kayıt_etiket: henüz tamamlanmamış" #: debug.c:1178 msgid "debug_record_variable: no current file" -msgstr "hata_ayýkla_kayýt_deðiþken: mevcut dosya yok" +msgstr "hata_ayıkla_kayıt_deÄŸiÅŸken: mevcut dosya yok" #: debug.c:1194 msgid "debug_record_variable: no current block" -msgstr "hata_ayýkla_kayýt_deðiþken: mevcut blok yok" +msgstr "hata_ayıkla_kayıt_deÄŸiÅŸken: mevcut blok yok" -#: debug.c:1764 +#: debug.c:1763 msgid "debug_make_undefined_type: unsupported kind" -msgstr "hata_ayýkla_tanýmlanmamýþ_tip: desteklenmeyen tip" +msgstr "hata_ayıkla_tanımlanmamış_tip: desteklenmeyen tip" -#: debug.c:1970 +#: debug.c:1964 msgid "debug_name_type: no current file" -msgstr "hata_ayýkla_isim_tipi: mevcut dosya yok" +msgstr "hata_ayıkla_isim_tipi: mevcut dosya yok" -#: debug.c:2018 +#: debug.c:2012 msgid "debug_tag_type: no current file" -msgstr "hata_ayýkla_etiket_tipi: mevcut dosya yok" +msgstr "hata_ayıkla_etiket_tipi: mevcut dosya yok" -#: debug.c:2026 +#: debug.c:2020 msgid "debug_tag_type: extra tag attempted" -msgstr "hata_ayýkla_etiket_tipi: fazla etiketleme denendi" +msgstr "hata_ayıkla_etiket_tipi: fazla etiketleme denendi" -#: debug.c:2066 +#: debug.c:2059 #, c-format msgid "Warning: changing type size from %d to %d\n" -msgstr "Uyarý: tip boyutu %d'den %d'ye deðiþtirildi\n" +msgstr "Uyarı: tip boyutu %d'den %d'ye deÄŸiÅŸtirildi\n" -#: debug.c:2090 +#: debug.c:2083 msgid "debug_find_named_type: no current compilation unit" -msgstr "hata_ayýkla_isimli_tipi_bul: mevcut derleme birimi yok" +msgstr "hata_ayıkla_isimli_tipi_bul: mevcut derleme birimi yok" -#: debug.c:2197 +#: debug.c:2190 #, c-format msgid "debug_get_real_type: circular debug information for %s\n" -msgstr "hata_ayýkla_gerçek_tipi_al: %s için çevrimsel hata ayýklama bilgisi\n" +msgstr "hata_ayıkla_gerçek_tipi_al: %s için çevrimsel hata ayıklama bilgisi\n" -#: debug.c:2662 +#: debug.c:2650 msgid "debug_write_type: illegal type encountered" -msgstr "hata_ayýkla_yaz_tipi: geçersiz tip bulundu" +msgstr "hata_ayıkla_yaz_tipi: geçersiz tip bulundu" -#: dlltool.c:743 dlltool.c:768 dlltool.c:794 +#: dlltool.c:735 dlltool.c:760 dlltool.c:786 #, c-format msgid "Internal error: Unknown machine type: %d" -msgstr "Ýç hata: Bilinmeyen makina tipi: %d" +msgstr "İç hata: Bilinmeyen makina tipi: %d" -#: dlltool.c:831 +#: dlltool.c:823 #, c-format msgid "Can't open def file: %s" -msgstr "Taným dosyasý açýlamadý: %s" +msgstr "Tanım dosyası açılamadı: %s" -#: dlltool.c:836 +#: dlltool.c:828 #, c-format msgid "Processing def file: %s" -msgstr "Taným dosyasý iþleniyor: %s" +msgstr "Tanım dosyası iÅŸleniyor: %s" -#: dlltool.c:840 +#: dlltool.c:832 msgid "Processed def file" -msgstr "Taným dosyasý iþlendi" +msgstr "Tanım dosyası iÅŸlendi" -#: dlltool.c:866 +#: dlltool.c:858 #, c-format msgid "Syntax error in def file %s:%d" -msgstr "Taným dosyasý %s'nda sözdizim hatasý:%d" +msgstr "Tanım dosyası %s'nda sözdizim hatası:%d" -#: dlltool.c:905 +#: dlltool.c:897 #, c-format msgid "NAME: %s base: %x" -msgstr "ÝSÝM: %s temel: %x" +msgstr "Ä°SÄ°M: %s temel: %x" -#: dlltool.c:908 dlltool.c:927 +#: dlltool.c:900 dlltool.c:919 msgid "Can't have LIBRARY and NAME" -msgstr "KÝTAPLIK ve ÝSÝM beraber olamaz" +msgstr "KÄ°TAPLIK ve Ä°SÄ°M beraber olamaz" -#: dlltool.c:924 +#: dlltool.c:916 #, c-format msgid "LIBRARY: %s base: %x" -msgstr "KÝTAPLIK: %s temel: %x" +msgstr "KÄ°TAPLIK: %s temel: %x" -#: dlltool.c:1182 resrc.c:271 +#: dlltool.c:1174 resrc.c:271 #, c-format msgid "wait: %s" msgstr "bekle: %s" -#: dlltool.c:1187 dllwrap.c:455 resrc.c:276 +#: dlltool.c:1179 dllwrap.c:430 resrc.c:276 #, c-format msgid "subprocess got fatal signal %d" -msgstr "Ast-iþlem %d ölümcül sinyalini aldý" +msgstr "Ast-iÅŸlem %d ölümcül sinyalini aldı" -#: dlltool.c:1193 dllwrap.c:462 resrc.c:283 +#: dlltool.c:1185 dllwrap.c:437 resrc.c:283 #, c-format msgid "%s exited with status %d" -msgstr "%s %d durumu ile çýktý" +msgstr "%s %d durumu ile çıktı" -#: dlltool.c:1225 +#: dlltool.c:1217 #, c-format msgid "Sucking in info from %s section in %s" -msgstr "%2$s'in %1$s bölümünden bilgi emiliyor" +msgstr "%2$s'in %1$s bölümünden bilgi emiliyor" -#: dlltool.c:1349 +#: dlltool.c:1341 #, c-format msgid "Excluding symbol: %s" -msgstr "Sembol dýþlandý: %s" +msgstr "Sembol dışlandı: %s" -#: dlltool.c:1444 dlltool.c:1455 nm.c:958 nm.c:969 objdump.c:383 objdump.c:400 +#: dlltool.c:1436 dlltool.c:1447 nm.c:959 nm.c:970 objdump.c:386 objdump.c:401 #, c-format msgid "%s: no symbols" msgstr "%s: sembol yok" #. FIXME: we ought to read in and block out the base relocations -#: dlltool.c:1482 +#: dlltool.c:1474 #, c-format msgid "Done reading %s" msgstr "%s okundu" -#: dlltool.c:1493 +#: dlltool.c:1485 #, c-format msgid "Unable to open object file: %s" -msgstr "Nesne dosyasý açýlamadý: %s" +msgstr "Nesne dosyası açılamadı: %s" -#: dlltool.c:1496 +#: dlltool.c:1488 #, c-format msgid "Scanning object file %s" -msgstr "Nesne dosyasý %s taranýyor" +msgstr "Nesne dosyası %s taranıyor" -#: dlltool.c:1511 +#: dlltool.c:1503 #, c-format msgid "Cannot produce mcore-elf dll from archive file: %s" -msgstr "Arþiv dosyasýndan mcore-elf dll oluþturulamadý: %s" +msgstr "ArÅŸiv dosyasından mcore-elf dll oluÅŸturulamadı: %s" -#: dlltool.c:1603 +#: dlltool.c:1595 msgid "Adding exports to output file" -msgstr "Çýktý dosyasýna ihraçlar ekleniyor" +msgstr "Çıktı dosyasına ihraçlar ekleniyor" -#: dlltool.c:1648 +#: dlltool.c:1640 msgid "Added exports to output file" -msgstr "Çýktý dosyasýna ihraçlar eklendi" +msgstr "Çıktı dosyasına ihraçlar eklendi" -#: dlltool.c:1772 +#: dlltool.c:1764 #, c-format msgid "Generating export file: %s" -msgstr "Ýhraç dosyasý oluþturuluyor: %s" +msgstr "Ä°hraç dosyası oluÅŸturuluyor: %s" -#: dlltool.c:1777 +#: dlltool.c:1769 #, c-format msgid "Unable to open temporary assembler file: %s" -msgstr "Geçiçi üretici dosyasý açýlamadý: %s" +msgstr "Geçiçi üretici dosyası açılamadı: %s" -#: dlltool.c:1780 +#: dlltool.c:1772 #, c-format msgid "Opened temporary file: %s" -msgstr "Geçici dosya açýldý: %s" +msgstr "Geçici dosya açıldı: %s" -#: dlltool.c:2004 +#: dlltool.c:1996 msgid "Generated exports file" -msgstr "Ýhraç dosyasý oluþturuldu" +msgstr "Ä°hraç dosyası oluÅŸturuldu" -#: dlltool.c:2266 +#: dlltool.c:2258 #, c-format msgid "bfd_open failed open stub file: %s" -msgstr "koçan dosyasý bfd_open ile açýlamadý: %s" +msgstr "koçan dosyası bfd_open ile açılamadı: %s" -#: dlltool.c:2269 +#: dlltool.c:2261 #, c-format msgid "Creating stub file: %s" -msgstr "Koçan dosyasý oluþturuluyor: %s" +msgstr "Koçan dosyası oluÅŸturuluyor: %s" -#: dlltool.c:2658 +#: dlltool.c:2650 #, c-format msgid "failed to open temporary head file: %s" -msgstr "geçici baþlýk dosyasý açýlamadý: %s" +msgstr "geçici baÅŸlık dosyası açılamadı: %s" -#: dlltool.c:2717 +#: dlltool.c:2709 #, c-format msgid "failed to open temporary tail file: %s" -msgstr "geçici kuyruk dosyasý açýlamadý: %s" +msgstr "geçici kuyruk dosyası açılamadı: %s" -#: dlltool.c:2785 +#: dlltool.c:2777 #, c-format msgid "Can't open .lib file: %s" -msgstr ".lib dosyasý açýlamadý: %s" +msgstr ".lib dosyası açılamadı: %s" -#: dlltool.c:2788 +#: dlltool.c:2780 #, c-format msgid "Creating library file: %s" -msgstr "Kitaplýk dosyasý açýlamadý: %s" +msgstr "Kitaplık dosyası açılamadı: %s" -#: dlltool.c:2847 +#: dlltool.c:2839 #, c-format msgid "cannot delete %s: %s" msgstr "%s silinemedi: %s" -#: dlltool.c:2851 +#: dlltool.c:2843 msgid "Created lib file" -msgstr "Lib dosyasý oluþturuldu" +msgstr "Lib dosyası oluÅŸturuldu" -#: dlltool.c:2956 +#: dlltool.c:2948 #, c-format msgid "Warning, ignoring duplicate EXPORT %s %d,%d" -msgstr "Uyarý, EXPORT tekrarý %s %d,%d yoksayýldý" +msgstr "Uyarı, EXPORT tekrarı %s %d,%d yoksayıldı" -#: dlltool.c:2962 +#: dlltool.c:2954 #, c-format msgid "Error, duplicate EXPORT with oridinals: %s" -msgstr "Hata, orjinal hali ile EXPORT tekrarý: %s" +msgstr "Hata, orjinal hali ile EXPORT tekrarı: %s" -#: dlltool.c:3089 +#: dlltool.c:3081 msgid "Processing definitions" -msgstr "Tanýmlar iþleniyor" +msgstr "Tanımlar iÅŸleniyor" -#: dlltool.c:3127 +#: dlltool.c:3119 msgid "Processed definitions" -msgstr "Tanýmlar iþlendi" +msgstr "Tanımlar iÅŸlendi" #. xgetext:c-format -#: dlltool.c:3138 dllwrap.c:519 +#: dlltool.c:3130 dllwrap.c:495 #, c-format -msgid "Usage %s \n" -msgstr "Kullaným %s \n" +msgid "Usage %s \n" +msgstr "Kullanım %s \n" #. xgetext:c-format -#: dlltool.c:3140 +#: dlltool.c:3132 #, c-format msgid " -m --machine Create as DLL for . [default: %s]\n" -msgstr " -m --machine için DLL olarak oluþtur. [öntanýmlý: %s]\n" +msgstr " -m --machine için DLL olarak oluÅŸtur. [öntanımlı: %s]\n" -#: dlltool.c:3141 +#: dlltool.c:3133 msgid " possible : arm[_interwork], i386, mcore[-elf]{-le|-be}, ppc, thumb\n" -msgstr " tanýmlý : arm[_interwork], i386, mcore[-elf]{-le|-be}, ppc, thumb\n" +msgstr " tanımlı : arm[_interwork], i386, mcore[-elf]{-le|-be}, ppc, thumb\n" -#: dlltool.c:3142 +#: dlltool.c:3134 msgid " -e --output-exp Generate an export file.\n" -msgstr " -e --output-exp <çýktýadý> Ýhraç dosyasý oluþturur.\n" +msgstr " -e --output-exp <çıktıadı> Ä°hraç dosyası oluÅŸturur.\n" -#: dlltool.c:3143 +#: dlltool.c:3135 msgid " -l --output-lib Generate an interface library.\n" -msgstr " -l --output-lib <çýktýadý> Arayüz kitaplýðý oluþturur.\n" +msgstr " -l --output-lib <çıktıadı> Arayüz kitaplığı oluÅŸturur.\n" -#: dlltool.c:3144 +#: dlltool.c:3136 msgid " -a --add-indirect Add dll indirects to export file.\n" -msgstr " -a --add-indirect Ýhraç dosyasýna dll yönlendirmelerini ekler.\n" +msgstr " -a --add-indirect Ä°hraç dosyasına dll yönlendirmelerini ekler.\n" -#: dlltool.c:3145 +#: dlltool.c:3137 msgid " -D --dllname Name of input dll to put into interface lib.\n" -msgstr " -D --dllname Arayüz kitaplýðýna eklenecek girdi dll adý.\n" +msgstr " -D --dllname Arayüz kitaplığına eklenecek girdi dll adı.\n" -#: dlltool.c:3146 +#: dlltool.c:3138 msgid " -d --input-def Name of .def file to be read in.\n" -msgstr " -d --input-def Okunacak .def dosyasýnýn adý.\n" +msgstr " -d --input-def Okunacak .def dosyasının adı.\n" -#: dlltool.c:3147 +#: dlltool.c:3139 msgid " -z --output-def Name of .def file to be created.\n" -msgstr " -z --output-def Oluþturulacak .def dosyasýnýn adý.\n" +msgstr " -z --output-def OluÅŸturulacak .def dosyasının adı.\n" -#: dlltool.c:3148 +#: dlltool.c:3140 msgid " --export-all-symbols Export all symbols to .def\n" -msgstr " --export-all-symbols Bütün sembolleri .def'e ihraç eder\n" +msgstr " --export-all-symbols Bütün sembolleri .def'e ihraç eder\n" -#: dlltool.c:3149 +#: dlltool.c:3141 msgid " --no-export-all-symbols Only export listed symbols\n" -msgstr " --no-export-all-symbols Yalnýzca listelenmiþ sembolleri ihraç eder\n" +msgstr " --no-export-all-symbols Yalnızca listelenmiÅŸ sembolleri ihraç eder\n" -#: dlltool.c:3150 +#: dlltool.c:3142 msgid " --exclude-symbols Don't export \n" -msgstr " --exclude-symbols 'yi ihraç etmez\n" +msgstr " --exclude-symbols 'yi ihraç etmez\n" -#: dlltool.c:3151 +#: dlltool.c:3143 msgid " --no-default-excludes Clear default exclude symbols\n" -msgstr " --no-default-excludes Öntanýmlý ihraç edilmeyecek sembol listesini boþaltýr\n" +msgstr " --no-default-excludes Öntanımlı ihraç edilmeyecek sembol listesini boÅŸaltır\n" -#: dlltool.c:3152 +#: dlltool.c:3144 msgid " -b --base-file Read linker generated base file.\n" -msgstr " -b --base-file Baðlayýcýnýn oluþturduðu temel dosyayý okur.\n" +msgstr " -b --base-file BaÄŸlayıcının oluÅŸturduÄŸu temel dosyayı okur.\n" -#: dlltool.c:3153 +#: dlltool.c:3145 msgid " -x --no-idata4 Don't generate idata$4 section.\n" -msgstr " -x --no-idata4 idata$4 bölümü oluþturmaz.\n" +msgstr " -x --no-idata4 idata$4 bölümü oluÅŸturmaz.\n" -#: dlltool.c:3154 +#: dlltool.c:3146 msgid " -c --no-idata5 Don't generate idata$5 section.\n" -msgstr " -c --no-idata5 idata$5 bölümü oluþturmaz.\n" +msgstr " -c --no-idata5 idata$5 bölümü oluÅŸturmaz.\n" -#: dlltool.c:3155 +#: dlltool.c:3147 msgid " -U --add-underscore Add underscores to symbols in interface library.\n" -msgstr " -U --add-underscore Arayüz kitaplýðýndaki sembollere alt-tire ekler.\n" +msgstr " -U --add-underscore Arayüz kitaplığındaki sembollere alt-tire ekler.\n" -#: dlltool.c:3156 +#: dlltool.c:3148 msgid " -k --kill-at Kill @ from exported names.\n" -msgstr " -k --kill-at Ýhraç edilmiþ isimlerden @'da öldürür.\n" +msgstr " -k --kill-at Ä°hraç edilmiÅŸ isimlerden @'da öldürür.\n" -#: dlltool.c:3157 +#: dlltool.c:3149 msgid " -A --add-stdcall-alias Add aliases without @.\n" -msgstr " -A --add-stdcall-alias Rumuzlarý @ içermeksizin ekler.\n" +msgstr " -A --add-stdcall-alias Rumuzları @ içermeksizin ekler.\n" -#: dlltool.c:3158 +#: dlltool.c:3150 msgid " -S --as Use for assembler.\n" -msgstr " -S --as Üretici olarak kullanýr.\n" +msgstr " -S --as Ãœretici olarak kullanır.\n" -#: dlltool.c:3159 +#: dlltool.c:3151 msgid " -f --as-flags Pass to the assembler.\n" -msgstr " -f --as-flags Üreticiye i geçirir.\n" +msgstr " -f --as-flags Ãœreticiye i geçirir.\n" -#: dlltool.c:3160 +#: dlltool.c:3152 msgid " -C --compat-implib Create backward compatible import library.\n" -msgstr " -C --compat-implib Geçmiþe uyumlu ithal kitaplýðý oluþturur.\n" +msgstr " -C --compat-implib GeçmiÅŸe uyumlu ithal kitaplığı oluÅŸturur.\n" -#: dlltool.c:3161 +#: dlltool.c:3153 msgid " -n --no-delete Keep temp files (repeat for extra preservation).\n" -msgstr " -n --no-delete Geçici dosyalarý tutar (daha da koruyucu olmasý için tekrarlanabilir).\n" +msgstr " -n --no-delete Geçici dosyaları tutar (daha da koruyucu olması için tekrarlanabilir).\n" -#: dlltool.c:3162 +#: dlltool.c:3154 msgid " -v --verbose Be verbose.\n" -msgstr " -v --verbose Açýklama verir.\n" +msgstr " -v --verbose Açıklama verir.\n" -#: dlltool.c:3163 +#: dlltool.c:3155 msgid " -V --version Display the program version.\n" -msgstr " -V --version Sürüm bilgilerini gösterir.\n" +msgstr " -V --version Sürüm bilgilerini gösterir.\n" -#: dlltool.c:3164 +#: dlltool.c:3156 msgid " -h --help Display this information.\n" -msgstr " -h --help Bu yardýmý gösterir.\n" +msgstr " -h --help Bu yardımı gösterir.\n" -#: dlltool.c:3166 +#: dlltool.c:3158 msgid " -M --mcore-elf Process mcore-elf object files into .\n" -msgstr " -M --mcore-elf <çýktý_adý> mcore-elf nesne dosyalarýný <çýktý_adý>'na iþler.\n" +msgstr " -M --mcore-elf <çıktı_adı> mcore-elf nesne dosyalarını <çıktı_adı>'na iÅŸler.\n" -#: dlltool.c:3167 +#: dlltool.c:3159 msgid " -L --linker Use as the linker.\n" -msgstr " -L --linker Baðlayýcý olarak kullanýr.\n" +msgstr " -L --linker BaÄŸlayıcı olarak kullanır.\n" -#: dlltool.c:3168 +#: dlltool.c:3160 msgid " -F --linker-flags Pass to the linker.\n" -msgstr " -F --linker-flags i baðlayýcýya geçirir.\n" +msgstr " -F --linker-flags i baÄŸlayıcıya geçirir.\n" -#: dlltool.c:3315 +#: dlltool.c:3310 #, c-format msgid "Unable to open base-file: %s" -msgstr "Temel-dosyasý açýlamadý: %s" +msgstr "Temel-dosyası açılamadı: %s" -#: dlltool.c:3344 +#: dlltool.c:3339 #, c-format msgid "Machine '%s' not supported" -msgstr "'%s' makinasý desteklenmiyor" +msgstr "'%s' makinası desteklenmiyor" -#: dlltool.c:3447 dllwrap.c:240 +#: dlltool.c:3442 dllwrap.c:214 #, c-format msgid "Tried file: %s" msgstr "Dosya denendi: %s" -#: dlltool.c:3454 dllwrap.c:247 +#: dlltool.c:3449 dllwrap.c:221 #, c-format msgid "Using file: %s" -msgstr "Dosya kullanýlýyor: %s" +msgstr "Dosya kullanılıyor: %s" -#: dllwrap.c:334 +#: dllwrap.c:308 #, c-format msgid "Keeping temporary base file %s" -msgstr "Geçici temel dosya %s tutuldu" +msgstr "Geçici temel dosya %s tutuldu" -#: dllwrap.c:336 +#: dllwrap.c:310 #, c-format msgid "Deleting temporary base file %s" -msgstr "Geçici temel dosya %s silindi" +msgstr "Geçici temel dosya %s silindi" -#: dllwrap.c:350 +#: dllwrap.c:324 #, c-format msgid "Keeping temporary exp file %s" -msgstr "Geçici ihraç dosyasý %s tutuldu" +msgstr "Geçici ihraç dosyası %s tutuldu" -#: dllwrap.c:352 +#: dllwrap.c:326 #, c-format msgid "Deleting temporary exp file %s" -msgstr "Geçici ihraç dosyasý %s silindi" +msgstr "Geçici ihraç dosyası %s silindi" -#: dllwrap.c:365 +#: dllwrap.c:339 #, c-format msgid "Keeping temporary def file %s" -msgstr "Geçici taným dosyasý %s tutuldu" +msgstr "Geçici tanım dosyası %s tutuldu" -#: dllwrap.c:367 +#: dllwrap.c:341 #, c-format msgid "Deleting temporary def file %s" -msgstr "Geçici taným dosyasý %s silindi" +msgstr "Geçici tanım dosyası %s silindi" -#: dllwrap.c:520 +#: dllwrap.c:496 msgid " Generic options:\n" -msgstr " Genel seçenekler: \n" +msgstr " Genel seçenekler: \n" -#: dllwrap.c:521 +#: dllwrap.c:497 msgid " --quiet, -q Work quietly\n" -msgstr " --quiet, -q Sessiz çalýþýr\n" +msgstr " --quiet, -q Sessiz çalışır\n" -#: dllwrap.c:522 +#: dllwrap.c:498 msgid " --verbose, -v Verbose\n" -msgstr " --verbose, -v Açýklamalý\n" +msgstr " --verbose, -v Açıklamalı\n" -#: dllwrap.c:523 +#: dllwrap.c:499 msgid " --version Print dllwrap version\n" -msgstr " --version dllwrap sürümünü yazdýrýr\n" +msgstr " --version dllwrap sürümünü yazdırır\n" -#: dllwrap.c:524 +#: dllwrap.c:500 msgid " --implib Synonym for --output-lib\n" -msgstr " --implib <çýktý_adý> --output-lib ile eþanlamlý\n" +msgstr " --implib <çıktı_adı> --output-lib ile eÅŸanlamlı\n" -#: dllwrap.c:525 +#: dllwrap.c:501 #, c-format msgid " Options for %s:\n" -msgstr " %s için seçenekler:\n" +msgstr " %s için seçenekler:\n" -#: dllwrap.c:526 +#: dllwrap.c:502 msgid " --driver-name Defaults to \"gcc\"\n" -msgstr " --driver-name \"gcc\"ye öntanýmlý\n" +msgstr " --driver-name \"gcc\"ye öntanımlı\n" -#: dllwrap.c:527 +#: dllwrap.c:503 msgid " --driver-flags Override default ld flags\n" -msgstr " --driver-flags Öntanýmlý ld seçeneklerinin yerine geçer\n" +msgstr " --driver-flags Öntanımlı ld seçeneklerinin yerine geçer\n" -#: dllwrap.c:528 +#: dllwrap.c:504 msgid " --dlltool-name Defaults to \"dlltool\"\n" -msgstr " --dlltool-name \"dlltool\"a öntanýmlý\n" +msgstr " --dlltool-name \"dlltool\"a öntanımlı\n" -#: dllwrap.c:529 +#: dllwrap.c:505 msgid " --entry Specify alternate DLL entry point\n" -msgstr " --entry Alternatif DLL giriþ noktasý belirtir\n" +msgstr " --entry Alternatif DLL giriÅŸ noktası belirtir\n" -#: dllwrap.c:530 +#: dllwrap.c:506 msgid " --image-base Specify image base address\n" -msgstr " --image-base Ýmaj temel adresini belirtir\n" +msgstr " --image-base Ä°maj temel adresini belirtir\n" -#: dllwrap.c:531 +#: dllwrap.c:507 msgid " --target i386-cygwin32 or i386-mingw32\n" msgstr " --target hedef makina, i386-cygwin32 veya i386-mingw32\n" -#: dllwrap.c:532 +#: dllwrap.c:508 msgid " --dry-run Show what needs to be run\n" -msgstr " --dry-run Çalýþtýrýlmasý gerekenleri gösterir\n" +msgstr " --dry-run Çalıştırılması gerekenleri gösterir\n" -#: dllwrap.c:533 +#: dllwrap.c:509 msgid " --mno-cygwin Create Mingw DLL\n" -msgstr " --mno-cygwin Mingw DLL oluþturur\n" +msgstr " --mno-cygwin Mingw DLL oluÅŸturur\n" -#: dllwrap.c:534 +#: dllwrap.c:510 msgid " Options passed to DLLTOOL:\n" -msgstr " DLLTOOL'a geçirilen seçenekler:\n" +msgstr " DLLTOOL'a geçirilen seçenekler:\n" -#: dllwrap.c:535 +#: dllwrap.c:511 msgid " --machine \n" msgstr " --machine \n" -#: dllwrap.c:536 +#: dllwrap.c:512 msgid " --output-exp Generate export file.\n" -msgstr " --output-exp <çýktý_adý> Ýhraç dosyasý oluþturur.\n" +msgstr " --output-exp <çıktı_adı> Ä°hraç dosyası oluÅŸturur.\n" -#: dllwrap.c:537 +#: dllwrap.c:513 msgid " --output-lib Generate input library.\n" -msgstr " --output-lib <çýktý_adý> Girdi kitaplýðý oluþturur.\n" +msgstr " --output-lib <çıktı_adı> Girdi kitaplığı oluÅŸturur.\n" -#: dllwrap.c:538 +#: dllwrap.c:514 msgid " --add-indirect Add dll indirects to export file.\n" -msgstr " --add-indirect Dll yönlendirmelerini ihraç dosyasýna ekler.\n" +msgstr " --add-indirect Dll yönlendirmelerini ihraç dosyasına ekler.\n" -#: dllwrap.c:539 +#: dllwrap.c:515 msgid " --dllname Name of input dll to put into output lib.\n" -msgstr " --dllname Çýktý kitaplýðýna konulacak girdi dll adý.\n" +msgstr " --dllname Çıktı kitaplığına konulacak girdi dll adı.\n" -#: dllwrap.c:540 +#: dllwrap.c:516 msgid " --def Name input .def file\n" -msgstr " --def Girdi .def dosyasý adý\n" +msgstr " --def Girdi .def dosyası adı\n" -#: dllwrap.c:541 +#: dllwrap.c:517 msgid " --output-def Name output .def file\n" -msgstr " --output-def Çýktý .def dosyasýnýn adý\n" +msgstr " --output-def Çıktı .def dosyasının adı\n" -#: dllwrap.c:542 +#: dllwrap.c:518 msgid " --export-all-symbols Export all symbols to .def\n" -msgstr " --export-all-symbols Bütün sembolleri .def'e ihraç eder\n" +msgstr " --export-all-symbols Bütün sembolleri .def'e ihraç eder\n" -#: dllwrap.c:543 +#: dllwrap.c:519 msgid " --no-export-all-symbols Only export .drectve symbols\n" -msgstr " --no-export-all-symbols Yalnýzca .drectve sembollerini ihraç eder\n" +msgstr " --no-export-all-symbols Yalnızca .drectve sembollerini ihraç eder\n" -#: dllwrap.c:544 +#: dllwrap.c:520 msgid " --exclude-symbols Exclude from .def\n" -msgstr " --exclude-symbols deki sembolleri .def'e ihraç etmez\n" +msgstr " --exclude-symbols deki sembolleri .def'e ihraç etmez\n" -#: dllwrap.c:545 +#: dllwrap.c:521 msgid " --no-default-excludes Zap default exclude symbols\n" -msgstr " --no-default-excludes Dýþlanacak sembol öntanýmlarýný boþaltýr\n" +msgstr " --no-default-excludes Dışlanacak sembol öntanımlarını boÅŸaltır\n" -#: dllwrap.c:546 +#: dllwrap.c:522 msgid " --base-file Read linker generated base file\n" -msgstr " --base-file Baðlayýcý tarafýndan oluþturulan temel dosyayý okur\n" +msgstr " --base-file BaÄŸlayıcı tarafından oluÅŸturulan temel dosyayı okur\n" -#: dllwrap.c:547 +#: dllwrap.c:523 msgid " --no-idata4 Don't generate idata$4 section\n" -msgstr " --no-idata4 idata$4 bölümünü oluþturmaz\n" +msgstr " --no-idata4 idata$4 bölümünü oluÅŸturmaz\n" -#: dllwrap.c:548 +#: dllwrap.c:524 msgid " --no-idata5 Don't generate idata$5 section\n" -msgstr " --no-idata5 idata$5 bölümünü oluþturmaz\n" +msgstr " --no-idata5 idata$5 bölümünü oluÅŸturmaz\n" -#: dllwrap.c:549 +#: dllwrap.c:525 msgid " -U Add underscores to .lib\n" msgstr " -U .lib'e alt-tire ekler\n" -#: dllwrap.c:550 +#: dllwrap.c:526 msgid " -k Kill @ from exported names\n" -msgstr " -k @'i ihraç edilmiþ isimlerden çýkartýr\n" +msgstr " -k @'i ihraç edilmiÅŸ isimlerden çıkartır\n" -#: dllwrap.c:551 +#: dllwrap.c:527 msgid " --add-stdcall-alias Add aliases without @\n" -msgstr " --add-stdcall-alias Rumuzlarý @ olmaksýzýn ekler\n" +msgstr " --add-stdcall-alias Rumuzları @ olmaksızın ekler\n" -#: dllwrap.c:552 +#: dllwrap.c:528 msgid " --as Use for assembler\n" -msgstr " --as Üretici olarak 'i kullanýr\n" +msgstr " --as Ãœretici olarak 'i kullanır\n" -#: dllwrap.c:553 +#: dllwrap.c:529 msgid " --nodelete Keep temp files.\n" -msgstr " --nodelete Geçici dosyalarý tutar.\n" +msgstr " --nodelete Geçici dosyaları tutar.\n" -#: dllwrap.c:554 +#: dllwrap.c:530 msgid " Rest are passed unmodified to the language driver\n" -msgstr " Kalanlar dil sürücüsüne deðiþtirilmeksizin geçirilir\n" +msgstr " Kalanlar dil sürücüsüne deÄŸiÅŸtirilmeksizin geçirilir\n" -#: dllwrap.c:824 +#: dllwrap.c:802 msgid "Must provide at least one of -o or --dllname options" -msgstr "-o veya --dllname (dll adý) seçeneklerinin en azýndan bir tanesi belirtilmelidir" +msgstr "-o veya --dllname (dll adı) seçeneklerinin en azından bir tanesi belirtilmelidir" -#: dllwrap.c:852 +#: dllwrap.c:830 msgid "" "no export definition file provided.\n" "Creating one, but that may not be what you want" msgstr "" -"ihraç taným dosyasý verilmemiþ.\n" -"Bir tane oluþturuluyor fakat istediðiniz bu olmayabilir" +"ihraç tanım dosyası verilmemiÅŸ.\n" +"Bir tane oluÅŸturuluyor fakat istediÄŸiniz bu olmayabilir" -#: dllwrap.c:1014 +#: dllwrap.c:992 #, c-format msgid "DLLTOOL name : %s\n" -msgstr "DLLTOOL adý : %s\n" +msgstr "DLLTOOL adı : %s\n" -#: dllwrap.c:1015 +#: dllwrap.c:993 #, c-format msgid "DLLTOOL options : %s\n" -msgstr "DLLTOOL seçenekleri : %s\n" +msgstr "DLLTOOL seçenekleri : %s\n" -#: dllwrap.c:1016 +#: dllwrap.c:994 #, c-format msgid "DRIVER name : %s\n" -msgstr "SÜRÜCÜ adý : %s\n" +msgstr "SÃœRÃœCÃœ adı : %s\n" -#: dllwrap.c:1017 +#: dllwrap.c:995 #, c-format msgid "DRIVER options : %s\n" -msgstr "SÜRÜCÜ seçenekleri : %s\n" +msgstr "SÃœRÃœCÃœ seçenekleri : %s\n" + +#: emul_aix.c:52 +#, c-format +msgid " [-g] - 32 bit small archive\n" +msgstr " [-g] - 32 bitlik küçük arÅŸiv\n" + +#: emul_aix.c:53 +msgid " [-X32] - ignores 64 bit objects\n" +msgstr " [-X32] - 64 bitlik nesneleri yok sayar\n" + +#: emul_aix.c:54 +msgid " [-X64] - ignores 32 bit objects\n" +msgstr " [-X64] - 32 bitlik nesneleri yok sayar\n" + +#: emul_aix.c:55 +msgid " [-X32_64] - accepts 32 and 64 bit objects\n" +msgstr " [-X32_64] - 32 ve 64 bitlik nesneleri kabul eder\n" #: ieee.c:317 msgid "unexpected end of debugging information" -msgstr "hata ayýklama bilgilerinde beklenmeyen son" +msgstr "hata ayıklama bilgilerinde beklenmeyen son" #: ieee.c:412 msgid "invalid number" -msgstr "geçersiz sayý" +msgstr "geçersiz sayı" #: ieee.c:471 msgid "invalid string length" -msgstr "geçersiz dizge uzunluðu" +msgstr "geçersiz dizge uzunluÄŸu" #: ieee.c:528 ieee.c:569 msgid "expression stack overflow" -msgstr "ifade yýðýtýnda taþma" +msgstr "ifade yığıtında taÅŸma" #: ieee.c:548 msgid "unsupported IEEE expression operator" -msgstr "desteklenmeyen IEEE ifade iþlemimi" +msgstr "desteklenmeyen IEEE ifade iÅŸlemimi" #: ieee.c:563 msgid "unknown section" -msgstr "bilinmeyen bölüm" +msgstr "bilinmeyen bölüm" #: ieee.c:584 msgid "expression stack underflow" -msgstr "ifade yýðýt taþmasý" +msgstr "ifade yığıt taÅŸması" #: ieee.c:598 msgid "expression stack mismatch" -msgstr "ifade yýðýtý uyumsuzluðu" +msgstr "ifade yığıtı uyumsuzluÄŸu" #: ieee.c:637 msgid "unknown builtin type" -msgstr "bilinmeyen oluþumiçi tip" +msgstr "bilinmeyen oluÅŸumiçi tip" #: ieee.c:782 msgid "BCD float type not supported" -msgstr "BCD gerçel tipi desteklenmiyor" +msgstr "BCD gerçel tipi desteklenmiyor" #: ieee.c:928 msgid "unexpected number" -msgstr "beklenmeyen sayý" +msgstr "beklenmeyen sayı" #: ieee.c:935 msgid "unexpected record type" -msgstr "beklenmeyen kayýt tipi" +msgstr "beklenmeyen kayıt tipi" #: ieee.c:968 msgid "blocks left on stack at end" -msgstr "yýðýt üzerinde bloklar kaldý" +msgstr "yığıt üzerinde bloklar kaldı" #: ieee.c:1233 msgid "unknown BB type" @@ -1004,19 +1086,19 @@ msgstr "bilinmeyen BB tipi" #: ieee.c:1242 msgid "stack overflow" -msgstr "yýðýt taþmasý" +msgstr "yığıt taÅŸması" #: ieee.c:1267 msgid "stack underflow" -msgstr "yýðýt alt taþmasý" +msgstr "yığıt alt taÅŸması" #: ieee.c:1381 ieee.c:1453 ieee.c:2152 msgid "illegal variable index" -msgstr "geçersiz deðiþken endeksi" +msgstr "geçersiz deÄŸiÅŸken endeksi" #: ieee.c:1431 msgid "illegal type index" -msgstr "geçersiz tip endeksi" +msgstr "geçersiz tip endeksi" #: ieee.c:1441 ieee.c:1478 msgid "unknown TY code" @@ -1024,20 +1106,20 @@ msgstr "bilinmeyen TY kodu" #: ieee.c:1460 msgid "undefined variable in TY" -msgstr "TY'de tanýmsýz deðiþken" +msgstr "TY'de tanımsız deÄŸiÅŸken" #. Pascal file name. FIXME. #: ieee.c:1871 msgid "Pascal file name not supported" -msgstr "Pascal dosya adý desteklenmiyor" +msgstr "Pascal dosya adı desteklenmiyor" #: ieee.c:1919 -msgid "unsupported qualifer" +msgid "unsupported qualifier" msgstr "desteklenmeyen niteleyici" #: ieee.c:2190 msgid "undefined variable in ATN" -msgstr "ATN'de tanýmsýz deðiþken" +msgstr "ATN'de tanımsız deÄŸiÅŸken" #: ieee.c:2233 msgid "unknown ATN type" @@ -1055,23 +1137,23 @@ msgstr "desteklenmeyen ATN12" #: ieee.c:2442 msgid "unexpected string in C++ misc" -msgstr "C++ misc içinde beklenmeyen dizge" +msgstr "C++ misc içinde beklenmeyen dizge" #: ieee.c:2455 msgid "bad misc record" -msgstr "hatalý misc kaydý" +msgstr "hatalı misc kaydı" #: ieee.c:2498 msgid "unrecognized C++ misc record" -msgstr "bilinmeyen C++ misc kaydý" +msgstr "bilinmeyen C++ misc kaydı" #: ieee.c:2615 msgid "undefined C++ object" -msgstr "tanýmlanmamýþ C++ nesnesi" +msgstr "tanımlanmamış C++ nesnesi" #: ieee.c:2649 msgid "unrecognized C++ object spec" -msgstr "bilinmeyen C++ nesne tanýmý" +msgstr "bilinmeyen C++ nesne tanımı" #: ieee.c:2685 msgid "unsupported C++ object type" @@ -1079,59 +1161,59 @@ msgstr "desteklenmeyen C++ nesne tipi" #: ieee.c:2695 msgid "C++ base class not defined" -msgstr "C++ temel sýnýfý tanýmlanmamýþ" +msgstr "C++ temel sınıfı tanımlanmamış" #: ieee.c:2707 ieee.c:2812 msgid "C++ object has no fields" -msgstr "C++ nesnesinde hiç alan yok" +msgstr "C++ nesnesinde hiç alan yok" #: ieee.c:2726 msgid "C++ base class not found in container" -msgstr "C++ temel sýnýfý taþýyýcý içinde bulunamadý" +msgstr "C++ temel sınıfı taşıyıcı içinde bulunamadı" #: ieee.c:2833 msgid "C++ data member not found in container" -msgstr "C++ veri üyesi taþýyýcý içinde bulunamadý" +msgstr "C++ veri üyesi taşıyıcı içinde bulunamadı" #: ieee.c:2874 ieee.c:3024 msgid "unknown C++ visibility" -msgstr "bilinmeyen C++ görünürlüðü" +msgstr "bilinmeyen C++ görünürlüğü" #: ieee.c:2908 msgid "bad C++ field bit pos or size" -msgstr "hatalý C++ alan biti konum veya boyu" +msgstr "hatalı C++ alan biti konum veya boyu" #: ieee.c:3000 msgid "bad type for C++ method function" -msgstr "C++ yöntem iþlevi için hatalý tip" +msgstr "C++ yöntem iÅŸlevi için hatalı tip" #: ieee.c:3010 msgid "no type information for C++ method function" -msgstr "C++ yöntem iþlevi için tip bilgisi yok" +msgstr "C++ yöntem iÅŸlevi için tip bilgisi yok" #: ieee.c:3049 msgid "C++ static virtual method" -msgstr "C++ statik sanal yöntem" +msgstr "C++ statik sanal yöntem" #: ieee.c:3144 msgid "unrecognized C++ object overhead spec" -msgstr "bilinmeyen C++ nesne masraf tanýmý" +msgstr "bilinmeyen C++ nesne masraf tanımı" #: ieee.c:3183 msgid "undefined C++ vtable" -msgstr "tanýmlanmamýþ C++ vtablosu" +msgstr "tanımlanmamış C++ vtablosu" #: ieee.c:3254 msgid "C++ default values not in a function" -msgstr "C++ öntanýmlý deðerleri iþlev içerisinde deðil" +msgstr "C++ öntanımlı deÄŸerleri iÅŸlev içerisinde deÄŸil" #: ieee.c:3294 msgid "unrecognized C++ default type" -msgstr "bilinmeyen öntanýmlý C++ tipi" +msgstr "bilinmeyen öntanımlı C++ tipi" #: ieee.c:3325 msgid "reference parameter is not a pointer" -msgstr "referans parametresi imleyici deðil" +msgstr "referans parametresi imleyici deÄŸil" #: ieee.c:3410 msgid "unrecognized C++ reference type" @@ -1139,11 +1221,11 @@ msgstr "bilinmeyen C++ referans tipi" #: ieee.c:3492 msgid "C++ reference not found" -msgstr "C++ referansý bulunamadý" +msgstr "C++ referansı bulunamadı" #: ieee.c:3500 msgid "C++ reference is not pointer" -msgstr "C++ referansý imleyici deðil" +msgstr "C++ referansı imleyici deÄŸil" #: ieee.c:3529 ieee.c:3537 msgid "missing required ASN" @@ -1155,233 +1237,237 @@ msgstr "Gerekli ATN65 yok" #: ieee.c:3589 msgid "bad ATN65 record" -msgstr "hatalý ATN65 kaydý" +msgstr "hatalı ATN65 kaydı" -#: ieee.c:4236 +#: ieee.c:4234 msgid "IEEE numeric overflow: 0x" -msgstr "IEEE sayýsal taþma: 0x" +msgstr "IEEE sayısal taÅŸma: 0x" -#: ieee.c:4282 +#: ieee.c:4280 #, c-format msgid "IEEE string length overflow: %u\n" -msgstr "IEEE dizge uzunluk taþmasý: %u\n" +msgstr "IEEE dizge uzunluk taÅŸması: %u\n" -#: ieee.c:5333 +#: ieee.c:5330 #, c-format msgid "IEEE unsupported integer type size %u\n" -msgstr "IEEE desteklenmeyen tamsayý tip boyu %u\n" +msgstr "IEEE desteklenmeyen tamsayı tip boyu %u\n" -#: ieee.c:5369 +#: ieee.c:5366 #, c-format msgid "IEEE unsupported float type size %u\n" -msgstr "IEEE desteklenmeyen gerçel tip boyu %u\n" +msgstr "IEEE desteklenmeyen gerçel tip boyu %u\n" -#: ieee.c:5405 +#: ieee.c:5402 #, c-format msgid "IEEE unsupported complex type size %u\n" -msgstr "IEEE desteklenmeyen karmaþýk tip boyu %u\n" +msgstr "IEEE desteklenmeyen karmaşık tip boyu %u\n" -#: nlmconv.c:278 srconv.c:2020 +#: nlmconv.c:281 srconv.c:2043 msgid "input and output files must be different" -msgstr "girdi ve çýktý dosyalarý farklý olmalý" +msgstr "girdi ve çıktı dosyaları farklı olmalı" -#: nlmconv.c:325 +#: nlmconv.c:328 msgid "input file named both on command line and with INPUT" -msgstr "girdi dosyasý ismi hem komut satýrýnda hem INPUT olarak verilmiþ" +msgstr "girdi dosyası ismi hem komut satırında hem INPUT olarak verilmiÅŸ" -#: nlmconv.c:334 +#: nlmconv.c:337 msgid "no input file" -msgstr "girdi dosyasý yok" +msgstr "girdi dosyası yok" -#: nlmconv.c:364 +#: nlmconv.c:367 msgid "no name for output file" -msgstr "çýktý dosyasý için isim yok" +msgstr "çıktı dosyası için isim yok" -#: nlmconv.c:377 +#: nlmconv.c:380 msgid "warning: input and output formats are not compatible" -msgstr "uyarý: girdi ve çýktý biçemleri uyumlu deðil" +msgstr "uyarı: girdi ve çıktı biçemleri uyumlu deÄŸil" -#: nlmconv.c:406 +#: nlmconv.c:409 msgid "make .bss section" -msgstr ".bss bölümü oluþtur" +msgstr ".bss bölümü oluÅŸtur" -#: nlmconv.c:415 +#: nlmconv.c:418 msgid "make .nlmsections section" -msgstr ".nlmsections bölümü oluþtur" +msgstr ".nlmsections bölümü oluÅŸtur" -#: nlmconv.c:417 +#: nlmconv.c:420 msgid "set .nlmsections flags" -msgstr ".nlmsections seçenekleri atar" +msgstr ".nlmsections seçenekleri atar" -#: nlmconv.c:445 +#: nlmconv.c:448 msgid "set .bss vma" msgstr ".bss vma atar" -#: nlmconv.c:452 +#: nlmconv.c:455 msgid "set .data size" msgstr ".data boyu atar" -#: nlmconv.c:632 +#: nlmconv.c:635 #, c-format msgid "warning: symbol %s imported but not in import list" -msgstr "uyarý: %s sembolü ithal edildi ama ithal listesinde deðil" +msgstr "uyarı: %s sembolü ithal edildi ama ithal listesinde deÄŸil" -#: nlmconv.c:652 +#: nlmconv.c:655 msgid "set start address" -msgstr "baþlangýç adresini atar" +msgstr "baÅŸlangıç adresini atar" -#: nlmconv.c:701 +#: nlmconv.c:704 #, c-format msgid "warning: START procedure %s not defined" -msgstr "uyarý: START altyordamý %s tanýmsýz" +msgstr "uyarı: START altyordamı %s tanımsız" -#: nlmconv.c:703 +#: nlmconv.c:706 #, c-format msgid "warning: EXIT procedure %s not defined" -msgstr "uyarý: EXIT altyordamý %s tanýmsýz" +msgstr "uyarı: EXIT altyordamı %s tanımsız" -#: nlmconv.c:705 +#: nlmconv.c:708 #, c-format msgid "warning: CHECK procedure %s not defined" -msgstr "warning: CHECK altyordamý %s tanýmsýz" +msgstr "warning: CHECK altyordamı %s tanımsız" -#: nlmconv.c:726 nlmconv.c:915 +#: nlmconv.c:729 nlmconv.c:918 msgid "custom section" -msgstr "özel bölüm" +msgstr "özel bölüm" -#: nlmconv.c:747 nlmconv.c:944 +#: nlmconv.c:750 nlmconv.c:947 msgid "help section" -msgstr "yardým bölümü" +msgstr "yardım bölümü" -#: nlmconv.c:769 nlmconv.c:962 +#: nlmconv.c:772 nlmconv.c:965 msgid "message section" -msgstr "ileti bölümü" +msgstr "ileti bölümü" -#: nlmconv.c:785 nlmconv.c:995 +#: nlmconv.c:788 nlmconv.c:998 msgid "module section" -msgstr "modül bölümü" +msgstr "modül bölümü" -#: nlmconv.c:805 nlmconv.c:1011 +#: nlmconv.c:808 nlmconv.c:1014 msgid "rpc section" -msgstr "rpc bölümü" +msgstr "rpc bölümü" #. There is no place to record this information. -#: nlmconv.c:841 +#: nlmconv.c:844 #, c-format msgid "%s: warning: shared libraries can not have uninitialized data" -msgstr "%s: uyarý: paylaþýmlý kitaplýklar öndeðer atanmamýþ veri kapsayamaz" +msgstr "%s: uyarı: paylaşımlı kitaplıklar öndeÄŸer atanmamış veri kapsayamaz" -#: nlmconv.c:862 nlmconv.c:1030 +#: nlmconv.c:865 nlmconv.c:1033 msgid "shared section" -msgstr "paylaþýmlý bölüm" +msgstr "paylaşımlı bölüm" -#: nlmconv.c:870 +#: nlmconv.c:873 msgid "warning: No version number given" -msgstr "uyarý: Sürüm numarasý verilmemiþ" +msgstr "uyarı: Sürüm numarası verilmemiÅŸ" -#: nlmconv.c:910 nlmconv.c:939 nlmconv.c:957 nlmconv.c:1006 nlmconv.c:1025 +#: nlmconv.c:913 nlmconv.c:942 nlmconv.c:960 nlmconv.c:1009 nlmconv.c:1028 #, c-format msgid "%s: read: %s" msgstr "%s: okundu: %s" -#: nlmconv.c:932 +#: nlmconv.c:935 msgid "warning: MAP and FULLMAP are not supported; try ld -M" -msgstr "uyarý: MAP ve FULLMAP desteklenmiyor; ld -M komutunu deneyin" +msgstr "uyarı: MAP ve FULLMAP desteklenmiyor; ld -M komutunu deneyin" -#: nlmconv.c:1101 +#: nlmconv.c:1107 #, c-format -msgid "%s: Convert an object file into a NetWare Loadable Module\n" -msgstr "%s: Bir nesne dosyasýný NetWare Yüklenebilir Modül haline getirir\n" +msgid "Usage: %s [option(s)] [in-file [out-file]]\n" +msgstr "Kullanım: %s [seçenekler] [girdi-dosyası [çıktı-dosyası]]\n" -#: nlmconv.c:1113 -#, c-format +#: nlmconv.c:1108 +msgid " Convert an object file into a NetWare Loadable Module\n" +msgstr " Bir nesne dosyasını NetWare Yüklenebilir Modül haline getirir\n" + +#: nlmconv.c:1109 msgid "" -"Usage: %s [-dhV] [-I bfdname] [-O bfdname] [-T header-file] [-l linker]\n" -" [--input-target=bfdname] [--output-target=bfdname]\n" -" [--header-file=file] [--linker=linker] [--debug]\n" -" [--help] [--version]\n" -" [in-file [out-file]]\n" -msgstr "" -"Kullaným: %s [-dhV] [-I bfd_adý] [-O bfd_adý] [-T baþlýk-dosyasý]\n" -" [-l baðlayýcý]\n" -" [--input-target=bfd_adý] girdi dosyasý adý\n" -" [--output-target=bfd_adý] çýktý dosyasý adý\n" -" [--header-file=dosya] baþlýk dosyasý adý\n" -" [--linker=baðlayýcý] baðlayýcý yazýlým adý\n" -" [--debug] hata ayýklama kipi\n" -" [--help] bu yardýmý gösterir\n" -" [--version] sürüm bilgisini gösterir\n" -" [girdi-dosyasý [çýktý-dosyasý]]\n" +" The options are:\n" +" -I --input-target= Set the input binary file format\n" +" -O --output-target= Set the output binary file format\n" +" -T --header-file= Read for NLM header information\n" +" -l --linker= Use for any linking\n" +" -d --debug Display on stderr the linker command line\n" +" -h --help Display this information\n" +" -v --version Display the program's version\n" +msgstr "" +" Seçenekler:\n" +" -I --input-target= Girdi ikilik dosya biçemini belirler\n" +" -O --output-target= Çıktı ikilik dosya biçemini belirler\n" +" -T --header-file= NLM baÅŸlık bilgilerini dan okur\n" +" -l --linker= BaÄŸlama iÅŸlemi için yı kullanır\n" +" -d --debug Standart hatada baÄŸlayıcı komut satırını gösterir\n" +" -h --help Bu bilgiyi gösterir\n" +" -v --version Program sürüm no'sunu gösterir\n" -#: nlmconv.c:1153 +#: nlmconv.c:1151 #, c-format msgid "support not compiled in for %s" -msgstr "%s için destek derlenmemiþ" +msgstr "%s için destek derlenmemiÅŸ" -#: nlmconv.c:1193 +#: nlmconv.c:1191 msgid "make section" -msgstr "bölüm oluþtur" +msgstr "bölüm oluÅŸtur" -#: nlmconv.c:1207 +#: nlmconv.c:1205 msgid "set section size" -msgstr "bölüm boyu belirtir" +msgstr "bölüm boyu belirtir" -#: nlmconv.c:1213 +#: nlmconv.c:1211 msgid "set section alignment" -msgstr "bölüm hizalanmasý atar" +msgstr "bölüm hizalanması atar" -#: nlmconv.c:1217 +#: nlmconv.c:1215 msgid "set section flags" -msgstr "bölüm seçeneklerini atar" +msgstr "bölüm seçeneklerini atar" -#: nlmconv.c:1228 +#: nlmconv.c:1226 msgid "set .nlmsections size" msgstr ".nlmsections boyunu atar" -#: nlmconv.c:1316 nlmconv.c:1324 nlmconv.c:1333 nlmconv.c:1338 +#: nlmconv.c:1314 nlmconv.c:1322 nlmconv.c:1331 nlmconv.c:1336 msgid "set .nlmsection contents" -msgstr ".nlmsection içeriðini atar" +msgstr ".nlmsection içeriÄŸini atar" -#: nlmconv.c:1841 +#: nlmconv.c:1837 msgid "stub section sizes" -msgstr "koçan bölüm boylarý" +msgstr "koçan bölüm boyları" -#: nlmconv.c:1890 +#: nlmconv.c:1886 msgid "writing stub" -msgstr "koçan yazýlýyor" +msgstr "koçan yazılıyor" -#: nlmconv.c:1980 +#: nlmconv.c:1975 #, c-format msgid "unresolved PC relative reloc against %s" -msgstr "%s'e göreli PC yer deðiþtirme çözümlenemedi" +msgstr "%s'e göreli PC yer deÄŸiÅŸtirme çözümlenemedi" -#: nlmconv.c:2044 +#: nlmconv.c:2039 #, c-format msgid "overflow when adjusting relocation against %s" -msgstr "%s'e göreli yer deðiþtirme ayarlanýrken taþma oluþtu" +msgstr "%s'e göreli yer deÄŸiÅŸtirme ayarlanırken taÅŸma oluÅŸtu" -#: nlmconv.c:2161 +#: nlmconv.c:2156 #, c-format msgid "%s: execution of %s failed: " -msgstr "%s: %s'in çalýþtýrýlmasý baþarýsýz oldu: " +msgstr "%s: %s'in çalıştırılması baÅŸarısız oldu: " -#: nlmconv.c:2176 +#: nlmconv.c:2171 #, c-format msgid "Execution of %s failed" -msgstr "%s'in çalýþtýrýlmasý baþarýsýz oldu" +msgstr "%s'in çalıştırılması baÅŸarısız oldu" -#: nm.c:300 +#: nm.c:246 size.c:85 strings.c:650 #, c-format -msgid "Usage: %s [OPTION]... [FILE]...\n" -msgstr "Kullaným: %s [SEÇENEK]... [DOSYA]...\n" +msgid "Usage: %s [option(s)] [file(s)]\n" +msgstr "Kullanım: %s [seçenekler] [dosya(lar)]\n" -#: nm.c:301 -msgid "List symbols from FILEs (a.out by default).\n" -msgstr "DOSYAlardaki sembolleri listeler (öntanýmlý a.out).\n" +#: nm.c:247 +msgid " List symbols in [file(s)] (a.out by default).\n" +msgstr " [dosya(lar)]daki sembolleri listeler (öntanımlı a.out).\n" -#: nm.c:302 +#: nm.c:248 msgid "" -"\n" +" The options are:\n" " -a, --debug-syms Display debugger-only symbols\n" " -A, --print-file-name Print name of the input file before every symbol\n" " -B Same as --format=bsd\n" @@ -1395,7 +1481,6 @@ msgid "" " -f, --format=FORMAT Use the output format FORMAT. FORMAT can be `bsd',\n" " `sysv' or `posix'. The default is `bsd'\n" " -g, --extern-only Display only external symbols\n" -" -h, --help Display this information\n" " -l, --line-numbers Use debugging information to find a filename and\n" " line number for each symbol\n" " -n, --numeric-sort Sort symbols numerically by address\n" @@ -1403,114 +1488,180 @@ msgid "" " -p, --no-sort Do not sort the symbols\n" " -P, --portability Same as --format=posix\n" " -r, --reverse-sort Reverse the sense of the sort\n" +" -S, --print-size Print size of defined symbols\n" " -s, --print-armap Include index for symbols from archive members\n" " --size-sort Sort symbols by size\n" " -t, --radix=RADIX Use RADIX for printing symbol values\n" " --target=BFDNAME Specify the target object format as BFDNAME\n" " -u, --undefined-only Display only undefined symbols\n" -" -V, --version Display this program's version number\n" " -X 32_64 (ignored)\n" +" -h, --help Display this information\n" +" -V, --version Display this program's version number\n" "\n" msgstr "" -"\n" -" -a, --debug-syms Yalnýzca hata ayýklamaya dair sembolleri gösterir\n" -" -A, --print-file-name Her sembolden önce girdi dosyasýnýn adýný yazdýrýr\n" -" -B --format=bsd ile ayný\n" -" -C, --demangle[=TARZ] Alt düzey sembol adlarýný kullanýcý seviyesinde adlara çevirir\n" -" TARZ, eðer belirtilirse, 'auto' (öntanýmlý),\n" +" Seçenekler:\n" +" -a, --debug-syms Yalnızca hata ayıklamaya dair sembolleri gösterir\n" +" -A, --print-file-name Her sembolden önce girdi dosyasının adını yazdırır\n" +" -B --format=bsd ile aynı\n" +" -C, --demangle[=TARZ] Alt düzey sembol adlarını kullanıcı seviyesinde adlara çevirir\n" +" TARZ, eÄŸer belirtilirse, 'auto' (öntanımlı),\n" " `gnu', 'lucid', 'arm', 'hp', 'edg' veya 'gnu-new-abi' olabilir\n" -" --no-demangle Alt düzey sembol adlarýný çevirmez\n" -" -D, --dynamic Normal semboller yerine dinamik sembolleri gösterir\n" -" --defined-only Yalnýzca tanýmlanmýþ sembolleri gösterir\n" -" -e (yoksayýlýr)\n" -" -f, --format=BÝÇEM Çýktý biçemi için BÝÇEM'i kullanýr. BÝÇEM, 'bsd' (öntanýmlý),\n" +" --no-demangle Alt düzey sembol adlarını çevirmez\n" +" -D, --dynamic Normal semboller yerine dinamik sembolleri gösterir\n" +" --defined-only Yalnızca tanımlanmış sembolleri gösterir\n" +" -e (yoksayılır)\n" +" -f, --format=BİÇEM Çıktı biçemi için BİÇEM'i kullanır. BİÇEM, 'bsd' (öntanımlı),\n" " `sysv' veya `posix' olabilir\n" -" -g, --extern-only Yalnýzca harici sembolleri gösterir\n" -" -h, --help Bu bilgiyi gösterir\n" -" -l, --line-numbers Hata ayýklama bilgisini kullanarak her sembol için bir\n" -" satýr numarasý ve dosya adý bulur.\n" -" -n, --numeric-sort Sembolleri adres numarasýna göre sýralar\n" -" -o -A ile ayný\n" -" -p, --no-sort Sembolleri sýralamaz\n" -" -P, --portability --format=posix ile ayný\n" -" -r, --reverse-sort Ters sýralar\n" -" -s, --print-armap Arþiv üyelerinden gelen semboller için endeks içerir\n" -" --size-sort Sembolleri büyüklüðe göre sýralar\n" -" -t, --radix=RADIX Sembol deðerlerini yazdýrmak için RADIX kullanýr\n" -" --target=BFD_ADI Hedef nesne biçemini BFD_ADI olarak belirler\n" -" -u, --undefined-only Yalnýzca tanýmlanmamýþ sembolleri gösterir\n" -" -V, --version Sürüm bilgilerini gösterir\n" -" -X 32_64 (yoksayýlýr)\n" +" -g, --extern-only Yalnızca harici sembolleri gösterir\n" +" -l, --line-numbers Hata ayıklama bilgisini kullanarak her sembol için bir\n" +" satır numarası ve dosya adı bulur.\n" +" -n, --numeric-sort Sembolleri adres numarasına göre sıralar\n" +" -o -A ile aynı\n" +" -p, --no-sort Sembolleri sıralamaz\n" +" -P, --portability --format=posix ile aynı\n" +" -r, --reverse-sort Ters sıralar\n" +" -S, --print-size Tanımlı sembollerin boyunu gösterir\n" +" -s, --print-armap ArÅŸiv üyelerinden gelen semboller için endeks içerir\n" +" --size-sort Sembolleri büyüklüğe göre sıralar\n" +" -t, --radix=RADIX Sembol deÄŸerlerini yazdırmak için RADIX kullanır\n" +" --target=BFD_ADI Hedef nesne biçemini BFD_ADI olarak belirler\n" +" -u, --undefined-only Yalnızca tanımlanmamış sembolleri gösterir\n" +" -X 32_64 (yok sayılır)\n" +" -h, --help Bu bilgiyi gösterir\n" +" -V, --version Sürüm bilgilerini gösterir\n" "\n" -#: nm.c:334 objdump.c:216 +#: nm.c:281 objdump.c:217 #, c-format msgid "Report bugs to %s.\n" msgstr "" -"Hatalarý %s adresine, \n" -"çeviri hatalarýný adresine bildiriniz.\n" +"Hataları %s adresine, \n" +"çeviri hatalarını adresine bildiriniz.\n" -#: nm.c:367 +#: nm.c:314 #, c-format msgid "%s: invalid radix" -msgstr "%s: geçersiz radix" +msgstr "%s: geçersiz radix" -#: nm.c:392 +#: nm.c:339 #, c-format msgid "%s: invalid output format" -msgstr "%s: geçersiz çýktý biçemi" +msgstr "%s: geçersiz çıktı biçemi" -#: nm.c:504 +#: nm.c:456 msgid "Only -X 32_64 is supported" -msgstr "Yalnýz -X 32_64 destekleniyor" +msgstr "Yalnız -X 32_64 destekleniyor" -#: nm.c:546 +#: nm.c:498 #, c-format msgid "data size %ld" -msgstr "veri büyüklüðü %ld" +msgstr "veri büyüklüğü %ld" + +#: nm.c:523 readelf.c:5306 readelf.c:5342 +#, c-format +msgid ": %d" +msgstr ": %d" + +#: nm.c:525 readelf.c:5308 readelf.c:5354 +#, c-format +msgid ": %d" +msgstr "<Ä°S'e özel>: %d" + +#: nm.c:527 readelf.c:5310 readelf.c:5357 +#, c-format +msgid ": %d" +msgstr ": %d" -#: nm.c:1340 +#: nm.c:1339 #, c-format -msgid "\n\nUndefined symbols from %s:\n\n" -msgstr "\n\n%s'de tanýmlanmamýþ semboller:\n\n" +msgid "" +"\n" +"\n" +"Undefined symbols from %s:\n" +"\n" +msgstr "" +"\n" +"\n" +"%s'de tanımlanmamış semboller:\n" +"\n" -#: nm.c:1342 +#: nm.c:1341 #, c-format -msgid "\n\nSymbols from %s:\n\n" -msgstr "\n\n%s'de semboller:\n\n" +msgid "" +"\n" +"\n" +"Symbols from %s:\n" +"\n" +msgstr "" +"\n" +"\n" +"%s'de semboller:\n" +"\n" -#: nm.c:1343 nm.c:1397 -msgid "Name Value Class Type Size Line Section\n\n" +#: nm.c:1343 nm.c:1401 +msgid "" +"Name Value Class Type Size Line Section\n" +"\n" msgstr "" -"Name Value Class Type Size Line Section\n" +"Ä°sim DeÄŸer Sınıf Tip Boy Satır Bölüm\n" +"\n" + +#: nm.c:1346 nm.c:1404 +msgid "" +"Name Value Class Type Size Line Section\n" "\n" -"Ýsim Deðer Sýnýf Tip Boy Satýr Bölüm\n" +msgstr "" +"Ä°sim DeÄŸer Sınıf Tip Boy Satır Bölüm\n" "\n" -#: nm.c:1394 +#: nm.c:1397 #, c-format -msgid "\n\nUndefined symbols from %s[%s]:\n\n" -msgstr "\n\n%s[%s]'de tanýmlanmamýþ semboller:\n\n" +msgid "" +"\n" +"\n" +"Undefined symbols from %s[%s]:\n" +"\n" +msgstr "" +"\n" +"\n" +"%s[%s]'de tanımlanmamış semboller:\n" +"\n" -#: nm.c:1396 +#: nm.c:1399 #, c-format -msgid "\n\nSymbols from %s[%s]:\n\n" -msgstr "\n\n%s[%s]'de semboller:\n\n" +msgid "" +"\n" +"\n" +"Symbols from %s[%s]:\n" +"\n" +msgstr "" +"\n" +"\n" +"%s[%s]'de semboller:\n" +"\n" -#: nm.c:1564 -msgid "\nArchive index:\n" -msgstr "\nArþiv endeksi:\n" +#: nm.c:1614 +msgid "" +"\n" +"Archive index:\n" +msgstr "" +"\n" +"ArÅŸiv endeksi:\n" -#: objcopy.c:363 +#: objcopy.c:363 srconv.c:1952 #, c-format -msgid "Usage: %s in-file [out-file]\n" -msgstr "Kullaným: %s girdi-dosyasý [çýktý-dosyasý]\n" +msgid "Usage: %s [option(s)] in-file [out-file]\n" +msgstr "Kullanım: %s [seçenekler] girdi-dosyası [çıktı-dosyası]\n" + +#: objcopy.c:364 +msgid " Copies a binary file, possibly transforming it in the process\n" +msgstr " Ä°kilik dosyayı, muhtemelen deÄŸiÅŸtirerek kopyalar\n" -#: objcopy.c:364 objcopy.c:433 +#: objcopy.c:365 objcopy.c:435 msgid " The options are:\n" -msgstr " Seçenekler:\n" +msgstr " Seçenekler:\n" -#: objcopy.c:365 +#: objcopy.c:366 msgid "" " -I --input-target Assume input file is in format \n" " -O --output-target Create an output file in format \n" @@ -1567,105 +1718,109 @@ msgid "" " -V --version Display this program's version number\n" " -h --help Display this output\n" msgstr "" -" -I --input-target Girdi dosyasýnýn biçeminde\n" -" olduðunu varsayar\n" -" -O --output-target Çýktý dosyasýný biçeminde\n" -" oluþturur\n" -" -B --binary-architecture Girdi ikilik biçeminde olduðu zaman çýktý\n" -" dosyasýnýn platformunu belirler.\n" -" -F --target Hem girdi, hem de çýktý biçemini \n" +" -I --input-target Girdi dosyasının biçeminde\n" +" olduÄŸunu varsayar\n" +" -O --output-target Çıktı dosyasını biçeminde\n" +" oluÅŸturur\n" +" -B --binary-architecture Girdi ikilik biçeminde olduÄŸu zaman çıktı\n" +" dosyasının platformunu belirler.\n" +" -F --target Hem girdi, hem de çıktı biçemini \n" " olarak atar\n" -" --debugging Mümkün olduðu kadar hata ayýklama\n" -" bilgisini dönüþtürür\n" -" -p --preserve-dates Çýktýya deðiþim/eriþim zaman damgalarýný\n" +" --debugging Mümkün olduÄŸu kadar hata ayıklama\n" +" bilgisini dönüştürür\n" +" -p --preserve-dates Çıktıya deÄŸiÅŸim/eriÅŸim zaman damgalarını\n" " kopyalar\n" -" -j --only-section Çýktýya yalnýzca bölümünü kopyalar\n" -" -R --remove-section Çýktýdan bölümünü çýkarýr\n" -" -S --strip-all Bütün sembol ve yer deðiþtirme bilgisini\n" +" -j --only-section Çıktıya yalnızca bölümünü kopyalar\n" +" -R --remove-section Çıktıdan bölümünü çıkarır\n" +" -S --strip-all Bütün sembol ve yer deÄŸiÅŸtirme bilgisini\n" " siler\n" -" -g --strip-debug Bütün hata ayýklama sembollerini siler\n" -" --strip-unneeded Yer deðiþtirmeler için gerekmeyen bütün\n" +" -g --strip-debug Bütün hata ayıklama sembollerini siler\n" +" --strip-unneeded Yer deÄŸiÅŸtirmeler için gerekmeyen bütün\n" " sembolleri siler\n" -" -N --strip-symbol sembolünü kopyalamaz\n" -" -K --keep-symbol Yalnýzca sembolünü kopyalar\n" -" -L --localize-symbol sembolünün yerel olarak\n" -" tanýmlanmasýný saðlar\n" -" -G --keep-global-symbol haricindeki bütün sembolleri\n" -" yerelleþtirir.\n" -" -W --weaken-symbol sembolünün zayýf olarak\n" -" tanýmlanmasýný saðlar\n" -" --weaken Bütün evrensel sembollerin zayýf olarak\n" -" tanýmlanmasýný saðlar\n" -" -x --discard-all Evrensel olmayan bütün sembolleri siler\n" -" -X --discard-locals Derleyici tarafýndan oluþturulan bütün\n" +" -N --strip-symbol sembolünü kopyalamaz\n" +" -K --keep-symbol Yalnızca sembolünü kopyalar\n" +" -L --localize-symbol sembolünün yerel olarak\n" +" tanımlanmasını saÄŸlar\n" +" -G --keep-global-symbol haricindeki bütün sembolleri\n" +" yerelleÅŸtirir.\n" +" -W --weaken-symbol sembolünün zayıf olarak\n" +" tanımlanmasını saÄŸlar\n" +" --weaken Bütün evrensel sembollerin zayıf olarak\n" +" tanımlanmasını saÄŸlar\n" +" -x --discard-all Evrensel olmayan bütün sembolleri siler\n" +" -X --discard-locals Derleyici tarafından oluÅŸturulan bütün\n" " sembolleri siler\n" -" -i --interleave Her bayttan yalnýz birini kopyalar\n" -" -b --byte Her serpiþtirilmiþ bloktan numaralý\n" -" baytý seçer\n" -" --gap-fill Bölümler arasý boþluklarý ile\n" +" -i --interleave Her bayttan yalnız birini kopyalar\n" +" -b --byte Her serpiÅŸtirilmiÅŸ bloktan numaralı\n" +" baytı seçer\n" +" --gap-fill Bölümler arası boÅŸlukları ile\n" " doldurur\n" -" --pad-to Son bölümü e kadar boþlukla doldurur\n" -" --set-start Baþlangýç adresini olarak belirtir\n" +" --pad-to Son bölümü e kadar boÅŸlukla doldurur\n" +" --set-start BaÅŸlangıç adresini olarak belirtir\n" " {--change-start|--adjust-start} \n" -" Baþlangýç adresine ekler\n" +" BaÅŸlangıç adresine ekler\n" " {--change-addresses|--adjust-vma} \n" -" LMA, VMA ve baþlangýç adreslerine \n" +" LMA, VMA ve baÅŸlangıç adreslerine \n" " ekler\n" -" {--change-section-address|--adjust-section-vma} {=|+|-}\n" -" bölümünün LMA ve VMA'sýný \n" -" kadar deðiþtirir\n" -" --change-section-lma {=|+|-}\n" -" bölümünün LMA'sýný kadar\n" -" deðiþtirir\n" -" --change-section-vma {=|+|-}\n" -" bölümünün VMA'sýný kadar\n" -" deðiþtirir\n" +" {--change-section-address|--adjust-section-vma} {=|+|-}\n" +" bölümünün LMA ve VMA'sını \n" +" kadar deÄŸiÅŸtirir\n" +" --change-section-lma {=|+|-}\n" +" bölümünün LMA'sını kadar\n" +" deÄŸiÅŸtirir\n" +" --change-section-vma {=|+|-}\n" +" bölümünün VMA'sını kadar\n" +" deÄŸiÅŸtirir\n" " {--[no-]change-warnings|--[no-]adjust-warnings}\n" -" Eðer isimli bir bölüm yok ise uyarý verir\n" -" --set-section-flags =\n" -" bölümünün özniteliklerini\n" -" e ayarlar\n" -" --add-section = içinde bulunan bölümünü\n" -" çýktýya ekler\n" -" --rename-section =[,] bölümünü olarak\n" -" yeniden adlandýrýr\n" -" --change-leading-char Çýktý biçeminin baþlangýç karakter tipini\n" -" deðiþtirir\n" -" --remove-leading-char Evrensel sembollerden baþlangýç\n" -" karakterini çýkarýr\n" -" --redefine-sym = isimli sembolü isimli olarak\n" -" yeniden tanýmlar\n" -" --srec-len Oluþturulan S kayýtlarýnýn boyutunu\n" -" kýsýtlar\n" -" --srec-forceS3 Oluþturulan S kayýtlarý tipini S3 olarak\n" -" kýsýtlar\n" -" --strip-symbols daki bütün semboller için -N uygular\n" -" --keep-symbols daki bütün semboller için -K uygular\n" -" --localize-symbols daki bütün semboller için -L uygular\n" -" --keep-global-symbols daki bütün semboller için -G uygular\n" -" --weaken-symbols daki bütün semboller için -W uygular\n" -" --alt-machine-code Çýktý için alternatif makina kodu kullanýr\n" -" -v --verbose Deðiþtirilen tüm nesne dosyalarýný listeler\n" -" -V --version Bu yazýlýmýn sürüm bilgilerini gösterir\n" -" -h --help Bu çýktýyý gösterir\n" +" EÄŸer isimli bir bölüm yok ise uyarı verir\n" +" --set-section-flags =\n" +" bölümünün özniteliklerini\n" +" e ayarlar\n" +" --add-section = içinde bulunan bölümünü\n" +" çıktıya ekler\n" +" --rename-section =[,] bölümünü olarak\n" +" yeniden adlandırır\n" +" --change-leading-char Çıktı biçeminin baÅŸlangıç karakter tipini\n" +" deÄŸiÅŸtirir\n" +" --remove-leading-char Evrensel sembollerden baÅŸlangıç\n" +" karakterini çıkarır\n" +" --redefine-sym = isimli sembolü isimli olarak\n" +" yeniden tanımlar\n" +" --srec-len OluÅŸturulan S kayıtlarının boyutunu\n" +" kısıtlar\n" +" --srec-forceS3 OluÅŸturulan S kayıtları tipini S3 olarak\n" +" kısıtlar\n" +" --strip-symbols daki bütün semboller için -N uygular\n" +" --keep-symbols daki bütün semboller için -K uygular\n" +" --localize-symbols daki bütün semboller için -L uygular\n" +" --keep-global-symbols daki bütün semboller için -G uygular\n" +" --weaken-symbols daki bütün semboller için -W uygular\n" +" --alt-machine-code Çıktı için alternatif makina kodu kullanır\n" +" -v --verbose DeÄŸiÅŸtirilen tüm nesne dosyalarını listeler\n" +" -V --version Bu yazılımın sürüm bilgilerini gösterir\n" +" -h --help Bu çıktıyı gösterir\n" -#: objcopy.c:432 +#: objcopy.c:433 #, c-format -msgid "Usage: %s in-file(s)\n" -msgstr "Kullaným: %s girdi-dosya(larý)\n" +msgid "Usage: %s in-file(s)\n" +msgstr "Kullanım: %s girdi-dosya(ları)\n" #: objcopy.c:434 +msgid " Removes symbols and sections from files\n" +msgstr " Dosyalardan sembol ve bölümleri çıkarır\n" + +#: objcopy.c:436 msgid "" -" -I --input-target Assume input file is in format \n" -" -O --output-target Create an output file in format \n" -" -F --target Set both input and output format to \n" +" -I --input-target= Assume input file is in format \n" +" -O --output-target= Create an output file in format \n" +" -F --target= Set both input and output format to \n" " -p --preserve-dates Copy modified/access timestamps to the output\n" -" -R --remove-section Remove section from the output\n" +" -R --remove-section= Remove section from the output\n" " -s --strip-all Remove all symbol and relocation information\n" -" -g -S --strip-debug Remove all debugging symbols\n" +" -g -S -d --strip-debug Remove all debugging symbols\n" " --strip-unneeded Remove all symbols not needed by relocations\n" -" -N --strip-symbol Do not copy symbol \n" -" -K --keep-symbol Only copy symbol \n" +" -N --strip-symbol= Do not copy symbol \n" +" -K --keep-symbol= Only copy symbol \n" " -x --discard-all Remove all non-global symbols\n" " -X --discard-locals Remove any compiler-generated symbols\n" " -v --verbose List all object files modified\n" @@ -1673,230 +1828,230 @@ msgid "" " -h --help Display this output\n" " -o Place stripped output into \n" msgstr "" -" -I --input-target Girdi dosyasýnýn biçeminde olduðunu varsayar\n" -" -O --output-target Çýktý dosyasýný biçeminde oluþturur\n" -" -F --target Girdi ve çýktý biçemlerini olarak atar\n" -" -p --preserve-dates Çýktýya deðiþim/eriþim zaman damgalarýný kopyalar\n" -" -R --remove-section Çýktýdan bölümünü çýkarýr\n" -" -s --strip-all Bütün sembol ve yer deðiþtirme bilgisini siler\n" -" -g -S --strip-debug Bütün hata ayýklama sembollerini siler\n" -" --strip-unneeded Yer deðiþtirmeler için gerekmeyen bütün sembolleri siler\n" -" -N --strip-symbol sembolünü kopyalamaz\n" -" -K --keep-symbol Yalnýzca sembolünü kopyalar\n" -" -x --discard-all Evrensel olmayan bütün sembolleri siler\n" -" -X --discard-locals Derleyici tarafýndan oluþturulan bütün sembolleri siler\n" -" -v --verbose Deðiþtirilen tüm nesne dosyalarýný listeler\n" -" -V --version Bu yazýlýmýn sürüm bilgilerini gösterir\n" -" -h --help Bu çýktýyý gösterir\n" -" -o Sembolleri silinmiþ çýktýyý ya yerleþtirir\n" +" -I --input-target= Girdi dosyasının biçeminde olduÄŸunu varsayar\n" +" -O --output-target= Çıktı dosyasını biçeminde oluÅŸturur\n" +" -F --target= Girdi ve çıktı biçemlerini olarak atar\n" +" -p --preserve-dates Çıktıya deÄŸiÅŸim/eriÅŸim zaman damgalarını kopyalar\n" +" -R --remove-section= Çıktıdan bölümünü çıkarır\n" +" -s --strip-all Bütün sembol ve yer deÄŸiÅŸtirme bilgisini siler\n" +" -g -S --strip-debug Bütün hata ayıklama sembollerini siler\n" +" --strip-unneeded Yer deÄŸiÅŸtirmeler için gerekmeyen bütün sembolleri siler\n" +" -N --strip-symbol= sembolünü kopyalamaz\n" +" -K --keep-symbol= Yalnızca sembolünü kopyalar\n" +" -x --discard-all Evrensel olmayan bütün sembolleri siler\n" +" -X --discard-locals Derleyici tarafından oluÅŸturulan bütün sembolleri siler\n" +" -v --verbose DeÄŸiÅŸtirilen tüm nesne dosyalarını listeler\n" +" -V --version Bu yazılımın sürüm bilgilerini gösterir\n" +" -h --help Bu çıktıyı gösterir\n" +" -o Sembolleri silinmiÅŸ çıktıyı ya yerleÅŸtirir\n" -#: objcopy.c:504 +#: objcopy.c:506 #, c-format msgid "unrecognized section flag `%s'" -msgstr "bilinmeyen bölüm seçeneði `%s'" +msgstr "bilinmeyen bölüm seçeneÄŸi `%s'" -#: objcopy.c:505 +#: objcopy.c:507 #, c-format msgid "supported flags: %s" -msgstr "desteklenen seçenekler: %s" +msgstr "desteklenen seçenekler: %s" -#: objcopy.c:582 objcopy.c:2206 +#: objcopy.c:584 objcopy.c:2243 #, c-format msgid "cannot stat: %s: %s" -msgstr "durumlanamadý: %s: %s" +msgstr "durumlanamadı: %s: %s" -#: objcopy.c:589 objcopy.c:2224 +#: objcopy.c:591 objcopy.c:2261 #, c-format msgid "cannot open: %s: %s" -msgstr "açýlamadý: %s: %s" +msgstr "açılamadı: %s: %s" -#: objcopy.c:592 objcopy.c:2228 +#: objcopy.c:594 objcopy.c:2265 #, c-format msgid "%s: fread failed" -msgstr "%s: fread baþarýsýz" +msgstr "%s: fread baÅŸarısız" -#: objcopy.c:665 +#: objcopy.c:667 #, c-format msgid "Ignoring rubbish found on line %d of %s" -msgstr "%2$s içinde %1$d satýrýnda bulunan bozukluk yoksayýldý" +msgstr "%2$s içinde %1$d satırında bulunan bozukluk yoksayıldı" -#: objcopy.c:886 +#: objcopy.c:888 #, c-format msgid "%s: Multiple redefinition of symbol \"%s\"" -msgstr "%s: \"%s\" sembolü tekrar tanýmlanmýþ" +msgstr "%s: \"%s\" sembolü tekrar tanımlanmış" -#: objcopy.c:891 +#: objcopy.c:893 #, c-format msgid "%s: Symbol \"%s\" is target of more than one redefinition" -msgstr "%s: \"%s\" sembolü birden fazla yeniden tanýmlamanýn hedefi" +msgstr "%s: \"%s\" sembolü birden fazla yeniden tanımlamanın hedefi" -#: objcopy.c:943 +#: objcopy.c:945 msgid "Unable to change endianness of input file(s)" -msgstr "Girdi dosyanýn küçük/büyük sonluluðu deðiþtirilemedi" +msgstr "Girdi dosyanın küçük/büyük sonluluÄŸu deÄŸiÅŸtirilemedi" -#: objcopy.c:951 +#: objcopy.c:953 #, c-format msgid "copy from %s(%s) to %s(%s)\n" msgstr "%s(%s)'dan %s(%s)'a kopyalar\n" -#: objcopy.c:975 +#: objcopy.c:977 #, c-format msgid "Warning: Output file cannot represent architecture %s" -msgstr "Uyarý: Çýktý dosyasý %s mimarisini temsil edemez" +msgstr "Uyarı: Çıktı dosyası %s mimarisini temsil edemez" -#: objcopy.c:1002 +#: objcopy.c:1004 #, c-format msgid "can't create section `%s': %s" -msgstr "`%s' bölümü oluþturulamadý: %s" +msgstr "`%s' bölümü oluÅŸturulamadı: %s" -#: objcopy.c:1088 +#: objcopy.c:1090 #, c-format msgid "Can't fill gap after %s: %s" -msgstr "%s'den sonraki boþluk doldurulamadý: %s" +msgstr "%s'den sonraki boÅŸluk doldurulamadı: %s" -#: objcopy.c:1113 +#: objcopy.c:1115 #, c-format msgid "Can't add padding to %s: %s" msgstr "%s'ye dolgu eklenemedi: %s" -#: objcopy.c:1252 +#: objcopy.c:1254 #, c-format msgid "%s: error copying private BFD data: %s" -msgstr "%s: özel BFD verisi kopyalanýrken hata: %s" +msgstr "%s: özel BFD verisi kopyalanırken hata: %s" -#: objcopy.c:1265 +#: objcopy.c:1267 msgid "unknown alternate machine code, ignored" -msgstr "bilinmeyen alternatif makina kodu, yoksayýldý" +msgstr "bilinmeyen alternatif makina kodu, yoksayıldı" -#: objcopy.c:1295 +#: objcopy.c:1300 objcopy.c:1330 #, c-format msgid "cannot mkdir %s for archive copying (error: %s)" -msgstr "arþiv kopyalamasý için mkdir %s baþarýlý olamadý (hata: %s)" +msgstr "arÅŸiv kopyalaması için mkdir %s baÅŸarılı olamadı (hata: %s)" -#: objcopy.c:1466 +#: objcopy.c:1497 #, c-format msgid "Multiple renames of section %s" -msgstr "%s bölümünde birden fazla yeniden isimleme" +msgstr "%s bölümünde birden fazla yeniden isimleme" -#: objcopy.c:1550 +#: objcopy.c:1581 msgid "making" -msgstr "oluþturuluyor" +msgstr "oluÅŸturuluyor" -#: objcopy.c:1559 +#: objcopy.c:1590 msgid "size" msgstr "boyut" -#: objcopy.c:1573 +#: objcopy.c:1604 msgid "vma" msgstr "vma" -#: objcopy.c:1599 +#: objcopy.c:1630 msgid "alignment" msgstr "hizalama" -#: objcopy.c:1607 +#: objcopy.c:1638 msgid "flags" -msgstr "seçenekler" +msgstr "seçenekler" -#: objcopy.c:1624 +#: objcopy.c:1655 msgid "private data" -msgstr "özel veri" +msgstr "özel veri" -#: objcopy.c:1632 +#: objcopy.c:1663 #, c-format msgid "%s: section `%s': error in %s: %s" -msgstr "%s: bölüm `%s': %s'da hata: %s" +msgstr "%s: bölüm `%s': %s'da hata: %s" -#: objcopy.c:1910 +#: objcopy.c:1946 #, c-format msgid "%s: can't create debugging section: %s" -msgstr "%s: hata ayýklama bölümü oluþturulamadý: %s" +msgstr "%s: hata ayıklama bölümü oluÅŸturulamadı: %s" -#: objcopy.c:1925 +#: objcopy.c:1961 #, c-format msgid "%s: can't set debugging section contents: %s" -msgstr "%s: hata ayýklama bölüm içeriði atanamadý: %s" +msgstr "%s: hata ayıklama bölüm içeriÄŸi atanamadı: %s" -#: objcopy.c:1934 +#: objcopy.c:1970 #, c-format msgid "%s: don't know how to write debugging information for %s" -msgstr "%s: %s için hata ayýklama bilgisinin nasýl yazýlacaðý bilinmiyor" +msgstr "%s: %s için hata ayıklama bilgisinin nasıl yazılacağı bilinmiyor" -#: objcopy.c:2041 +#: objcopy.c:2078 #, c-format msgid "%s: cannot stat: %s" -msgstr "%s: durumlanamadý: %s" +msgstr "%s: durumlanamadı: %s" -#: objcopy.c:2092 +#: objcopy.c:2129 msgid "byte number must be non-negative" -msgstr "bayt numarasý negatif olmamalý" +msgstr "bayt numarası negatif olmamalı" -#: objcopy.c:2102 +#: objcopy.c:2139 msgid "interleave must be positive" -msgstr "serpiþtirme pozitif olmalý" +msgstr "serpiÅŸtirme pozitif olmalı" -#: objcopy.c:2122 objcopy.c:2130 +#: objcopy.c:2159 objcopy.c:2167 #, c-format msgid "%s both copied and removed" -msgstr "%s hem kopyalandý hem silindi" +msgstr "%s hem kopyalandı hem silindi" -#: objcopy.c:2203 objcopy.c:2273 objcopy.c:2373 objcopy.c:2400 objcopy.c:2424 -#: objcopy.c:2428 objcopy.c:2448 +#: objcopy.c:2240 objcopy.c:2310 objcopy.c:2410 objcopy.c:2437 objcopy.c:2461 +#: objcopy.c:2465 objcopy.c:2485 #, c-format msgid "bad format for %s" -msgstr "%s için hatalý biçem" +msgstr "%s için hatalı biçem" -#: objcopy.c:2342 +#: objcopy.c:2379 #, c-format msgid "Warning: truncating gap-fill from 0x%s to 0x%x" -msgstr "Uyarý: dolgu, 0x%s'dan 0x%x'ya kýrpýldý" +msgstr "Uyarı: dolgu, 0x%s'dan 0x%x'ya kırpıldı" -#: objcopy.c:2494 +#: objcopy.c:2531 msgid "alternate machine code index must be positive" -msgstr "alternatif makina kodu indeksi pozitif olmalý" +msgstr "alternatif makina kodu indeksi pozitif olmalı" -#: objcopy.c:2512 +#: objcopy.c:2550 msgid "byte number must be less than interleave" -msgstr "bayt numarasý serpiþtirmeden daha küçük olmalý" +msgstr "bayt numarası serpiÅŸtirmeden daha küçük olmalı" -#: objcopy.c:2539 +#: objcopy.c:2577 #, c-format msgid "architecture %s unknown" msgstr "%s platformu bilinmiyor" -#: objcopy.c:2543 +#: objcopy.c:2581 msgid "Warning: input target 'binary' required for binary architecture parameter." -msgstr "Uyarý: ikilik platform parametresi için ikilik (`binary') girdi hedefi gerekli." +msgstr "Uyarı: ikilik platform parametresi için ikilik (`binary') girdi hedefi gerekli." -#: objcopy.c:2544 +#: objcopy.c:2582 #, c-format msgid " Argument %s ignored" -msgstr " %s argümaný yoksayýldý" +msgstr " %s argümanı yoksayıldı" -#: objcopy.c:2550 +#: objcopy.c:2588 #, c-format msgid "Cannot stat: %s: %s" -msgstr "Durumlanamadý: %s: %s" +msgstr "Durumlanamadı: %s: %s" -#: objcopy.c:2590 objcopy.c:2604 +#: objcopy.c:2628 objcopy.c:2642 #, c-format msgid "%s %s%c0x%s never used" -msgstr "%s %s%c0x%s hiç kullanýlmadý" - -#: objdump.c:164 -#, c-format -msgid "Usage: %s OPTION... FILE...\n" -msgstr "Kullaným: %s SEÇENEK... DOSYA...\n" +msgstr "%s %s%c0x%s hiç kullanılmadı" #: objdump.c:165 -msgid "Display information from object FILE.\n" -msgstr "Nesne DOSYA'sýndan bilgi gösterir.\n" +#, c-format +msgid "Usage: %s \n" +msgstr "Kullanım: %s \n" #: objdump.c:166 -msgid "\n At least one of the following switches must be given:\n" -msgstr "\n En azýndan aþaðýdaki seçeneklerin biri verilmelidir:\n" +msgid " Display information from object .\n" +msgstr "Nesne 'sından bilgi gösterir.\n" #: objdump.c:167 +msgid " At least one of the following switches must be given:\n" +msgstr " En azından aÅŸağıdaki seçeneklerin biri verilmelidir:\n" + +#: objdump.c:168 msgid "" " -a, --archive-headers Display archive header information\n" " -f, --file-headers Display the contents of the overall file header\n" @@ -1913,35 +2068,39 @@ msgid "" " -T, --dynamic-syms Display the contents of the dynamic symbol table\n" " -r, --reloc Display the relocation entries in the file\n" " -R, --dynamic-reloc Display the dynamic relocation entries in the file\n" -" -V, --version Display this program's version number\n" +" -v, --version Display this program's version number\n" " -i, --info List object formats and architectures supported\n" " -H, --help Display this information\n" msgstr "" -" -a, --archive-headers Arþiv baþlýk bilgilerini gösterir\n" -" -f, --file-headers Dosya baþlýk bilgilerini gösterir\n" -" -p, --private-headers Nesne biçemine özgü dosya baþlýk bilgilerini gösterir\n" -" -h, --[section-]headers Bölüm baþlýklarýný gösterir\n" -" -x, --all-headers Bütün baþlýklarý gösterir\n" -" -d, --disassemble Uygulama bölümlerinin üretici içeriðini gösterir\n" -" -D, --disassemble-all Bütün bölümlerin üretici içeriklerini gösterir\n" -" -S, --source Üretici içerikleri ile kaynak kodunu bir arada gösterir\n" -" -s, --full-contents Ýstenen bütün bölümlerin bütün içeriðini gösterir\n" -" -g, --debugging Nesne dosyasýndaki hata ayýklama bilgilerini gösterir\n" -" -G, --stabs Dosyadaki STABS bilgisini (ham hali ile) gösterir\n" -" -t, --syms Sembol tablolarýnýn içeriðini gösterir\n" -" -T, --dynamic-syms Dinamik sembol tablolarýnýn içeriðini gösterir\n" -" -r, --reloc Dosyadaki yer deðiþtirme girdilerini gösterir\n" -" -R, --dynamic-reloc Dosyadaki dinamik yer deðiþtirme bilgilerini gösterir\n" -" -V, --version Bu yazýlýmýn sürüm bilgilerini gösterir\n" -" -i, --info Desteklenen biçem ve mimarileri gösterir\n" -" -H, --help Bu bilgiyi gösterir\n" - -#: objdump.c:189 -msgid "\n The following switches are optional:\n" -msgstr "\n Aþaðýdaki seçenekler isteðe baðlý:\n" +" -a, --archive-headers ArÅŸiv baÅŸlık bilgilerini gösterir\n" +" -f, --file-headers Dosya baÅŸlık bilgilerini gösterir\n" +" -p, --private-headers Nesne biçemine özgü dosya baÅŸlık bilgilerini gösterir\n" +" -h, --[section-]headers Bölüm baÅŸlıklarını gösterir\n" +" -x, --all-headers Bütün baÅŸlıkları gösterir\n" +" -d, --disassemble Uygulama bölümlerinin üretici içeriÄŸini gösterir\n" +" -D, --disassemble-all Bütün bölümlerin üretici içeriklerini gösterir\n" +" -S, --source Ãœretici içerikleri ile kaynak kodunu bir arada gösterir\n" +" -s, --full-contents Ä°stenen bütün bölümlerin bütün içeriÄŸini gösterir\n" +" -g, --debugging Nesne dosyasındaki hata ayıklama bilgilerini gösterir\n" +" -G, --stabs Dosyadaki STABS bilgisini (ham hali ile) gösterir\n" +" -t, --syms Sembol tablolarının içeriÄŸini gösterir\n" +" -T, --dynamic-syms Dinamik sembol tablolarının içeriÄŸini gösterir\n" +" -r, --reloc Dosyadaki yer deÄŸiÅŸtirme girdilerini gösterir\n" +" -R, --dynamic-reloc Dosyadaki dinamik yer deÄŸiÅŸtirme bilgilerini gösterir\n" +" -V, --version Bu yazılımın sürüm bilgilerini gösterir\n" +" -i, --info Desteklenen biçem ve mimarileri gösterir\n" +" -H, --help Bu bilgiyi gösterir\n" #: objdump.c:190 msgid "" +"\n" +" The following switches are optional:\n" +msgstr "" +"\n" +" AÅŸağıdaki seçenekler isteÄŸe baÄŸlı:\n" + +#: objdump.c:191 +msgid "" " -b, --target=BFDNAME Specify the target object format as BFDNAME\n" " -m, --architecture=MACHINE Specify the target architecture as MACHINE\n" " -j, --section=NAME Only display information for section NAME\n" @@ -1962,165 +2121,181 @@ msgid "" " --adjust-vma=OFFSET Add OFFSET to all displayed section addresses\n" "\n" msgstr "" -" -b, --target=BFD_ADI Hedef nesne biçemini BFD_ADI olarak belirtir\n" -" -m, --architecture=MAKÝNA Hedef mimariyi MAKÝNA olarak belirtir\n" -" -j, --section=ÝSÝM Yalnýzca ÝSÝM bölümü için bilgi gösterir\n" -" -M, --disassembler-options=SEÇ Karþýt-çeviriciye metin SEÇeneklerini geçirir\n" -" -EB --endian=big Karþýt-çevirim esnasýnda big-endian biçemini varsayar\n" -" -EL --endian=little Karþýt-çevirim esnasýnda little-endian biçemini varsayar\n" -" --file-start-context Dosyanýn baþlangýcýndan itibaren baðlamý içerir (-S ile)\n" -" -l, --line-numbers Çýktýda dosya isimleri ve satýr numaralarý gösterir\n" -" -C, --demangle[=TARZ] Karýþtýrýlmýþ/iþlenmiþ sembol isimlerini çözümler\n" -" Tarz, eðer belirtilmiþse, `auto', 'gnu',\n" +" -b, --target=BFD_ADI Hedef nesne biçemini BFD_ADI olarak belirtir\n" +" -m, --architecture=MAKÄ°NA Hedef mimariyi MAKÄ°NA olarak belirtir\n" +" -j, --section=Ä°SÄ°M Yalnızca Ä°SÄ°M bölümü için bilgi gösterir\n" +" -M, --disassembler-options=SEÇ Karşıt-çeviriciye metin SEÇeneklerini geçirir\n" +" -EB --endian=big Karşıt-çevirim esnasında big-endian biçemini varsayar\n" +" -EL --endian=little Karşıt-çevirim esnasında little-endian biçemini varsayar\n" +" --file-start-context Dosyanın baÅŸlangıcından itibaren baÄŸlamı içerir (-S ile)\n" +" -l, --line-numbers Çıktıda dosya isimleri ve satır numaraları gösterir\n" +" -C, --demangle[=TARZ] Karıştırılmış/iÅŸlenmiÅŸ sembol isimlerini çözümler\n" +" Tarz, eÄŸer belirtilmiÅŸse, `auto', 'gnu',\n" " 'lucid', 'arm', 'hp', 'edg', veya 'gnu-new-abi' olabilir\n" -" -w, --wide Çýktýyý 80 sütundan daha geniþ olarak biçemler\n" -" -z, --disassemble-zeroes Karþýt-çevirim esnasýnda sýfýr bloklarýný atlamaz\n" -" --start-address=ADRES Yalnýzca adresi >= ADRES olan verileri iþler\n" -" --stop-address=ADRES Yalnýzca adresi <= ADRES olan verileri iþler\n" -" --prefix-addresses Tam adresi karþýt çevirim ile birlikte yazdýrýr\n" -" --[no-]show-raw-insn Onaltýlýk bilgi ile sembolik karþýt-çevrimi birlikte yazdýrýr\n" -" --adjust-vma=BASAMAK Bütün gösterilen bölüm adreslerine BASAMAK ekler\n" +" -w, --wide Çıktıyı 80 sütundan daha geniÅŸ olarak biçemler\n" +" -z, --disassemble-zeroes Karşıt-çevirim esnasında sıfır bloklarını atlamaz\n" +" --start-address=ADRES Yalnızca adresi >= ADRES olan verileri iÅŸler\n" +" --stop-address=ADRES Yalnızca adresi <= ADRES olan verileri iÅŸler\n" +" --prefix-addresses Tam adresi karşıt çevirim ile birlikte yazdırır\n" +" --[no-]show-raw-insn Onaltılık bilgi ile sembolik karşıt-çevrimi birlikte yazdırır\n" +" --adjust-vma=BASAMAK Bütün gösterilen bölüm adreslerine BASAMAK ekler\n" "\n" -#: objdump.c:359 +#: objdump.c:358 msgid "Sections:\n" -msgstr "Bölümler:\n" +msgstr "Bölümler:\n" -#: objdump.c:362 +#: objdump.c:361 objdump.c:365 msgid "Idx Name Size VMA LMA File off Algn" -msgstr "Idx Adý Boy VMA LMA Dosya of Hiza" +msgstr "Idx Adı Boy VMA LMA Dosya of Hiza" -#: objdump.c:364 +#: objdump.c:367 msgid "Idx Name Size VMA LMA File off Algn" -msgstr "Idx Adý Boy VMA LMA Dosya of Hiza" +msgstr "Idx Adı Boy VMA LMA Dosya of Hiza" -#: objdump.c:368 +#: objdump.c:371 msgid " Flags" -msgstr " Seçenekler" +msgstr " Seçenekler" -#: objdump.c:418 +#: objdump.c:419 #, c-format msgid "%s: not a dynamic object" -msgstr "%s: dinamik nesne deðil" +msgstr "%s: dinamik nesne deÄŸil" -#: objdump.c:434 +#: objdump.c:433 #, c-format msgid "%s: No dynamic symbols" msgstr "%s: Dinamik sembol yok" -#: objdump.c:1124 +#: objdump.c:1114 msgid "Out of virtual memory" -msgstr "Sanal bellek tükendi" +msgstr "Sanal bellek tükendi" -#: objdump.c:1553 +#: objdump.c:1543 #, c-format msgid "Can't use supplied machine %s" -msgstr "Verilen makina %s kullanýlamadý" +msgstr "Verilen makina %s kullanılamadı" -#: objdump.c:1571 +#: objdump.c:1561 #, c-format msgid "Can't disassemble for architecture %s\n" -msgstr "%s mimarisi için karþýt çevirim yapýlamadý\n" +msgstr "%s mimarisi için karşıt çevirim yapılamadı\n" -#: objdump.c:1653 +#: objdump.c:1643 #, c-format msgid "Disassembly of section %s:\n" -msgstr "%s bölümünün karþýt çevrimi:\n" +msgstr "%s bölümünün karşıt çevrimi:\n" -#: objdump.c:1828 +#: objdump.c:1818 #, c-format -msgid "No %s section present\n\n" -msgstr "%s bölümü yok\n\n" +msgid "" +"No %s section present\n" +"\n" +msgstr "" +"%s bölümü yok\n" +"\n" -#: objdump.c:1835 +#: objdump.c:1825 #, c-format msgid "%s has no %s section" -msgstr "%s %s bölümü yok" +msgstr "%s %s bölümü yok" -#: objdump.c:1849 +#: objdump.c:1839 #, c-format msgid "Reading %s section of %s failed: %s" -msgstr "%2$s'nin %1$s bölümünün okunmasý baþarýsýz: %3$s" +msgstr "%2$s'nin %1$s bölümünün okunması baÅŸarısız: %3$s" -#: objdump.c:1861 +#: objdump.c:1851 #, c-format msgid "Reading %s section of %s failed: %s\n" -msgstr "%2$s'nin %1$s bölümünün okunmasý baþarýsýz: %3$s\n" +msgstr "%2$s'nin %1$s bölümünün okunması baÅŸarısız: %3$s\n" -#: objdump.c:1904 +#: objdump.c:1894 #, c-format -msgid "Contents of %s section:\n\n" -msgstr "%s bölümünün içeriði:\n\n" +msgid "" +"Contents of %s section:\n" +"\n" +msgstr "" +"%s bölümünün içeriÄŸi:\n" +"\n" -#: objdump.c:2004 +#: objdump.c:1994 #, c-format msgid "architecture: %s, " msgstr "mimari: %s," -#: objdump.c:2007 +#: objdump.c:1997 #, c-format msgid "flags 0x%08x:\n" -msgstr "seçenekler 0x%08x:\n" +msgstr "seçenekler 0x%08x:\n" -#: objdump.c:2020 -msgid "\nstart address 0x" -msgstr "\nbaþlangýç adresi 0x" +#: objdump.c:2010 +msgid "" +"\n" +"start address 0x" +msgstr "" +"\n" +"baÅŸlangıç adresi 0x" -#: objdump.c:2052 +#: objdump.c:2042 #, c-format -msgid "\n%s: file format %s\n" -msgstr "\n%s: %s dosya biçemi\n" +msgid "" +"\n" +"%s: file format %s\n" +msgstr "" +"\n" +"%s: %s dosya biçemi\n" -#: objdump.c:2094 +#: objdump.c:2084 #, c-format msgid "%s: printing debugging information failed" -msgstr "%s: hata ayýklama bilgisinin yazdýrýlmasý baþarýsýz" +msgstr "%s: hata ayıklama bilgisinin yazdırılması baÅŸarısız" -#: objdump.c:2171 +#: objdump.c:2161 #, c-format msgid "In archive %s:\n" -msgstr "%s arþivi içinde:\n" +msgstr "%s arÅŸivi içinde:\n" -#: objdump.c:2223 +#: objdump.c:2213 #, c-format msgid "Contents of section %s:\n" -msgstr "%s bölümünün içeriði:\n" +msgstr "%s bölümünün içeriÄŸi:\n" -#: objdump.c:2736 +#: objdump.c:2718 #, c-format msgid "BFD header file version %s\n" -msgstr "BFD baþlýk dosyasý sürümü %s\n" +msgstr "BFD baÅŸlık dosyası sürümü %s\n" -#: objdump.c:2825 +#: objdump.c:2807 msgid "unrecognized -E option" -msgstr "tanýnmayan -E seçeneði" +msgstr "tanınmayan -E seçeneÄŸi" -#: objdump.c:2836 +#: objdump.c:2818 #, c-format msgid "unrecognized --endian type `%s'" -msgstr "tanýnmayan --endian tipi `%s'" +msgstr "tanınmayan --endian tipi `%s'" -#: rdcoff.c:205 +#: rdcoff.c:204 #, c-format msgid "parse_coff_type: Bad type code 0x%x" -msgstr "parse_coff_type: Kötü tip kodu 0x%x" +msgstr "parse_coff_type: Kötü tip kodu 0x%x" -#: rdcoff.c:423 rdcoff.c:531 rdcoff.c:730 +#: rdcoff.c:422 rdcoff.c:530 rdcoff.c:729 #, c-format msgid "bfd_coff_get_syment failed: %s" -msgstr "bfd_coff_get_syment baþarýsýz: %s" +msgstr "bfd_coff_get_syment baÅŸarısız: %s" -#: rdcoff.c:439 rdcoff.c:750 +#: rdcoff.c:438 rdcoff.c:749 #, c-format msgid "bfd_coff_get_auxent failed: %s" -msgstr "bfd_coff_get_auxent baþarýsýz: %s" +msgstr "bfd_coff_get_auxent baÅŸarısız: %s" -#: rdcoff.c:817 +#: rdcoff.c:816 #, c-format msgid "%ld: .bf without preceding function" -msgstr "%ld: öncesinde iþlev olmadan .bf" +msgstr "%ld: öncesinde iÅŸlev olmadan .bf" -#: rdcoff.c:867 +#: rdcoff.c:866 #, c-format msgid "%ld: unexpected .ef\n" msgstr "%ld: beklenmeyen .ef\n" @@ -2128,1826 +2303,2056 @@ msgstr "%ld: beklenmeyen .ef\n" #: rddbg.c:87 #, c-format msgid "%s: no recognized debugging information" -msgstr "%s: tanýnan hata ayýklama bilgisi yok" +msgstr "%s: tanınan hata ayıklama bilgisi yok" #: rddbg.c:410 msgid "Last stabs entries before error:\n" -msgstr "Hata öncesi son stabs girdileri:\n" +msgstr "Hata öncesi son stabs girdileri:\n" -#: readelf.c:318 +#: readelf.c:328 #, c-format msgid "%s: Error: " msgstr "%s: Hata: " -#: readelf.c:329 +#: readelf.c:339 #, c-format msgid "%s: Warning: " -msgstr "%s: Uyarý: " +msgstr "%s: Uyarı: " -#: readelf.c:351 +#: readelf.c:361 #, c-format msgid "Unable to seek to %x for %s\n" -msgstr "%2$s için %1$x'e kadar arama yapýlamadý\n" +msgstr "%2$s için %1$x'e kadar arama yapılamadı\n" -#: readelf.c:362 +#: readelf.c:372 #, c-format msgid "Out of memory allocating %d bytes for %s\n" -msgstr "%2$s için %1$d bayt ayrýlýrken bellek tükendi\n" +msgstr "%2$s için %1$d bayt ayrılırken bellek tükendi\n" -#: readelf.c:370 +#: readelf.c:380 #, c-format msgid "Unable to read in %d bytes of %s\n" -msgstr "%2$s'in %1$d baytý okunamadý\n" +msgstr "%2$s'in %1$d baytı okunamadı\n" -#: readelf.c:423 readelf.c:581 +#: readelf.c:433 readelf.c:591 #, c-format msgid "Unhandled data length: %d\n" -msgstr "Desteklenmeyen veri uzunluðu: %d\n" +msgstr "Desteklenmeyen veri uzunluÄŸu: %d\n" -#: readelf.c:660 +#: readelf.c:675 msgid "Don't know about relocations on this machine architecture\n" -msgstr "Bu makina mimarisi üzerinde yer deðiþtirmeler konusunda bilgi yok\n" +msgstr "Bu makina mimarisi üzerinde yer deÄŸiÅŸtirmeler konusunda bilgi yok\n" -#: readelf.c:682 readelf.c:711 readelf.c:757 readelf.c:784 +#: readelf.c:697 readelf.c:726 readelf.c:772 readelf.c:799 msgid "relocs" -msgstr "yerdeðiþimler" +msgstr "yerdeÄŸiÅŸimler" -#: readelf.c:693 readelf.c:722 readelf.c:767 readelf.c:794 +#: readelf.c:708 readelf.c:737 readelf.c:782 readelf.c:809 msgid "out of memory parsing relocs" -msgstr "yer deðiþtirmeleri tararken bellek tükendi" +msgstr "yer deÄŸiÅŸtirmeleri tararken bellek tükendi" + +#: readelf.c:861 +msgid " Offset Info Type Sym. Value Symbol's Name + Addend\n" +msgstr " Görece Bilgi Tür Sembol DeÄŸeri Sembol Adı + Sonekleme\n" + +#: readelf.c:863 +msgid " Offset Info Type Sym.Value Sym. Name + Addend\n" +msgstr " Görece Bilgi Tür Sembol DeÄŸeri Sembol Adı + Sonekleme\n" -#: readelf.c:845 -msgid " Offset Info Type Symbol's Value Symbol's Name Addend\n" -msgstr " Görece Bilgi Tür Sembol Deðeri Sembol Adý Sonekleme\n" +#: readelf.c:868 +msgid " Offset Info Type Sym. Value Symbol's Name\n" +msgstr " Görece Bilgi Tür Sembol DeÄŸeri Sembol Adı\n" -#: readelf.c:848 -msgid " Offset Info Type Symbol's Value Symbol's Name\n" -msgstr " Görece Bilgi Tür Sembol Deðeri Sembol Adý\n" +#: readelf.c:870 +msgid " Offset Info Type Sym.Value Sym. Name\n" +msgstr " Görece Bilgi Tür Sembol DeÄŸeri Sembol Adı\n" -#: readelf.c:854 -msgid " Offset Info Type Symbol's Value Symbol's Name Addend\n" -msgstr " Görece Bilgi Tür Sembol Deðeri Sembol Adý Sonekleme\n" +#: readelf.c:878 +msgid " Offset Info Type Symbol's Value Symbol's Name + Addend\n" +msgstr " Görece Bilgi Tür Sembol DeÄŸeri Sembol Adı + Sonek\n" -#: readelf.c:857 -msgid " Offset Info Type Symbol's Value Symbol's Name\n" -msgstr " Görece Bilgi Tür Sembol Deðeri Sembol Adý\n" +#: readelf.c:880 +msgid " Offset Info Type Sym. Value Sym. Name + Addend\n" +msgstr " Görece Bilgi Tür Sembol DeÄŸeri Sembol Adı + Sonekleme\n" -#: readelf.c:1061 readelf.c:1063 +#: readelf.c:885 +msgid " Offset Info Type Symbol's Value Symbol's Name\n" +msgstr " Görece Bilgi Tür Sembol DeÄŸeri Sembol Adı\n" + +#: readelf.c:887 +msgid " Offset Info Type Sym. Value Sym. Name\n" +msgstr " Görece Bilgi Tür Sembol DeÄŸeri Sembol Adı\n" + +#: readelf.c:1134 readelf.c:1136 readelf.c:1184 readelf.c:1186 readelf.c:1195 +#: readelf.c:1197 #, c-format -msgid "unrecognised: %-7lx" +msgid "unrecognized: %-7lx" msgstr "bilinmeyen: %-7lx" -#: readelf.c:1085 +#: readelf.c:1158 #, c-format msgid "" msgstr "" -#: readelf.c:1315 +#: readelf.c:1423 #, c-format msgid "Processor Specific: %lx" -msgstr "Ýþlemciye Özel: %lx" +msgstr "Ä°ÅŸlemciye Özel: %lx" -#: readelf.c:1334 +#: readelf.c:1442 #, c-format msgid "Operating System specific: %lx" -msgstr "Ýþletim Sistemine Özel: %lx" +msgstr "Ä°ÅŸletim Sistemine Özel: %lx" -#: readelf.c:1337 readelf.c:1961 +#: readelf.c:1445 readelf.c:2086 #, c-format msgid ": %lx" msgstr ": %lx" -#: readelf.c:1351 +#: readelf.c:1459 msgid "NONE (None)" -msgstr "HÝÇBÝRÝ (Hiçbiri)" +msgstr "HİÇBÄ°RÄ° (Hiçbiri)" -#: readelf.c:1352 +#: readelf.c:1460 msgid "REL (Relocatable file)" -msgstr "YER (Yer deðiþtirebilen dosya)" +msgstr "YER (Yer deÄŸiÅŸtirebilen dosya)" -#: readelf.c:1353 +#: readelf.c:1461 msgid "EXEC (Executable file)" -msgstr "UYGU (Uygulama dosyasý)" +msgstr "UYGU (Uygulama dosyası)" -#: readelf.c:1354 +#: readelf.c:1462 msgid "DYN (Shared object file)" -msgstr "DÝN (Paylaþýmlý nesne dosyasý)" +msgstr "DÄ°N (Paylaşımlı nesne dosyası)" -#: readelf.c:1355 +#: readelf.c:1463 msgid "CORE (Core file)" -msgstr "CORE (Core dosyasý)" +msgstr "CORE (Core dosyası)" -#: readelf.c:1359 +#: readelf.c:1467 #, c-format msgid "Processor Specific: (%x)" -msgstr "Ýþlemciye Özel: (%x)" +msgstr "Ä°ÅŸlemciye Özel: (%x)" -#: readelf.c:1361 +#: readelf.c:1469 #, c-format msgid "OS Specific: (%x)" -msgstr "Ýþletim Sistemine Özel: (%x)" +msgstr "Ä°ÅŸletim Sistemine Özel: (%x)" -#: readelf.c:1363 readelf.c:1460 readelf.c:2112 +#: readelf.c:1471 readelf.c:1573 readelf.c:2238 #, c-format msgid ": %x" msgstr ": %x" -#: readelf.c:1376 +#: readelf.c:1484 msgid "None" -msgstr "Hiçbiri" +msgstr "Hiçbiri" -#: readelf.c:2152 -msgid "Usage: readelf {options} elf-file(s)\n" -msgstr "Kullaným: readelf {seçenekler} elf-dosya(larý)\n" +#: readelf.c:2278 +msgid "Usage: readelf elf-file(s)\n" +msgstr "Kullanım: readelf elf-dosya(ları)\n" -#: readelf.c:2153 -msgid " Options are:\n" -msgstr " Seçenekler:\n" +#: readelf.c:2279 +msgid " Display information about the contents of ELF format files\n" +msgstr " ELF biçem dosyalarının içeriÄŸi hakkında bilgi gösterir\n" -#: readelf.c:2154 -msgid " -a or --all Equivalent to: -h -l -S -s -r -d -V -A -I\n" -msgstr " -a veya --all Buna eþit: -h -l -S -s -r -d -V -A -I\n" +#: readelf.c:2280 +msgid "" +" Options are:\n" +" -a --all Equivalent to: -h -l -S -s -r -d -V -A -I\n" +" -h --file-header Display the ELF file header\n" +" -l --program-headers Display the program headers\n" +" --segments An alias for --program-headers\n" +" -S --section-headers Display the sections' header\n" +" --sections An alias for --section-headers\n" +" -e --headers Equivalent to: -h -l -S\n" +" -s --syms Display the symbol table\n" +" --symbols An alias for --syms\n" +" -n --notes Display the core notes (if present)\n" +" -r --relocs Display the relocations (if present)\n" +" -u --unwind Display the unwind info (if present)\n" +" -d --dynamic Display the dynamic segment (if present)\n" +" -V --version-info Display the version sections (if present)\n" +" -A --arch-specific Display architecture specific information (if any).\n" +" -D --use-dynamic Use the dynamic section info when displaying symbols\n" +" -x --hex-dump= Dump the contents of section \n" +" -w --debug-dump[=line,=info,=abbrev,=pubnames,=ranges,=macro,=frames,=str,=loc]\n" +" Display the contents of DWARF2 debug sections\n" +msgstr "" +" Seçenekler:\n" +" -a --all -h -l -S -s -r -d -V -A -I ile aynı\n" +" -h --file-header ELF dosya baÅŸlığını gösterir\n" +" -l --program-headers Yazılım baÅŸlıklarını gösterir\n" +" --segments --program-headers ile aynı\n" +" -S --section-headers Bölüm baÅŸlıklarını gösterir\n" +" --sections --section-headers ile aynı\n" +" -e --headers -h -l -S ile aynı\n" +" -s --syms Sembol tablosunu gösterir\n" +" --symbols --syms ile aynı\n" +" -n --notes EÄŸer varsa, 'core' dosyasını gösterir\n" +" -r --relocs EÄŸer varsa, yerdeÄŸiÅŸimleri gösterir\n" +" -u --unwind EÄŸer varsa, geri dönüşümleri gösterir\n" +" -d --dynamic EÄŸer varsa, dinamik bölümleri gösterir\n" +" -V --version-info EÄŸer varsa, sürüm bölümlerini gösterir\n" +" -A --arch-specific EÄŸer varsa, platforma özgü bilgileri gösterir\n" +" -D --use-dynamic Sembolleri gösterirken dinamik bölümleri kullanır\n" +" -x --hex-dump= no'lu bölümün içeriÄŸini gösterir\n" +" -w --debug-dump[=line,=info,=abbrev,=pubnames,=ranges,=macro,=frames,=str,=loc]\n" +" DWARF2 hata ayıklama bölümlerinin içeriÄŸini gösterir\n" -#: readelf.c:2155 -msgid " -h or --file-header Display the ELF file header\n" -msgstr " -h veya --file-header ELF dosyasý baþlýðýný gösterir\n" +#: readelf.c:2301 +msgid "" +" -i --instruction-dump=\n" +" Disassemble the contents of section \n" +msgstr "" +" -i --instruction-dump=\n" +" bölümünün içeriÄŸini karşıt-çevirir\n" -#: readelf.c:2156 -msgid " -l or --program-headers or --segments\n" -msgstr " -l veya --program-headers veya --segments\n" +#: readelf.c:2305 +msgid "" +" -I --histogram Display histogram of bucket list lengths\n" +" -W --wide Allow output width to exceed 80 characters\n" +" -H --help Display this information\n" +" -v --version Display the version number of readelf\n" +msgstr "" +" -I --histogram Küme listesi uzunluklarının geçmiÅŸ grafiÄŸini gösterir\n" +" -W --wide Çıktı geniÅŸliÄŸinin 80 karakteri geçmesine izin verir\n" +" -H --help Bu bilgiyi gösterir\n" +" -v --version readelf'in sürüm no'sunu gösterir\n" -#: readelf.c:2157 -msgid " Display the program headers\n" -msgstr " Yazýlým baþlýklarýný gösterir\n" +#: readelf.c:2327 +msgid "Out of memory allocating dump request table." +msgstr "Döküm istek tablosu ayrılırken bellek tükendi." -#: readelf.c:2158 -msgid " -S or --section-headers or --sections\n" -msgstr " -S veya --section-headers veya --sections\n" +#: readelf.c:2491 +#, c-format +msgid "Unrecognized debug option '%s'\n" +msgstr "Tanınmayan hata ayıklama seçeneÄŸi '%s'\n" -#: readelf.c:2159 -msgid " Display the sections' header\n" -msgstr " Bölüm baþlýklarýný gösterir\n" +#: readelf.c:2519 +#, c-format +msgid "Invalid option '-%c'\n" +msgstr "Geçersiz seçenek '-%c'\n" -#: readelf.c:2160 -msgid " -e or --headers Equivalent to: -h -l -S\n" -msgstr " -e veya --headers Buna eþit: -h -l -S\n" - -#: readelf.c:2161 -msgid " -s or --syms or --symbols Display the symbol table\n" -msgstr " -s veya --syms veya --symbols Sembol tablosunu gösterir\n" - -#: readelf.c:2162 -msgid " -n or --notes Display the core notes (if present)\n" -msgstr " -n veya --notes (Eðer varsa) core notlarýný gösterir\n" - -#: readelf.c:2163 -msgid " -r or --relocs Display the relocations (if present)\n" -msgstr " -r veya --relocs (Eðer varsa) yer deðiþtirmeleri gösterir\n" - -#: readelf.c:2164 -msgid " -u or --unwind Display the unwind info (if present)\n" -msgstr " -u veya --unwind (Eðer varsa) geri alma bilgisini gösterir\n" - -#: readelf.c:2165 -msgid " -d or --dynamic Display the dynamic segment (if present)\n" -msgstr " -d veya --dynamic (Eðer varsa) dinamik bölümü gösterir\n" - -#: readelf.c:2166 -msgid " -V or --version-info Display the version sections (if present)\n" -msgstr " -V veya --version-info (Eðer varsa) sürüm bölümlerini gösterir\n" - -#: readelf.c:2167 -msgid " -A or --arch-specific Display architecture specific information (if any).\n" -msgstr " -A veya --arch-specific (Eðer varsa) mimariye özel bilgiyi gösterir.\n" - -#: readelf.c:2168 -msgid " -D or --use-dynamic Use the dynamic section info when displaying symbols\n" -msgstr " -D veya --use-dynamic Sembolleri gösterirken dinamik bölüm bilgisini kullanýr\n" - -#: readelf.c:2169 -msgid " -x or --hex-dump=\n" -msgstr " -x veya --hex-dump=\n" - -#: readelf.c:2170 -msgid " Dump the contents of section \n" -msgstr " bölümünün içeriðini gösterir\n" - -#: readelf.c:2171 -msgid " -w[liaprmfs] or --debug-dump[=line,=info,=abbrev,=pubnames,=ranges,=macro,=frames,=str]\n" -msgstr " -w[liaprmfs] veya --debug-dump[=line,=info,=abbrev,=pubnames,=ranges,=macro,=frames,=str]\n" - -#: readelf.c:2172 -msgid " Display the contents of DWARF2 debug sections\n" -msgstr " DWARF2 hata ayýklama bölümlerinin içeriðini gösterir\n" - -#: readelf.c:2174 -msgid " -i or --instruction-dump=\n" -msgstr " -i veya --instruction-dump=\n" - -#: readelf.c:2175 -msgid " Disassemble the contents of section \n" -msgstr " bölümünün içeriðini karþýt-çevirir\n" - -#: readelf.c:2177 -msgid " -I or --histogram Display histogram of bucket list lengths\n" -msgstr " -I veya --histogram Küme liste uzunluðu geçmiþ grafiðini gösterir\n" - -#: readelf.c:2178 -msgid " -v or --version Display the version number of readelf\n" -msgstr " -v veya --version readelf'in sürüm numarasýný gösterir\n" - -#: readelf.c:2179 -msgid " -W or --wide Don't split lines or truncate symbols to fit into 80 columns\n" -msgstr " -W veya --wide 80 sütuna sýðdýrmak için satýrlarý bölmez veya kesmez\n" - -#: readelf.c:2180 -msgid " -H or --help Display this information\n" -msgstr " -H veya --help Bu bilgiyi gösterir\n" - -#: readelf.c:2198 -msgid "Out of memory allocating dump request table." -msgstr "Döküm istek tablosu ayrýlýrken bellek tükendi." - -#: readelf.c:2357 -#, c-format -msgid "Unrecognised debug option '%s'\n" -msgstr "Tanýnmayan hata ayýklama seçeneði '%s'\n" - -#: readelf.c:2385 -#, c-format -msgid "Invalid option '-%c'\n" -msgstr "Geçersiz seçenek '-%c'\n" - -#: readelf.c:2398 +#: readelf.c:2532 msgid "Nothing to do.\n" -msgstr "Yapýlacak bir þey yok.\n" +msgstr "Yapılacak bir ÅŸey yok.\n" -#: readelf.c:2411 readelf.c:2428 readelf.c:4700 +#: readelf.c:2545 readelf.c:2562 readelf.c:4867 msgid "none" msgstr "yok" -#: readelf.c:2415 readelf.c:2432 readelf.c:2460 +#: readelf.c:2549 readelf.c:2566 readelf.c:2594 #, c-format msgid "" msgstr "" -#: readelf.c:2429 +#: readelf.c:2563 msgid "2's complement, little endian" msgstr "2's complement, little endian" -#: readelf.c:2430 +#: readelf.c:2564 msgid "2's complement, big endian" msgstr "2's complement, big endian" -#: readelf.c:2457 +#: readelf.c:2591 msgid "Standalone App" -msgstr "Tekbaþýna Uygulama" +msgstr "Tekbaşına Uygulama" -#: readelf.c:2475 +#: readelf.c:2609 msgid "Not an ELF file - it has the wrong magic bytes at the start\n" -msgstr "ELF dosyasý deðil - baþlangýçta yanlýþ sihirli baytlar var\n" +msgstr "ELF dosyası deÄŸil - baÅŸlangıçta yanlış sihirli baytlar var\n" -#: readelf.c:2483 +#: readelf.c:2617 msgid "ELF Header:\n" -msgstr "ELF Baþlýðý:\n" +msgstr "ELF BaÅŸlığı:\n" -#: readelf.c:2484 +#: readelf.c:2618 msgid " Magic: " msgstr " Sihir: " -#: readelf.c:2488 +#: readelf.c:2622 #, c-format msgid " Class: %s\n" -msgstr " Sýnýf: %s\n" +msgstr " Sınıf: %s\n" -#: readelf.c:2490 +#: readelf.c:2624 #, c-format msgid " Data: %s\n" msgstr " Veri: %s\n" -#: readelf.c:2492 +#: readelf.c:2626 #, c-format msgid " Version: %d %s\n" -msgstr " Sürüm: %d %s\n" +msgstr " Sürüm: %d %s\n" -#: readelf.c:2499 +#: readelf.c:2633 #, c-format msgid " OS/ABI: %s\n" msgstr " OS/ABI: %s\n" -#: readelf.c:2501 +#: readelf.c:2635 #, c-format msgid " ABI Version: %d\n" -msgstr " ABI Sürümü: %d\n" +msgstr " ABI Sürümü: %d\n" -#: readelf.c:2503 +#: readelf.c:2637 #, c-format msgid " Type: %s\n" msgstr " Tip: %s\n" -#: readelf.c:2505 +#: readelf.c:2639 #, c-format msgid " Machine: %s\n" msgstr " Makina: %s\n" -#: readelf.c:2507 +#: readelf.c:2641 #, c-format msgid " Version: 0x%lx\n" -msgstr " Sürüm: 0x%lx\n" +msgstr " Sürüm: 0x%lx\n" -#: readelf.c:2510 +#: readelf.c:2644 msgid " Entry point address: " -msgstr " Girdi noktasý adresi: " +msgstr " Girdi noktası adresi: " -#: readelf.c:2512 -msgid "\n Start of program headers: " -msgstr "\n Yazýlým baþlýklarý baþlangýcý: " +#: readelf.c:2646 +msgid "" +"\n" +" Start of program headers: " +msgstr "" +"\n" +" Yazılım baÅŸlıkları baÅŸlangıcı: " -#: readelf.c:2514 +#: readelf.c:2648 msgid "" " (bytes into file)\n" " Start of section headers: " msgstr "" -" (bayt dosya içinde)\n" -" Bölüm baþlýklarý baþlangýcý: " +" (bayt dosya içinde)\n" +" Bölüm baÅŸlıkları baÅŸlangıcı: " -#: readelf.c:2516 +#: readelf.c:2650 msgid " (bytes into file)\n" -msgstr " (bayt dosya içinde)\n" +msgstr " (bayt dosya içinde)\n" -#: readelf.c:2518 +#: readelf.c:2652 #, c-format msgid " Flags: 0x%lx%s\n" -msgstr " Seçenekler: 0x%lx%s\n" +msgstr " Seçenekler: 0x%lx%s\n" -#: readelf.c:2521 +#: readelf.c:2655 #, c-format msgid " Size of this header: %ld (bytes)\n" -msgstr " Bu baþlýðýn boyu: %ld (bayt)\n" +msgstr " Bu baÅŸlığın boyu: %ld (bayt)\n" -#: readelf.c:2523 +#: readelf.c:2657 #, c-format msgid " Size of program headers: %ld (bytes)\n" -msgstr " Yazýlým baþlýk boyu: %ld (bayt)\n" +msgstr " Yazılım baÅŸlık boyu: %ld (bayt)\n" -#: readelf.c:2525 +#: readelf.c:2659 #, c-format msgid " Number of program headers: %ld\n" -msgstr " Yazýlým baþlýk sayýsý: %ld\n" +msgstr " Yazılım baÅŸlık sayısı: %ld\n" -#: readelf.c:2527 +#: readelf.c:2661 #, c-format msgid " Size of section headers: %ld (bytes)\n" -msgstr " Bölüm baþlýk boyu: %ld (bayt)\n" +msgstr " Bölüm baÅŸlık boyu: %ld (bayt)\n" -#: readelf.c:2529 +#: readelf.c:2663 #, c-format msgid " Number of section headers: %ld" -msgstr " Bölüm baþlýklarý sayýsý: %ld" +msgstr " Bölüm baÅŸlıkları sayısı: %ld" -#: readelf.c:2534 +#: readelf.c:2668 #, c-format msgid " Section header string table index: %ld" -msgstr " Bölüm baþlýðý dizge tablo endeksi: %ld" +msgstr " Bölüm baÅŸlığı dizge tablo endeksi: %ld" -#: readelf.c:2568 readelf.c:2604 +#: readelf.c:2702 readelf.c:2738 msgid "program headers" -msgstr "Yazýlým Baþlýklarý" +msgstr "Yazılım BaÅŸlıkları" -#: readelf.c:2638 -msgid "\nThere are no program headers in this file.\n" -msgstr "\nBu dosyada yazýlým baþlýðý yok.\n" +#: readelf.c:2772 +msgid "" +"\n" +"There are no program headers in this file.\n" +msgstr "" +"\n" +"Bu dosyada yazılım baÅŸlığı yok.\n" -#: readelf.c:2644 +#: readelf.c:2778 #, c-format -msgid "\nElf file type is %s\n" -msgstr "\nElf dosya tipi: %s\n" +msgid "" +"\n" +"Elf file type is %s\n" +msgstr "" +"\n" +"Elf dosya tipi: %s\n" -#: readelf.c:2645 +#: readelf.c:2779 msgid "Entry point " -msgstr "Giriþ noktasý " +msgstr "GiriÅŸ noktası " -#: readelf.c:2647 +#: readelf.c:2781 #, c-format -msgid "\nThere are %d program headers, starting at offset " -msgstr "\n%d adet yazýlým baþlýðý var, göreli konumdan baþlanýyor" +msgid "" +"\n" +"There are %d program headers, starting at offset " +msgstr "" +"\n" +"%d adet yazılım baÅŸlığı var, göreli konumdan baÅŸlanıyor" -#: readelf.c:2658 readelf.c:2883 readelf.c:2929 readelf.c:2992 readelf.c:3059 -#: readelf.c:4087 readelf.c:4130 readelf.c:4310 readelf.c:5246 readelf.c:5260 -#: readelf.c:9246 readelf.c:9286 +#: readelf.c:2792 readelf.c:3019 readelf.c:3065 readelf.c:3128 readelf.c:3195 +#: readelf.c:4229 readelf.c:4272 readelf.c:4461 readelf.c:5414 readelf.c:5428 +#: readelf.c:9659 readelf.c:9699 msgid "Out of memory\n" -msgstr "Bellek tükendi\n" +msgstr "Bellek tükendi\n" -#: readelf.c:2676 -#, c-format -msgid "\nProgram Header%s:\n" -msgstr "\nYazýlým Baþlýðý%s:\n" +#: readelf.c:2810 readelf.c:2812 +msgid "" +"\n" +"Program Headers:\n" +msgstr "" +"\n" +"Yazılım BaÅŸlıkları:\n" -#: readelf.c:2680 +#: readelf.c:2816 msgid " Type Offset VirtAddr PhysAddr FileSiz MemSiz Flg Align\n" -msgstr " Tip Basamak SanalAdr GerçAdrs DosyaBoyBelBoy Seç Hiza\n" +msgstr " Tip Basamak SanalAdr GerçAdrs DosyaBoyBelBoy Seç Hiza\n" -#: readelf.c:2683 +#: readelf.c:2819 msgid " Type Offset VirtAddr PhysAddr FileSiz MemSiz Flg Align\n" -msgstr " Tür Görece SanalAdr GerçAdrs DosyaBoy BelBoy Seç Hiza\n" +msgstr " Tür Görece SanalAdr GerçAdrs DosyaBoy BelBoy Seç Hiza\n" -#: readelf.c:2687 +#: readelf.c:2823 msgid " Type Offset VirtAddr PhysAddr\n" -msgstr " Tip Basamak SanalAdres GerçekAdres\n" +msgstr " Tip Basamak SanalAdres GerçekAdres\n" -#: readelf.c:2689 +#: readelf.c:2825 msgid " FileSiz MemSiz Flags Align\n" -msgstr " DosyaBoyu BellekBoyu Seç Hiza\n" +msgstr " DosyaBoyu BellekBoyu Seç Hiza\n" -#: readelf.c:2789 +#: readelf.c:2925 msgid "more than one dynamic segment\n" -msgstr "bir dinamik parçadan fazla\n" +msgstr "bir dinamik parçadan fazla\n" -#: readelf.c:2797 +#: readelf.c:2933 msgid "Unable to find program interpreter name\n" -msgstr "Yazýlým yorumlayýcýsý adý bulunamadý\n" +msgstr "Yazılım yorumlayıcısı adı bulunamadı\n" -#: readelf.c:2804 +#: readelf.c:2940 #, c-format -msgid "\n [Requesting program interpreter: %s]" -msgstr "\n [Yazýlým yorumlayýcýsý isteniyor: %s]" +msgid "" +"\n" +" [Requesting program interpreter: %s]" +msgstr "" +"\n" +" [Yazılım yorumlayıcısı isteniyor: %s]" -#: readelf.c:2822 -msgid "\n Section to Segment mapping:\n" -msgstr "\n Bölümden parçaya eþleþme:\n" +#: readelf.c:2958 +msgid "" +"\n" +" Section to Segment mapping:\n" +msgstr "" +"\n" +" Bölümden parçaya eÅŸleÅŸme:\n" -#: readelf.c:2823 +#: readelf.c:2959 msgid " Segment Sections...\n" -msgstr " Parça Bölümleri...\n" +msgstr " Parça Bölümleri...\n" -#: readelf.c:2874 readelf.c:2920 +#: readelf.c:3010 readelf.c:3056 msgid "section headers" -msgstr "Bölüm Baþlýklarý" +msgstr "Bölüm BaÅŸlıkları" -#: readelf.c:2968 readelf.c:3035 +#: readelf.c:3104 readelf.c:3171 msgid "symbols" msgstr "semboller" -#: readelf.c:2979 readelf.c:3046 +#: readelf.c:3115 readelf.c:3182 msgid "symtab shndx" msgstr "symtab shndx" -#: readelf.c:3147 -msgid "\nThere are no sections in this file.\n" -msgstr "\nBu dosyada bölüm yok.\n" +#: readelf.c:3284 +msgid "" +"\n" +"There are no sections in this file.\n" +msgstr "" +"\n" +"Bu dosyada bölüm yok.\n" -#: readelf.c:3153 +#: readelf.c:3290 #, c-format msgid "There are %d section headers, starting at offset 0x%lx:\n" -msgstr "%d adet bölüm baþlýðý mevcut, göreli konum 0x%lx'dan baþlanýyor:\n" +msgstr "%d adet bölüm baÅŸlığı mevcut, göreli konum 0x%lx'dan baÅŸlanıyor:\n" -#: readelf.c:3170 readelf.c:3479 readelf.c:3826 readelf.c:5397 +#: readelf.c:3307 readelf.c:3621 readelf.c:3968 readelf.c:5565 msgid "string table" msgstr "dizge tablosu" -#: readelf.c:3191 +#: readelf.c:3328 msgid "File contains multiple dynamic symbol tables\n" msgstr "Dosyada birden fazla dinamik sembol tablosu var\n" -#: readelf.c:3203 +#: readelf.c:3340 msgid "File contains multiple dynamic string tables\n" msgstr "Dosyada birden fazla dinamik dizge tablosu var\n" -#: readelf.c:3209 +#: readelf.c:3346 msgid "dynamic strings" msgstr "dinamik dizgeler" -#: readelf.c:3215 +#: readelf.c:3352 msgid "File contains multiple symtab shndx tables\n" msgstr "Dosyada birden fazla symtab shndx tablosu var\n" -#: readelf.c:3250 -#, c-format -msgid "\nSection Header%s:\n" -msgstr "\nBölüm Baþlýðý%s:\n" +#: readelf.c:3390 +msgid "" +"\n" +"Section Headers:\n" +msgstr "" +"\n" +"Bölüm BaÅŸlıkları:\n" + +#: readelf.c:3392 +msgid "" +"\n" +"Section Header:\n" +msgstr "" +"\n" +"Bölüm BaÅŸlığı:\n" -#: readelf.c:3254 +#: readelf.c:3396 msgid " [Nr] Name Type Addr Off Size ES Flg Lk Inf Al\n" -msgstr " [Nr] Ýsim Tip Adres Bas Boy ES Seç Lk Inf Al\n" +msgstr " [Nr] Ä°sim Tip Adres Bas Boy ES Seç Lk Inf Al\n" -#: readelf.c:3257 +#: readelf.c:3399 msgid " [Nr] Name Type Address Off Size ES Flg Lk Inf Al\n" -msgstr " [Nr] Ýsim Tür Adres Görece Boy ES Seç Lk Inf Al\n" +msgstr " [Nr] Ä°sim Tür Adres Görece Boy ES Seç Lk Inf Al\n" -#: readelf.c:3260 +#: readelf.c:3402 msgid " [Nr] Name Type Address Offset\n" -msgstr " [Nr] Ýsim Tip Adres Basamak\n" +msgstr " [Nr] Ä°sim Tip Adres Basamak\n" -#: readelf.c:3261 +#: readelf.c:3403 msgid " Size EntSize Flags Link Info Align\n" -msgstr " Boy EntBoy Seç Bað Bilgi Hiza\n" +msgstr " Boy EntBoy Seç BaÄŸ Bilgi Hiza\n" -#: readelf.c:3356 +#: readelf.c:3498 msgid "" "Key to Flags:\n" " W (write), A (alloc), X (execute), M (merge), S (strings)\n" " I (info), L (link order), G (group), x (unknown)\n" " O (extra OS processing required) o (OS specific), p (processor specific)\n" msgstr "" -"Seçenekler:\n" -" W (yazdýrýr), A (ayýrýr), X (uygular), M (birleþtirir), S (dizgeler)\n" -" I (bilgi), L (bað sýrasý), G (grup), x (bilinmeyen)\n" -" O (daha fazla OS iþlemesi gerekli) o (OS'e özgü), p (iþlemciye özgü)\n" +"Seçenekler:\n" +" W (yazdırır), A (ayırır), X (uygular), M (birleÅŸtirir), S (dizgeler)\n" +" I (bilgi), L (baÄŸ sırası), G (grup), x (bilinmeyen)\n" +" O (daha fazla OS iÅŸlemesi gerekli) o (OS'e özgü), p (iÅŸlemciye özgü)\n" -#: readelf.c:3417 +#: readelf.c:3559 #, c-format -msgid "\nRelocation section at offset 0x%lx contains %ld bytes:\n" -msgstr "\nGöreli konum 0x%lx'da yer deðiþtirme bölümü %ld bayt içeriyor:\n" +msgid "" +"\n" +"Relocation section at offset 0x%lx contains %ld bytes:\n" +msgstr "" +"\n" +"Göreli konum 0x%lx'da yer deÄŸiÅŸtirme bölümü %ld bayt içeriyor:\n" -#: readelf.c:3424 -msgid "\nThere are no dynamic relocations in this file.\n" -msgstr "\nBu dosyada dinamik yer deðiþtirmeler yok.\n" +#: readelf.c:3566 +msgid "" +"\n" +"There are no dynamic relocations in this file.\n" +msgstr "" +"\n" +"Bu dosyada dinamik yer deÄŸiÅŸtirmeler yok.\n" -#: readelf.c:3451 -msgid "\nRelocation section " -msgstr "\nYer deðiþtirme bölümü " +#: readelf.c:3593 +msgid "" +"\n" +"Relocation section " +msgstr "" +"\n" +"Yer deÄŸiÅŸtirme bölümü " -#: readelf.c:3458 readelf.c:3905 +#: readelf.c:3598 readelf.c:4031 readelf.c:4045 +#, c-format +msgid "'%s'" +msgstr "'%s'" + +#: readelf.c:3600 readelf.c:4047 #, c-format msgid " at offset 0x%lx contains %lu entries:\n" -msgstr "göreli konum 0x%lx %lu girdi içeriyor:\n" +msgstr "göreli konum 0x%lx %lu girdi içeriyor:\n" -#: readelf.c:3496 -msgid "\nThere are no relocations in this file.\n" -msgstr "\nBu dosyada yer deðiþtirmeler yok.\n" +#: readelf.c:3638 +msgid "" +"\n" +"There are no relocations in this file.\n" +msgstr "" +"\n" +"Bu dosyada yer deÄŸiÅŸtirmeler yok.\n" -#: readelf.c:3692 +#: readelf.c:3834 msgid "unwind table" msgstr "geri alma tablosu" -#: readelf.c:3743 readelf.c:3755 readelf.c:7608 readelf.c:7619 +#: readelf.c:3885 readelf.c:3897 readelf.c:7890 readelf.c:7901 #, c-format msgid "Skipping unexpected symbol type %u\n" -msgstr "beklenmeyen sembol türü %u atlanýyor\n" +msgstr "beklenmeyen sembol türü %u atlanıyor\n" -#: readelf.c:3763 +#: readelf.c:3905 #, c-format msgid "Skipping unexpected relocation type %s\n" -msgstr "beklenmeyen yerdeðiþim türü %s atlanýyor\n" +msgstr "beklenmeyen yerdeÄŸiÅŸim türü %s atlanıyor\n" -#: readelf.c:3808 readelf.c:3833 -msgid "\nThere are no unwind sections in this file.\n" -msgstr "\nBu dosyada geri alma bölümü yok.\n" +#: readelf.c:3950 readelf.c:3975 +msgid "" +"\n" +"There are no unwind sections in this file.\n" +msgstr "" +"\n" +"Bu dosyada geri alma bölümü yok.\n" -#: readelf.c:3884 -msgid "\nCould not find unwind info section for " -msgstr "\nGeri alma bilgi bölümü bulunamadý " +#: readelf.c:4026 +msgid "" +"\n" +"Could not find unwind info section for " +msgstr "" +"\n" +"Geri alma bilgi bölümü bulunamadı " -#: readelf.c:3896 +#: readelf.c:4038 msgid "unwind info" msgstr "geri alma bilgisi" -#: readelf.c:3898 -msgid "\nUnwind section " -msgstr "\nGeri alma bölümü " +#: readelf.c:4040 +msgid "" +"\n" +"Unwind section " +msgstr "" +"\n" +"Geri alma bölümü " -#: readelf.c:4071 readelf.c:4114 +#: readelf.c:4213 readelf.c:4256 msgid "dynamic segment" -msgstr "dinamik bölüm" +msgstr "dinamik bölüm" -#: readelf.c:4183 -msgid "\nThere is no dynamic segment in this file.\n" -msgstr "\nBu dosyada dinamik parça yok.\n" +#: readelf.c:4334 +msgid "" +"\n" +"There is no dynamic segment in this file.\n" +msgstr "" +"\n" +"Bu dosyada dinamik parça yok.\n" -#: readelf.c:4217 +#: readelf.c:4368 msgid "Unable to seek to end of file!" -msgstr "Dosya sonuna kadar aranamýyor!" +msgstr "Dosya sonuna kadar aranamıyor!" -#: readelf.c:4228 +#: readelf.c:4379 msgid "Unable to determine the number of symbols to load\n" -msgstr "Yüklenecek sembol sayýsý belirlenemedi\n" +msgstr "Yüklenecek sembol sayısı belirlenemedi\n" -#: readelf.c:4258 +#: readelf.c:4409 msgid "Unable to seek to end of file\n" -msgstr "Dosyanýn sonuna kadar aranamadý\n" +msgstr "Dosyanın sonuna kadar aranamadı\n" -#: readelf.c:4264 +#: readelf.c:4415 msgid "Unable to determine the length of the dynamic string table\n" -msgstr "Dinamik dizge tablosunun uzunluðu belirlenemedi\n" +msgstr "Dinamik dizge tablosunun uzunluÄŸu belirlenemedi\n" -#: readelf.c:4269 +#: readelf.c:4420 msgid "dynamic string table" msgstr "dinamik dizge tablosu" -#: readelf.c:4303 +#: readelf.c:4454 msgid "symbol information" msgstr "sembol bilgisi" -#: readelf.c:4327 +#: readelf.c:4478 #, c-format -msgid "\nDynamic segment at offset 0x%x contains %ld entries:\n" -msgstr "\nGöreli konum 0x%x'deki dinamik parça %ld girdi içeriyor:\n" +msgid "" +"\n" +"Dynamic segment at offset 0x%x contains %ld entries:\n" +msgstr "" +"\n" +"Göreli konum 0x%x'deki dinamik parça %ld girdi içeriyor:\n" -#: readelf.c:4330 +#: readelf.c:4481 msgid " Tag Type Name/Value\n" -msgstr " Etiket Tip Ýsim/Deðer\n" +msgstr " Etiket Tip Ä°sim/DeÄŸer\n" -#: readelf.c:4366 +#: readelf.c:4517 msgid "Auxiliary library" -msgstr "Yardýmcý kitaplýk" +msgstr "Yardımcı kitaplık" -#: readelf.c:4370 +#: readelf.c:4521 msgid "Filter library" -msgstr "Filtre kitaplýðý" +msgstr "Filtre kitaplığı" -#: readelf.c:4374 +#: readelf.c:4525 msgid "Configuration file" -msgstr "Ayar dosyasý" +msgstr "Ayar dosyası" -#: readelf.c:4378 +#: readelf.c:4529 msgid "Dependency audit library" -msgstr "Baðýmlýlýk denetim kitaplýðý" +msgstr "Bağımlılık denetim kitaplığı" -#: readelf.c:4382 +#: readelf.c:4533 msgid "Audit library" -msgstr "Denetim kitaplýðý" +msgstr "Denetim kitaplığı" -#: readelf.c:4400 readelf.c:4426 readelf.c:4452 +#: readelf.c:4551 readelf.c:4577 readelf.c:4603 msgid "Flags:" -msgstr "Seçenekler:" +msgstr "Seçenekler:" -#: readelf.c:4402 readelf.c:4428 readelf.c:4454 +#: readelf.c:4553 readelf.c:4579 readelf.c:4605 msgid " None\n" -msgstr " Hiçbiri\n" +msgstr " Hiçbiri\n" -#: readelf.c:4573 +#: readelf.c:4724 #, c-format msgid "Shared library: [%s]" -msgstr "Paylaþýmlý kitaplýk: [%s]" +msgstr "Paylaşımlı kitaplık: [%s]" -#: readelf.c:4576 +#: readelf.c:4727 msgid " program interpreter" -msgstr " yazýlým yorumlayýcýsý" +msgstr " yazılım yorumlayıcısı" -#: readelf.c:4580 +#: readelf.c:4731 #, c-format msgid "Library soname: [%s]" -msgstr "Kitaplýk so_adý: [%s]" +msgstr "Kitaplık so_adı: [%s]" -#: readelf.c:4584 +#: readelf.c:4735 #, c-format msgid "Library rpath: [%s]" -msgstr "Kitaplýk r_yolu: [%s]" +msgstr "Kitaplık r_yolu: [%s]" -#: readelf.c:4588 +#: readelf.c:4739 #, c-format msgid "Library runpath: [%s]" -msgstr "Kitaplýk çalýþým yolu: [%s]" +msgstr "Kitaplık çalışım yolu: [%s]" -#: readelf.c:4649 +#: readelf.c:4802 #, c-format msgid "Not needed object: [%s]\n" msgstr "Gereksiz nesne: [%s]\n" -#: readelf.c:4746 +#: readelf.c:4913 #, c-format -msgid "\nVersion definition section '%s' contains %ld entries:\n" -msgstr "\nSürüm tanýmý bölümü '%s' %ld girdi içeriyor:\n" +msgid "" +"\n" +"Version definition section '%s' contains %ld entries:\n" +msgstr "" +"\n" +"Sürüm tanımı bölümü '%s' %ld girdi içeriyor:\n" -#: readelf.c:4749 +#: readelf.c:4916 msgid " Addr: 0x" msgstr " Adres: 0x" -#: readelf.c:4751 readelf.c:4946 +#: readelf.c:4918 readelf.c:5113 #, c-format msgid " Offset: %#08lx Link: %lx (%s)\n" -msgstr " Basamak: %#08lx Bað: %lx (%s)\n" +msgstr " Basamak: %#08lx BaÄŸ: %lx (%s)\n" -#: readelf.c:4758 +#: readelf.c:4925 msgid "version definition section" -msgstr "sürüm tanýmý bölümü" +msgstr "sürüm tanımı bölümü" -#: readelf.c:4784 +#: readelf.c:4951 #, c-format msgid " %#06x: Rev: %d Flags: %s" -msgstr " %#06x: Sür: %d Seçenek: %s" +msgstr " %#06x: Sür: %d Seçenek: %s" -#: readelf.c:4787 +#: readelf.c:4954 #, c-format msgid " Index: %d Cnt: %d " -msgstr " Endeks: %d Sayý: %d " +msgstr " Endeks: %d Sayı: %d " -#: readelf.c:4798 +#: readelf.c:4965 #, c-format msgid "Name: %s\n" -msgstr "Ýsim: %s\n" +msgstr "Ä°sim: %s\n" -#: readelf.c:4800 +#: readelf.c:4967 #, c-format msgid "Name index: %ld\n" -msgstr "Ýsim Endeksi: %ld\n" +msgstr "Ä°sim Endeksi: %ld\n" -#: readelf.c:4815 +#: readelf.c:4982 #, c-format msgid " %#06x: Parent %d: %s\n" -msgstr " %#06x: Üst %d: %s\n" +msgstr " %#06x: Ãœst %d: %s\n" -#: readelf.c:4818 +#: readelf.c:4985 #, c-format msgid " %#06x: Parent %d, name index: %ld\n" -msgstr " %#06x: Üst %d, isim endeksi: %ld\n" +msgstr " %#06x: Ãœst %d, isim endeksi: %ld\n" -#: readelf.c:4837 +#: readelf.c:5004 #, c-format -msgid "\nVersion needs section '%s' contains %ld entries:\n" -msgstr "\nSürüm gereksinimleri bölümü '%s' %ld girdi içeriyor:\n" +msgid "" +"\n" +"Version needs section '%s' contains %ld entries:\n" +msgstr "" +"\n" +"Sürüm gereksinimleri bölümü '%s' %ld girdi içeriyor:\n" -#: readelf.c:4840 +#: readelf.c:5007 msgid " Addr: 0x" msgstr " Adres: 0x" -#: readelf.c:4842 +#: readelf.c:5009 #, c-format msgid " Offset: %#08lx Link to section: %ld (%s)\n" -msgstr " Basamak: %#08lx Bölüme bað: %ld (%s)\n" +msgstr " Basamak: %#08lx Bölüme baÄŸ: %ld (%s)\n" -#: readelf.c:4848 +#: readelf.c:5015 msgid "version need section" -msgstr "Sürüm Gereksinim Bölüm" +msgstr "Sürüm Gereksinim Bölüm" -#: readelf.c:4870 +#: readelf.c:5037 #, c-format msgid " %#06x: Version: %d" -msgstr " %#06x: Sürüm: %d" +msgstr " %#06x: Sürüm: %d" -#: readelf.c:4873 +#: readelf.c:5040 #, c-format msgid " File: %s" msgstr " Dosya: %s" -#: readelf.c:4875 +#: readelf.c:5042 #, c-format msgid " File: %lx" msgstr " Dosya: %lx" -#: readelf.c:4877 +#: readelf.c:5044 #, c-format msgid " Cnt: %d\n" -msgstr " Sayý: %d\n" +msgstr " Sayı: %d\n" -#: readelf.c:4895 +#: readelf.c:5062 #, c-format msgid " %#06x: Name: %s" -msgstr " %#06x: Ýsim: %s" +msgstr " %#06x: Ä°sim: %s" -#: readelf.c:4898 +#: readelf.c:5065 #, c-format msgid " %#06x: Name index: %lx" -msgstr " %#06x: Ýsim endeksi: %lx" +msgstr " %#06x: Ä°sim endeksi: %lx" -#: readelf.c:4901 +#: readelf.c:5068 #, c-format msgid " Flags: %s Version: %d\n" -msgstr " Seçenekler: %s Sürüm: %d\n" +msgstr " Seçenekler: %s Sürüm: %d\n" -#: readelf.c:4937 +#: readelf.c:5104 msgid "version string table" -msgstr "Sürüm Dizge Tablo" +msgstr "Sürüm Dizge Tablo" -#: readelf.c:4941 +#: readelf.c:5108 #, c-format -msgid "\nVersion symbols section '%s' contains %d entries:\n" -msgstr "\nSürüm sembolleri bölümü '%s' %d girdi içeriyor:\n" +msgid "" +"\n" +"Version symbols section '%s' contains %d entries:\n" +msgstr "" +"\n" +"Sürüm sembolleri bölümü '%s' %d girdi içeriyor:\n" -#: readelf.c:4944 +#: readelf.c:5111 msgid " Addr: " msgstr " Adres: " -#: readelf.c:4954 +#: readelf.c:5121 msgid "version symbol data" -msgstr "Sürüm Sembol Veri" +msgstr "Sürüm Sembol Veri" -#: readelf.c:4981 +#: readelf.c:5148 msgid " 0 (*local*) " msgstr " 0 (*yerel*) " -#: readelf.c:4985 +#: readelf.c:5152 msgid " 1 (*global*) " msgstr " 1 (*evrensel*) " -#: readelf.c:5020 readelf.c:5454 +#: readelf.c:5187 readelf.c:5622 msgid "version need" -msgstr "Sürüm Gereksinim" +msgstr "Sürüm Gereksinim" -#: readelf.c:5030 +#: readelf.c:5197 msgid "version need aux (2)" -msgstr "Sürüm Gereksinim Yardýmcý (2)" +msgstr "Sürüm Gereksinim Yardımcı (2)" -#: readelf.c:5071 readelf.c:5516 +#: readelf.c:5238 readelf.c:5684 msgid "version def" -msgstr "sürüm tanýmý" +msgstr "sürüm tanımı" -#: readelf.c:5090 readelf.c:5531 +#: readelf.c:5257 readelf.c:5699 msgid "version def aux" -msgstr "Sürüm yardýmcý tanýmý" - -#: readelf.c:5121 -msgid "\nNo version information found in this file.\n" -msgstr "\nBu dosyada sürüm bilgisi yok.\n" - -#: readelf.c:5139 readelf.c:5174 -#, c-format -msgid ": %d" -msgstr ": %d" +msgstr "Sürüm yardımcı tanımı" -#: readelf.c:5141 readelf.c:5186 -#, c-format -msgid ": %d" -msgstr "<ÝS'e özel>: %d" - -#: readelf.c:5143 readelf.c:5189 -#, c-format -msgid ": %d" -msgstr ": %d" +#: readelf.c:5288 +msgid "" +"\n" +"No version information found in this file.\n" +msgstr "" +"\n" +"Bu dosyada sürüm bilgisi yok.\n" -#: readelf.c:5252 +#: readelf.c:5420 msgid "Unable to read in dynamic data\n" -msgstr "Dinamik veri okunamadý\n" +msgstr "Dinamik veri okunamadı\n" -#: readelf.c:5294 +#: readelf.c:5462 msgid "Unable to seek to start of dynamic information" -msgstr "Dinamik bilginin baþlangýcýna kadar aranamadý" +msgstr "Dinamik bilginin baÅŸlangıcına kadar aranamadı" -#: readelf.c:5300 +#: readelf.c:5468 msgid "Failed to read in number of buckets\n" -msgstr "Küme sayýsý okunamadý\n" +msgstr "Küme sayısı okunamadı\n" -#: readelf.c:5306 +#: readelf.c:5474 msgid "Failed to read in number of chains\n" -msgstr "Zincir sayýsý okunamadý\n" +msgstr "Zincir sayısı okunamadı\n" -#: readelf.c:5326 -msgid "\nSymbol table for image:\n" -msgstr "\nÝmaj için sembol tablosu:\n" +#: readelf.c:5494 +msgid "" +"\n" +"Symbol table for image:\n" +msgstr "" +"\n" +"Ä°maj için sembol tablosu:\n" -#: readelf.c:5328 +#: readelf.c:5496 msgid " Num Buc: Value Size Type Bind Vis Ndx Name\n" -msgstr " Küme Num: Deðer Boy Tip Bað Gör Ndx Ýsim\n" +msgstr " Küme Num: DeÄŸer Boy Tip BaÄŸ Gör Ndx Ä°sim\n" -#: readelf.c:5330 +#: readelf.c:5498 msgid " Num Buc: Value Size Type Bind Vis Ndx Name\n" -msgstr " Küme Num: Deðer Boy Tip Bað Gör Ndx Ýsim\n" +msgstr " Küme Num: DeÄŸer Boy Tip BaÄŸ Gör Ndx Ä°sim\n" -#: readelf.c:5375 +#: readelf.c:5543 #, c-format -msgid "\nSymbol table '%s' contains %lu entries:\n" -msgstr "\n'%s' sembol tablosu %lu girdi içeriyor:\n" +msgid "" +"\n" +"Symbol table '%s' contains %lu entries:\n" +msgstr "" +"\n" +"'%s' sembol tablosu %lu girdi içeriyor:\n" -#: readelf.c:5379 +#: readelf.c:5547 msgid " Num: Value Size Type Bind Vis Ndx Name\n" -msgstr " Num: Deðer Boy Tip Bað Gör Ndx Ýsim\n" +msgstr " Num: DeÄŸer Boy Tip BaÄŸ Gör Ndx Ä°sim\n" -#: readelf.c:5381 +#: readelf.c:5549 msgid " Num: Value Size Type Bind Vis Ndx Name\n" -msgstr " Num: Deðer Boy Tip Bað Gör Ndx Ýsim\n" +msgstr " Num: DeÄŸer Boy Tip BaÄŸ Gör Ndx Ä°sim\n" -#: readelf.c:5427 +#: readelf.c:5595 msgid "version data" -msgstr "sürüm verisi" +msgstr "sürüm verisi" -#: readelf.c:5467 +#: readelf.c:5635 msgid "version need aux (3)" -msgstr "Sürüm Gereksinim Yardýmcý (3)" +msgstr "Sürüm Gereksinim Yardımcı (3)" -#: readelf.c:5492 +#: readelf.c:5660 msgid "bad dynamic symbol" -msgstr "hatalý dinamik sembol" +msgstr "hatalı dinamik sembol" -#: readelf.c:5554 -msgid "\nDynamic symbol information is not available for displaying symbols.\n" -msgstr "\nDinamik sembolleri göstermek için dinamik sembol bilgisi mevcut deðil.\n" +#: readelf.c:5722 +msgid "" +"\n" +"Dynamic symbol information is not available for displaying symbols.\n" +msgstr "" +"\n" +"Dinamik sembolleri göstermek için dinamik sembol bilgisi mevcut deÄŸil.\n" -#: readelf.c:5566 +#: readelf.c:5734 #, c-format -msgid "\nHistogram for bucket list length (total of %d buckets):\n" -msgstr "\nKüme liste boyu (toplam %d küme) geçmiþ grafiði:\n" +msgid "" +"\n" +"Histogram for bucket list length (total of %d buckets):\n" +msgstr "" +"\n" +"Küme liste boyu (toplam %d küme) geçmiÅŸ grafiÄŸi:\n" -#: readelf.c:5568 +#: readelf.c:5736 #, c-format msgid " Length Number %% of total Coverage\n" msgstr "" " Length Number %% of total Coverage\n" -" Boy Numara toplam kapsamýn %%\n" +" Boy Numara toplam kapsamın %%\n" -#: readelf.c:5573 readelf.c:5592 readelf.c:8825 readelf.c:9017 +#: readelf.c:5741 readelf.c:5760 readelf.c:9146 readelf.c:9338 msgid "Out of memory" msgstr "Bellek yetersiz" -#: readelf.c:5641 +#: readelf.c:5809 #, c-format -msgid "\nDynamic info segment at offset 0x%lx contains %d entries:\n" -msgstr "\nGöreli konum 0x%lx'de yer alan dinamik bilgi parçasý %d girdi içeriyor:\n" +msgid "" +"\n" +"Dynamic info segment at offset 0x%lx contains %d entries:\n" +msgstr "" +"\n" +"Göreli konum 0x%lx'de yer alan dinamik bilgi parçası %d girdi içeriyor:\n" -#: readelf.c:5644 +#: readelf.c:5812 msgid " Num: Name BoundTo Flags\n" -msgstr " Num: Ýsim Baðlý Seçenekler\n" +msgstr " Num: Ä°sim BaÄŸlı Seçenekler\n" -#: readelf.c:5696 +#: readelf.c:5864 #, c-format -msgid "\nAssembly dump of section %s\n" -msgstr "\n%s bölümünün üretici dökümü\n" +msgid "" +"\n" +"Assembly dump of section %s\n" +msgstr "" +"\n" +"%s bölümünün üretici dökümü\n" -#: readelf.c:5719 +#: readelf.c:5887 #, c-format -msgid "\nSection '%s' has no data to dump.\n" -msgstr "\n'%s' bölümünde dökülecek veri yok.\n" +msgid "" +"\n" +"Section '%s' has no data to dump.\n" +msgstr "" +"\n" +"'%s' bölümünde dökülecek veri yok.\n" -#: readelf.c:5724 +#: readelf.c:5892 #, c-format -msgid "\nHex dump of section '%s':\n" -msgstr "\n'%s' bölümünün onaltýlýk dökümü:\n" +msgid "" +"\n" +"Hex dump of section '%s':\n" +msgstr "" +"\n" +"'%s' bölümünün onaltılık dökümü:\n" -#: readelf.c:5729 +#: readelf.c:5897 msgid "section data" -msgstr "bölüm verisi" +msgstr "bölüm verisi" -#: readelf.c:5878 +#: readelf.c:6046 msgid "badly formed extended line op encountered!\n" -msgstr "hatalý oluþturulmuþ uzun satýr iþlevi bulundu!\n" +msgstr "hatalı oluÅŸturulmuÅŸ uzun satır iÅŸlevi bulundu!\n" -#: readelf.c:5885 +#: readelf.c:6053 #, c-format msgid " Extended opcode %d: " msgstr " Ek opkod %d: " -#: readelf.c:5890 -msgid "End of Sequence\n\n" -msgstr "Dizi Sonu\n\n" +#: readelf.c:6058 +msgid "" +"End of Sequence\n" +"\n" +msgstr "" +"Dizi Sonu\n" +"\n" -#: readelf.c:5896 +#: readelf.c:6064 #, c-format msgid "set Address to 0x%lx\n" msgstr "Adresi 0x%lx olarak atar\n" -#: readelf.c:5901 +#: readelf.c:6069 msgid " define new File Table entry\n" -msgstr " yeni Dosya Tablosu girdisi tanýmlar\n" +msgstr " yeni Dosya Tablosu girdisi tanımlar\n" -#: readelf.c:5902 readelf.c:6031 +#: readelf.c:6070 readelf.c:6199 msgid " Entry\tDir\tTime\tSize\tName\n" -msgstr " Girdi\tDizin\tZaman\tBoy\tÝsim\n" +msgstr " Girdi\tDizin\tZaman\tBoy\tÄ°sim\n" -#: readelf.c:5904 +#: readelf.c:6072 #, c-format msgid " %d\t" msgstr " %d\t" -#: readelf.c:5907 readelf.c:5909 readelf.c:5911 readelf.c:6043 readelf.c:6045 -#: readelf.c:6047 +#: readelf.c:6075 readelf.c:6077 readelf.c:6079 readelf.c:6211 readelf.c:6213 +#: readelf.c:6215 #, c-format msgid "%lu\t" msgstr "%lu\t" -#: readelf.c:5912 +#: readelf.c:6080 #, c-format -msgid "%s\n\n" -msgstr "%s\n\n" +msgid "" +"%s\n" +"\n" +msgstr "" +"%s\n" +"\n" -#: readelf.c:5916 +#: readelf.c:6084 #, c-format msgid "UNKNOWN: length %d\n" msgstr "TANIMSIZ: uzunluk %d\n" -#: readelf.c:5942 +#: readelf.c:6110 #, c-format -msgid "\nDump of debug contents of section %s:\n\n" -msgstr "\n%s bölümünün hata ayýklama içeriði dökümü:\n\n" +msgid "" +"\n" +"Dump of debug contents of section %s:\n" +"\n" +msgstr "" +"\n" +"%s bölümünün hata ayıklama içeriÄŸi dökümü:\n" +"\n" -#: readelf.c:5954 +#: readelf.c:6122 msgid "64-bit DWARF line info is not supported yet.\n" -msgstr "64 bitlik DWARF satýr bilgisi henüz desteklenmiyor.\n" +msgstr "64 bitlik DWARF satır bilgisi henüz desteklenmiyor.\n" -#: readelf.c:5961 +#: readelf.c:6129 msgid "The line info appears to be corrupt - the section is too small\n" -msgstr "Satýr bilgisi bozuk - bölüm çok küçük\n" +msgstr "Satır bilgisi bozuk - bölüm çok küçük\n" -#: readelf.c:5969 +#: readelf.c:6137 msgid "Only DWARF version 2 line info is currently supported.\n" -msgstr "Þimdilik yalnýzca DWARF sürüm 2 satýr bilgisi destekleniyor.\n" +msgstr "Åžimdilik yalnızca DWARF sürüm 2 satır bilgisi destekleniyor.\n" -#: readelf.c:5984 +#: readelf.c:6152 #, c-format msgid " Length: %ld\n" msgstr " Uzunluk: %ld\n" -#: readelf.c:5985 +#: readelf.c:6153 #, c-format msgid " DWARF Version: %d\n" -msgstr " DWARF Sürümü: %d\n" +msgstr " DWARF Sürümü: %d\n" -#: readelf.c:5986 +#: readelf.c:6154 #, c-format msgid " Prologue Length: %d\n" -msgstr " Giriþ Uzunluðu: %d\n" +msgstr " GiriÅŸ UzunluÄŸu: %d\n" -#: readelf.c:5987 +#: readelf.c:6155 #, c-format msgid " Minimum Instruction Length: %d\n" -msgstr " Minimum Ýþlem Uzunluðu: %d\n" +msgstr " Minimum Ä°ÅŸlem UzunluÄŸu: %d\n" -#: readelf.c:5988 +#: readelf.c:6156 #, c-format msgid " Initial value of 'is_stmt': %d\n" -msgstr " 'is_stmt' baþlangýç deðeri: %d\n" +msgstr " 'is_stmt' baÅŸlangıç deÄŸeri: %d\n" -#: readelf.c:5989 +#: readelf.c:6157 #, c-format msgid " Line Base: %d\n" -msgstr " Satýr Temeli: %d\n" +msgstr " Satır Temeli: %d\n" -#: readelf.c:5990 +#: readelf.c:6158 #, c-format msgid " Line Range: %d\n" -msgstr " Satýr Aralýðý: %d\n" +msgstr " Satır Aralığı: %d\n" -#: readelf.c:5991 +#: readelf.c:6159 #, c-format msgid " Opcode Base: %d\n" msgstr " Opkod Temeli: %d\n" -#: readelf.c:6000 -msgid "\n Opcodes:\n" -msgstr "\n Opkodlar:\n" +#: readelf.c:6168 +msgid "" +"\n" +" Opcodes:\n" +msgstr "" +"\n" +" Opkodlar:\n" -#: readelf.c:6003 +#: readelf.c:6171 #, c-format msgid " Opcode %d has %d args\n" -msgstr " %d opkodunun %d seçeneði var\n" +msgstr " %d opkodunun %d seçeneÄŸi var\n" -#: readelf.c:6009 -msgid "\n The Directory Table is empty.\n" -msgstr "\n Dizin Tablosu boþ.\n" +#: readelf.c:6177 +msgid "" +"\n" +" The Directory Table is empty.\n" +msgstr "" +"\n" +" Dizin Tablosu boÅŸ.\n" -#: readelf.c:6012 -msgid "\n The Directory Table:\n" -msgstr "\n Dizin Tablosu:\n" +#: readelf.c:6180 +msgid "" +"\n" +" The Directory Table:\n" +msgstr "" +"\n" +" Dizin Tablosu:\n" -#: readelf.c:6016 +#: readelf.c:6184 #, c-format msgid " %s\n" msgstr " %s\n" -#: readelf.c:6027 -msgid "\n The File Name Table is empty.\n" -msgstr "\n Dosya Adý Tablosu boþ.\n" - -#: readelf.c:6030 -msgid "\n The File Name Table:\n" -msgstr "\n Dosya Adý Tablosu:\n" +#: readelf.c:6195 +msgid "" +"\n" +" The File Name Table is empty.\n" +msgstr "" +"\n" +" Dosya Adı Tablosu boÅŸ.\n" + +#: readelf.c:6198 +msgid "" +"\n" +" The File Name Table:\n" +msgstr "" +"\n" +" Dosya Adı Tablosu:\n" -#: readelf.c:6038 +#: readelf.c:6206 #, c-format msgid " %d\t" msgstr " %d\t" -#: readelf.c:6049 +#: readelf.c:6217 #, c-format msgid "%s\n" msgstr "%s\n" #. Now display the statements. -#: readelf.c:6057 -msgid "\n Line Number Statements:\n" -msgstr "\n Satýr Numarasý Deyimleri:\n" +#: readelf.c:6225 +msgid "" +"\n" +" Line Number Statements:\n" +msgstr "" +"\n" +" Satır Numarası Deyimleri:\n" -#: readelf.c:6073 +#: readelf.c:6241 #, c-format msgid " Special opcode %d: advance Address by %d to 0x%lx" -msgstr " Özel opkod %1$d: Adresi 0x%3$lx'e kadar %2$d ilerletir" +msgstr " Özel opkod %1$d: Adresi 0x%3$lx'e kadar %2$d ilerletir" -#: readelf.c:6077 +#: readelf.c:6245 #, c-format msgid " and Line by %d to %d\n" -msgstr " ve Satýr'ý %2$d'ye kadar %1$d\n" +msgstr " ve Satır'ı %2$d'ye kadar %1$d\n" -#: readelf.c:6088 +#: readelf.c:6256 msgid " Copy\n" msgstr " Kopyalar\n" -#: readelf.c:6095 +#: readelf.c:6263 #, c-format msgid " Advance PC by %d to %lx\n" msgstr " PC'yi %2$lx'ye kadar, %1$d ilerletir\n" -#: readelf.c:6103 +#: readelf.c:6271 #, c-format msgid " Advance Line by %d to %d\n" -msgstr " Satýrý %2$d'ye kadar %1$d ilerletir\n" +msgstr " Satırı %2$d'ye kadar %1$d ilerletir\n" -#: readelf.c:6110 +#: readelf.c:6278 #, c-format msgid " Set File Name to entry %d in the File Name Table\n" -msgstr " Dosya Adýný, Dosya Ýsim Tablosunda, %d numaralý girdi olarak atar\n" +msgstr " Dosya Adını, Dosya Ä°sim Tablosunda, %d numaralı girdi olarak atar\n" -#: readelf.c:6118 +#: readelf.c:6286 #, c-format msgid " Set column to %d\n" -msgstr " Sütunu %d olarak atar\n" +msgstr " Sütunu %d olarak atar\n" -#: readelf.c:6125 +#: readelf.c:6293 #, c-format msgid " Set is_stmt to %d\n" msgstr " is_stmt'i %d olarak atar\n" -#: readelf.c:6130 +#: readelf.c:6298 msgid " Set basic block\n" -msgstr " Temel bloðu atar\n" +msgstr " Temel bloÄŸu atar\n" -#: readelf.c:6138 +#: readelf.c:6306 #, c-format msgid " Advance PC by constant %d to 0x%lx\n" msgstr " PC'yi 0x%2$lx'e kadar %1$d ilerletir\n" -#: readelf.c:6146 +#: readelf.c:6314 #, c-format msgid " Advance PC by fixed size amount %d to 0x%lx\n" msgstr " PC'yi 0x%2$lx'e kadar %1$d ilerletir\n" -#: readelf.c:6151 +#: readelf.c:6319 msgid " Set prologue_end to true\n" -msgstr " Prologue_end'i doðru (true) olarak atar\n" +msgstr " Prologue_end'i doÄŸru (true) olarak atar\n" -#: readelf.c:6155 +#: readelf.c:6323 msgid " Set epilogue_begin to true\n" -msgstr " Epilogue_begin'i doðru (true) olarak atar\n" +msgstr " Epilogue_begin'i doÄŸru (true) olarak atar\n" -#: readelf.c:6161 +#: readelf.c:6329 #, c-format msgid " Set ISA to %d\n" -msgstr " ISA'yý %d olarak atar\n" +msgstr " ISA'yı %d olarak atar\n" -#: readelf.c:6165 +#: readelf.c:6333 #, c-format msgid " Unknown opcode %d with operands: " -msgstr " Bilinmeyen %d opkodu ve iþlenenleri: " +msgstr " Bilinmeyen %d opkodu ve iÅŸlenenleri: " -#: readelf.c:6197 readelf.c:6658 readelf.c:6730 +#: readelf.c:6365 readelf.c:6827 readelf.c:6899 #, c-format -msgid "Contents of the %s section:\n\n" -msgstr "%s bölümünün içeriði:\n\n" +msgid "" +"Contents of the %s section:\n" +"\n" +msgstr "" +"%s bölümünün içeriÄŸi:\n" +"\n" -#: readelf.c:6216 +#: readelf.c:6384 msgid "64-bit DWARF pubnames are not supported yet.\n" -msgstr "64 bitlik DWARF genel isimleri henüz desteklenmiyor\n" +msgstr "64 bitlik DWARF genel isimleri henüz desteklenmiyor\n" -#: readelf.c:6226 +#: readelf.c:6394 msgid "Only DWARF 2 pubnames are currently supported\n" -msgstr "Þimdilik yalnýz DWARF 2 genel isimleri destekleniyor\n" +msgstr "Åžimdilik yalnız DWARF 2 genel isimleri destekleniyor\n" -#: readelf.c:6233 +#: readelf.c:6401 #, c-format msgid " Length: %ld\n" msgstr " Uzunluk: %ld\n" -#: readelf.c:6235 +#: readelf.c:6403 #, c-format msgid " Version: %d\n" -msgstr " Sürüm: %d\n" +msgstr " Sürüm: %d\n" -#: readelf.c:6237 +#: readelf.c:6405 #, c-format msgid " Offset into .debug_info section: %ld\n" -msgstr ".debug_info bölümünün içine göreli konum: %ld\n" +msgstr ".debug_info bölümünün içine göreli konum: %ld\n" -#: readelf.c:6239 +#: readelf.c:6407 #, c-format msgid " Size of area in .debug_info section: %ld\n" -msgstr ".debug_info bölümünde alan büyüklüðü: %ld\n" +msgstr ".debug_info bölümünde alan büyüklüğü: %ld\n" -#: readelf.c:6242 -msgid "\n Offset\tName\n" -msgstr "\n Basamak\tÝsim\n" +#: readelf.c:6410 +msgid "" +"\n" +" Offset\tName\n" +msgstr "" +"\n" +" Basamak\tÄ°sim\n" -#: readelf.c:6333 +#: readelf.c:6501 #, c-format msgid "Unknown TAG value: %lx" -msgstr "Bilinmeyen TAG deðeri: %lx" +msgstr "Bilinmeyen TAG deÄŸeri: %lx" -#: readelf.c:6443 +#: readelf.c:6612 #, c-format msgid "Unknown AT value: %lx" -msgstr "Bilinmeyen AT deðeri: %lx" +msgstr "Bilinmeyen AT deÄŸeri: %lx" -#: readelf.c:6480 +#: readelf.c:6649 #, c-format msgid "Unknown FORM value: %lx" -msgstr "Bilinmeyen FORM deðeri: %lx" +msgstr "Bilinmeyen FORM deÄŸeri: %lx" -#: readelf.c:6679 +#: readelf.c:6848 #, c-format msgid " DW_MACINFO_start_file - lineno: %d filenum: %d\n" -msgstr " DW_MACINFO_start_file - satýr no: %d dosya no: %d\n" +msgstr " DW_MACINFO_start_file - satır no: %d dosya no: %d\n" -#: readelf.c:6684 +#: readelf.c:6853 msgid " DW_MACINFO_end_file\n" msgstr " DW_MACINFO_end_file\n" -#: readelf.c:6692 +#: readelf.c:6861 #, c-format msgid " DW_MACINFO_define - lineno : %d macro : %s\n" -msgstr " DW_MACINFO_define - satýr no : %d makro : %s\n" +msgstr " DW_MACINFO_define - satır no : %d makro : %s\n" -#: readelf.c:6700 +#: readelf.c:6869 #, c-format msgid " DW_MACINFO_undef - lineno : %d macro : %s\n" -msgstr " DW_MACINFO_undef - satýr no : %d makro : %s\n" +msgstr " DW_MACINFO_undef - satır no : %d makro : %s\n" -#: readelf.c:6711 +#: readelf.c:6880 #, c-format msgid " DW_MACINFO_vendor_ext - constant : %d string : %s\n" msgstr " DW_MACINFO_vendor_ext - sabit : %d dizge : %s\n" -#: readelf.c:6739 +#: readelf.c:6908 msgid " Number TAG\n" -msgstr " Sayý TAG\n" +msgstr " Sayı TAG\n" -#: readelf.c:6745 +#: readelf.c:6914 #, c-format msgid " %ld %s [%s]\n" msgstr " %ld %s [%s]\n" -#: readelf.c:6748 +#: readelf.c:6917 msgid "has children" -msgstr "astlarý var" +msgstr "astları var" -#: readelf.c:6748 +#: readelf.c:6917 msgid "no children" -msgstr "astlarý yok" +msgstr "astları yok" -#: readelf.c:6752 +#: readelf.c:6921 #, c-format msgid " %-18s %s\n" msgstr " %-18s %s\n" -#: readelf.c:6773 +#: readelf.c:6942 #, c-format msgid " %lu byte block: " -msgstr " %lu baytlýk blok: " +msgstr " %lu baytlık blok: " -#: readelf.c:7096 +#: readelf.c:7265 msgid "(User defined location op)" -msgstr "(Kullanýcý tanýmlý yer yönergesi)" +msgstr "(Kullanıcı tanımlı yer yönergesi)" -#: readelf.c:7098 +#: readelf.c:7267 msgid "(Unknown location op)" -msgstr "(Bilinmeyen yer yönergesi)" +msgstr "(Bilinmeyen yer yönergesi)" + +#: readelf.c:7305 +msgid "debug_loc section data" +msgstr "hata ayıklama bölüm verisi" + +#: readelf.c:7336 +msgid "" +"\n" +"The .debug_loc section is empty.\n" +msgstr "" +"\n" +".debug_loc bölümü boÅŸ.\n" + +#: readelf.c:7339 +msgid "" +"Contents of the .debug_loc section:\n" +"\n" +msgstr "" +".debug_loc bölümünün içeriÄŸi:\n" +"\n" + +#: readelf.c:7340 +msgid "" +"\n" +" Offset Begin End Expression\n" +msgstr "" +"\n" +" Görece BaÅŸlan. Son Ä°fade\n" -#: readelf.c:7137 +#: readelf.c:7412 msgid "debug_str section data" -msgstr "debug_str bölüm verisi" +msgstr "debug_str bölüm verisi" -#: readelf.c:7156 +#: readelf.c:7431 msgid "" -msgstr "<.debug_str bölümü yok>" +msgstr "<.debug_str bölümü yok>" -#: readelf.c:7159 +#: readelf.c:7434 msgid "" -msgstr "" +msgstr "" -#: readelf.c:7179 -msgid "\nThe .debug_str section is empty.\n" -msgstr "\n.debug_str bölümü boþ.\n" +#: readelf.c:7454 +msgid "" +"\n" +"The .debug_str section is empty.\n" +msgstr "" +"\n" +".debug_str bölümü boÅŸ.\n" -#: readelf.c:7183 -msgid "Contents of the .debug_str section:\n\n" -msgstr ".debug_str bölümünün içeriði:\n\n" +#: readelf.c:7458 +msgid "" +"Contents of the .debug_str section:\n" +"\n" +msgstr "" +".debug_str bölümünün içeriÄŸi:\n" +"\n" -#: readelf.c:7354 +#: readelf.c:7629 #, c-format msgid " (indirect string, offset: 0x%lx): " -msgstr " (dolaylý dizge, görece: 0x%lx): " +msgstr " (dolaylı dizge, görece: 0x%lx): " -#: readelf.c:7363 +#: readelf.c:7638 #, c-format -msgid "Unrecognised form: %d\n" +msgid "Unrecognized form: %d\n" msgstr "Bilinmeyen form: %d\n" -#: readelf.c:7376 +#: readelf.c:7651 msgid "(not inlined)" -msgstr "(inline'lanamadý)" +msgstr "(inline'lanamadı)" -#: readelf.c:7377 +#: readelf.c:7652 msgid "(inlined)" -msgstr "(inline'landý)" +msgstr "(inline'landı)" -#: readelf.c:7378 +#: readelf.c:7653 msgid "(declared as inline but ignored)" -msgstr "(inline olarak tanýmlandý ama yoksayýldý)" +msgstr "(inline olarak tanımlandı ama yoksayıldı)" -#: readelf.c:7379 +#: readelf.c:7654 msgid "(declared as inline and inlined)" -msgstr "(inline olarak tanýmlandý ve inline'landý)" +msgstr "(inline olarak tanımlandı ve inline'landı)" -#: readelf.c:7380 +#: readelf.c:7655 #, c-format msgid " (Unknown inline attribute value: %lx)" -msgstr " (Bilinmeyen inline öznitelik deðeri: %lx)" +msgstr " (Bilinmeyen inline öznitelik deÄŸeri: %lx)" -#: readelf.c:7545 readelf.c:7746 +#: readelf.c:7826 readelf.c:8029 #, c-format -msgid "The section %s contains:\n\n" -msgstr "%s bölümü içeriyor:\n\n" +msgid "" +"The section %s contains:\n" +"\n" +msgstr "" +"%s bölümü içeriyor:\n" +"\n" -#: readelf.c:7568 +#: readelf.c:7850 msgid "64-bit DWARF debug info is not supported yet.\n" -msgstr "64 bitlik DWARF hata ayýklama bilgisi henüz desteklenmiyor.\n" +msgstr "64 bitlik DWARF hata ayıklama bilgisi henüz desteklenmiyor.\n" -#: readelf.c:7637 +#: readelf.c:7919 #, c-format msgid " Compilation Unit @ %lx:\n" msgstr " Derleme Birimi @ %lx:\n" -#: readelf.c:7638 +#: readelf.c:7920 #, c-format msgid " Length: %ld\n" msgstr " Uzunluk: %ld\n" -#: readelf.c:7639 +#: readelf.c:7921 #, c-format msgid " Version: %d\n" -msgstr " Sürüm: %d\n" +msgstr " Sürüm: %d\n" -#: readelf.c:7640 +#: readelf.c:7922 #, c-format msgid " Abbrev Offset: %ld\n" -msgstr " Kýsaltma Basamaðý: %ld\n" +msgstr " Kısaltma Basamağı: %ld\n" -#: readelf.c:7641 +#: readelf.c:7923 #, c-format msgid " Pointer Size: %d\n" -msgstr " Gösterge Boyu: %d\n" +msgstr " Gösterge Boyu: %d\n" -#: readelf.c:7645 +#: readelf.c:7927 msgid "Only version 2 DWARF debug information is currently supported.\n" -msgstr "Þimdilik yalnýzca DWARF Sürüm 2 hata ayýklama bilgisi destekleniyor.\n" +msgstr "Åžimdilik yalnızca DWARF Sürüm 2 hata ayıklama bilgisi destekleniyor.\n" -#: readelf.c:7666 +#: readelf.c:7948 msgid "Unable to locate .debug_abbrev section!\n" -msgstr ".debug_abbrev bölümü bulunamadý!\n" +msgstr ".debug_abbrev bölümü bulunamadı!\n" -#: readelf.c:7672 +#: readelf.c:7954 msgid "debug_abbrev section data" -msgstr "debug_abbrev bölüm verisi" +msgstr "debug_abbrev bölüm verisi" -#: readelf.c:7709 +#: readelf.c:7991 #, c-format msgid "Unable to locate entry %lu in the abbreviation table\n" -msgstr "Kýsaltma tablosunda %lu girdisi bulunamadý\n" +msgstr "Kısaltma tablosunda %lu girdisi bulunamadı\n" -#: readelf.c:7714 +#: readelf.c:7996 #, c-format msgid " <%d><%lx>: Abbrev Number: %lu (%s)\n" -msgstr " <%d><%lx>: Kýsaltma Numarasý: %lu (%s)\n" +msgstr " <%d><%lx>: Kısaltma Numarası: %lu (%s)\n" -#: readelf.c:7767 +#: readelf.c:8050 msgid "64-bit DWARF aranges are not supported yet.\n" -msgstr "64 bitlik DWARF a-aralýklarý henüz desteklenmiyor.\n" +msgstr "64 bitlik DWARF a-aralıkları henüz desteklenmiyor.\n" -#: readelf.c:7773 +#: readelf.c:8056 msgid "Only DWARF 2 aranges are currently supported.\n" -msgstr "Þimdilik yalnýzca DWARF 2 a-aralýklarý destekleniyor.\n" +msgstr "Åžimdilik yalnızca DWARF 2 a-aralıkları destekleniyor.\n" -#: readelf.c:7777 +#: readelf.c:8060 #, c-format msgid " Length: %ld\n" msgstr " Uzunluk: %ld\n" -#: readelf.c:7778 +#: readelf.c:8061 #, c-format msgid " Version: %d\n" -msgstr " Sürüm: %d\n" +msgstr " Sürüm: %d\n" -#: readelf.c:7779 +#: readelf.c:8062 #, c-format msgid " Offset into .debug_info: %lx\n" -msgstr " .debug_info'nun içine göreli konum: %lx\n" +msgstr " .debug_info'nun içine göreli konum: %lx\n" -#: readelf.c:7780 +#: readelf.c:8063 #, c-format msgid " Pointer Size: %d\n" -msgstr " Gösterge Boyu: %d\n" +msgstr " Gösterge Boyu: %d\n" -#: readelf.c:7781 +#: readelf.c:8064 #, c-format msgid " Segment Size: %d\n" -msgstr " Parça Boyu: %d\n" +msgstr " Parça Boyu: %d\n" -#: readelf.c:7783 -msgid "\n Address Length\n" -msgstr "\n Adres Uzunluk\n" +#: readelf.c:8066 +msgid "" +"\n" +" Address Length\n" +msgstr "" +"\n" +" Adres Uzunluk\n" -#: readelf.c:7965 +#: readelf.c:8248 #, c-format msgid "The section %s contains:\n" -msgstr "%s bölümü içeriyor:\n" +msgstr "%s bölümü içeriyor:\n" -#: readelf.c:7988 +#: readelf.c:8271 msgid "64-bit DWARF format frames are not supported yet.\n" -msgstr "64 bitlik DWARF biçem çerçeveleri henüz desteklenmiyor.\n" +msgstr "64 bitlik DWARF biçem çerçeveleri henüz desteklenmiyor.\n" -#: readelf.c:8499 +#: readelf.c:8820 #, c-format msgid "Displaying the debug contents of section %s is not yet supported.\n" -msgstr "%s bölümünün hata ayýklama içerik bilgilerini göstermek henüz desteklenmiyor.\n" +msgstr "%s bölümünün hata ayıklama içerik bilgilerini göstermek henüz desteklenmiyor.\n" -#: readelf.c:8565 +#: readelf.c:8886 #, c-format -msgid "\nSection '%s' has no debugging data.\n" -msgstr "\n'%s' bölümünde hata ayýklama bilgisi yok.\n" +msgid "" +"\n" +"Section '%s' has no debugging data.\n" +msgstr "" +"\n" +"'%s' bölümünde hata ayıklama bilgisi yok.\n" -#: readelf.c:8570 readelf.c:8632 +#: readelf.c:8891 readelf.c:8953 msgid "debug section data" -msgstr "hata ayýklama bölüm verisi" +msgstr "hata ayıklama bölüm verisi" -#: readelf.c:8586 +#: readelf.c:8907 #, c-format -msgid "Unrecognised debug section: %s\n" -msgstr "Tanýnmayan hata ayýklama bölümü: %s\n" +msgid "Unrecognized debug section: %s\n" +msgstr "Tanınmayan hata ayıklama bölümü: %s\n" -#: readelf.c:8660 +#: readelf.c:8981 msgid "Some sections were not dumped because they do not exist!\n" -msgstr "Bazý bölümler dökülmedi çünkü mevcut deðiller!\n" +msgstr "Bazı bölümler dökülmedi çünkü mevcut deÄŸiller!\n" -#: readelf.c:8733 +#: readelf.c:9054 readelf.c:9418 msgid "liblist" msgstr "liblist" -#: readelf.c:8818 +#: readelf.c:9139 msgid "options" -msgstr "seçenekler" +msgstr "seçenekler" -#: readelf.c:8849 +#: readelf.c:9170 #, c-format -msgid "\nSection '%s' contains %d entries:\n" -msgstr "\n'%s' bölümü %d girdi içeriyor:\n" +msgid "" +"\n" +"Section '%s' contains %d entries:\n" +msgstr "" +"\n" +"'%s' bölümü %d girdi içeriyor:\n" -#: readelf.c:9010 -msgid "conflict list with without table" -msgstr "tablolu ve tablosuz çeliþki listesi" +#: readelf.c:9331 +msgid "conflict list found without a dynamic symbol table" +msgstr "dinamik sembol tablosu olmayan çeliÅŸki listesi bulundu" -#: readelf.c:9028 readelf.c:9044 +#: readelf.c:9349 readelf.c:9365 msgid "conflict" -msgstr "çakýþma" +msgstr "çakışma" -#: readelf.c:9054 +#: readelf.c:9375 #, c-format -msgid "\nSection '.conflict' contains %ld entries:\n" -msgstr "\n'.conflict' bölümü %ld girdi içeriyor:\n" +msgid "" +"\n" +"Section '.conflict' contains %ld entries:\n" +msgstr "" +"\n" +"'.conflict' bölümü %ld girdi içeriyor:\n" -#: readelf.c:9056 +#: readelf.c:9377 msgid " Num: Index Value Name" -msgstr " Num: Endeks Deðer Ýsim" +msgstr " Num: Endeks DeÄŸer Ä°sim" + +#: readelf.c:9426 +msgid "liblist string table" +msgstr "liblist dizge tablosu" -#: readelf.c:9083 +#: readelf.c:9435 +#, c-format +msgid "" +"\n" +"Library list section '%s' contains %lu entries:\n" +msgstr "" +"\n" +"Kitaplık liste bölümü '%s', %lu girdi içeriyor:\n" + +#: readelf.c:9484 msgid "NT_PRSTATUS (prstatus structure)" -msgstr "NT_PRSTATUS (prstatus yapýsý)" +msgstr "NT_PRSTATUS (prstatus yapısı)" -#: readelf.c:9084 +#: readelf.c:9485 msgid "NT_FPREGSET (floating point registers)" -msgstr "NT_FPREGSET (kayan nokta yazmaçlarý)" +msgstr "NT_FPREGSET (kayan nokta yazmaçları)" -#: readelf.c:9085 +#: readelf.c:9486 msgid "NT_PRPSINFO (prpsinfo structure)" -msgstr "NT_PRPSINFO (prpsinfo yapýsý)" +msgstr "NT_PRPSINFO (prpsinfo yapısı)" -#: readelf.c:9086 +#: readelf.c:9487 msgid "NT_TASKSTRUCT (task structure)" -msgstr "NT_TASKSTRUCT (görev yapýsý)" +msgstr "NT_TASKSTRUCT (görev yapısı)" -#: readelf.c:9087 +#: readelf.c:9488 msgid "NT_PRXFPREG (user_xfpregs structure)" -msgstr "NT_PRXFPREG (user_xfpregs yapýsý)" +msgstr "NT_PRXFPREG (user_xfpregs yapısı)" -#: readelf.c:9088 +#: readelf.c:9489 msgid "NT_PSTATUS (pstatus structure)" -msgstr "NT_PSTATUS (pstatus yapýsý)" +msgstr "NT_PSTATUS (pstatus yapısı)" -#: readelf.c:9089 +#: readelf.c:9490 msgid "NT_FPREGS (floating point registers)" -msgstr "NT_FPREGS (kayan nokta yazmaçlarý)" +msgstr "NT_FPREGS (kayan nokta yazmaçları)" -#: readelf.c:9090 +#: readelf.c:9491 msgid "NT_PSINFO (psinfo structure)" -msgstr "NT_PSINFO (psinfo yapýsý)" +msgstr "NT_PSINFO (psinfo yapısı)" -#: readelf.c:9091 +#: readelf.c:9492 msgid "NT_LWPSTATUS (lwpstatus_t structure)" -msgstr "NT_LWPSTATUS (lwpstatus_t yapýsý)" +msgstr "NT_LWPSTATUS (lwpstatus_t yapısı)" -#: readelf.c:9092 +#: readelf.c:9493 msgid "NT_LWPSINFO (lwpsinfo_t structure)" -msgstr "NT_LWPSINFO (lwpsinfo_t yapýsý)" +msgstr "NT_LWPSINFO (lwpsinfo_t yapısı)" -#: readelf.c:9093 -msgid "NT_WIN32PSTATUS (win32_pstatus strcuture)" -msgstr "NT_WIN32PSTATUS (win32_pstatus yapýsý)" +#: readelf.c:9494 +msgid "NT_WIN32PSTATUS (win32_pstatus structure)" +msgstr "NT_WIN32PSTATUS (win32_pstatus yapısı)" -#: readelf.c:9095 readelf.c:9119 +#: readelf.c:9496 readelf.c:9520 #, c-format msgid "Unknown note type: (0x%08x)" msgstr "Bilinmeyen not tipi: (0x%08x)" #. NetBSD core "procinfo" structure. -#: readelf.c:9109 +#: readelf.c:9510 msgid "NetBSD procinfo structure" -msgstr "NetBSD procinfo yapýsý" +msgstr "NetBSD procinfo yapısı" -#: readelf.c:9136 readelf.c:9150 +#: readelf.c:9537 readelf.c:9551 msgid "PT_GETREGS (reg structure)" -msgstr "PT_GETREGS (yazmaç yapýsý)" +msgstr "PT_GETREGS (yazmaç yapısı)" -#: readelf.c:9138 readelf.c:9152 +#: readelf.c:9539 readelf.c:9553 msgid "PT_GETFPREGS (fpreg structure)" -msgstr "PT_GETFPREGS (kayan nokta yazmaç yapýsý)" +msgstr "PT_GETFPREGS (kayan nokta yazmaç yapısı)" -#: readelf.c:9158 +#: readelf.c:9559 #, c-format msgid "PT_FIRSTMACH+%d" msgstr "PT_FIRSTMACH+%d" -#: readelf.c:9212 +#: readelf.c:9613 msgid "notes" msgstr "notlar" -#: readelf.c:9218 +#: readelf.c:9619 #, c-format -msgid "\nNotes at offset 0x%08lx with length 0x%08lx:\n" -msgstr "\n0x%08lx göreli konumunda, 0x%08lx uzunluðunda notlar:\n" +msgid "" +"\n" +"Notes at offset 0x%08lx with length 0x%08lx:\n" +msgstr "" +"\n" +"0x%08lx göreli konumunda, 0x%08lx uzunluÄŸunda notlar:\n" -#: readelf.c:9220 +#: readelf.c:9621 msgid " Owner\t\tData size\tDescription\n" -msgstr " Sahip\t\tVeri Boyu\tAçýklama\n" +msgstr " Sahip\t\tVeri Boyu\tAçıklama\n" -#: readelf.c:9331 +#: readelf.c:9640 +#, c-format +msgid "corrupt note found at offset %x into core notes\n" +msgstr "'core' notlarının içinde, %x görecesinde bozuk not bulundu\n" + +#: readelf.c:9642 +#, c-format +msgid " type: %x, namesize: %08lx, descsize: %08lx\n" +msgstr " tür: %x, isimboyu: %08lx, tanımboyu: %08lx\n" + +#: readelf.c:9744 msgid "No note segments present in the core file.\n" -msgstr "Core dosyasýnda not parçalarý yok.\n" +msgstr "Core dosyasında not parçaları yok.\n" -#: readelf.c:9409 +#: readelf.c:9822 msgid "" "This instance of readelf has been built without support for a\n" "64 bit data type and so it cannot read 64 bit ELF files.\n" msgstr "" -"Bu readelf, 64 bitlik veri türü desteði olmaksýzýn derlenmiþtir ve\n" -"64 bitlik ELF dosyalarýný okuyamaz.\n" +"Bu readelf, 64 bitlik veri türü desteÄŸi olmaksızın derlenmiÅŸtir ve\n" +"64 bitlik ELF dosyalarını okuyamaz.\n" -#: readelf.c:9452 +#: readelf.c:9868 #, c-format msgid "Cannot stat input file %s.\n" -msgstr "%s girdi dosyasý durumlanamadý.\n" +msgstr "%s girdi dosyası durumlanamadı.\n" -#: readelf.c:9459 +#: readelf.c:9875 #, c-format msgid "Input file %s not found.\n" -msgstr "Girdi dosyasý %s bulunamadý.\n" +msgstr "Girdi dosyası %s bulunamadı.\n" -#: readelf.c:9465 +#: readelf.c:9881 #, c-format msgid "%s: Failed to read file header\n" -msgstr "%s: Dosya baþlýðý okunamadý\n" +msgstr "%s: Dosya baÅŸlığı okunamadı\n" -#: readelf.c:9479 +#: readelf.c:9895 #, c-format -msgid "\nFile: %s\n" -msgstr "\nDosya: %s\n" +msgid "" +"\n" +"File: %s\n" +msgstr "" +"\n" +"Dosya: %s\n" #: rename.c:131 #, c-format msgid "%s: cannot set time: %s" -msgstr "%s: zaman atanamadý: %s" +msgstr "%s: zaman atanamadı: %s" #. We have to clean up here. #: rename.c:170 rename.c:203 #, c-format msgid "%s: rename: %s" -msgstr "%s: yeniden adlandýrma: %s" +msgstr "%s: yeniden adlandırma: %s" #: rename.c:211 #, c-format msgid "%s: simple_copy: %s" msgstr "%s: simple_copy: %s" -#: resbin.c:130 +#: resbin.c:134 #, c-format msgid "%s: not enough binary data" msgstr "%s: yeterli ikilik veri yok" -#: resbin.c:149 +#: resbin.c:153 msgid "null terminated unicode string" -msgstr "boþ deðerle sonlanmýþ unicode dizgesi" +msgstr "boÅŸ deÄŸerle sonlanmış unicode dizgesi" -#: resbin.c:179 resbin.c:185 +#: resbin.c:183 resbin.c:189 msgid "resource ID" msgstr "kaynak ID" -#: resbin.c:229 +#: resbin.c:233 msgid "cursor" -msgstr "gösterge" +msgstr "gösterge" -#: resbin.c:263 resbin.c:270 +#: resbin.c:267 resbin.c:274 msgid "menu header" -msgstr "menü baþlýðý" +msgstr "menü baÅŸlığı" -#: resbin.c:280 +#: resbin.c:284 msgid "menuex header" -msgstr "menuex baþlýðý" +msgstr "menuex baÅŸlığı" -#: resbin.c:284 +#: resbin.c:288 msgid "menuex offset" -msgstr "menuex basamaðý" +msgstr "menuex basamağı" -#: resbin.c:291 +#: resbin.c:295 #, c-format msgid "unsupported menu version %d" -msgstr "desteklenmeyen menü sürümü %d" +msgstr "desteklenmeyen menü sürümü %d" -#: resbin.c:319 resbin.c:334 resbin.c:400 +#: resbin.c:323 resbin.c:338 resbin.c:404 msgid "menuitem header" -msgstr "menü üyesi baþlýðý" +msgstr "menü üyesi baÅŸlığı" -#: resbin.c:430 +#: resbin.c:434 msgid "menuitem" -msgstr "menü üyesi" +msgstr "menü üyesi" -#: resbin.c:471 resbin.c:499 +#: resbin.c:475 resbin.c:503 msgid "dialog header" -msgstr "diyalog baþlýðý" +msgstr "diyalog baÅŸlığı" -#: resbin.c:489 +#: resbin.c:493 #, c-format -msgid "unexpected dialog signature %d" -msgstr "beklenmeyen diyalog imzasý %d" +msgid "unexpected DIALOGEX version %d" +msgstr "beklenmeyen DIALOGEX sürümü %d" -#: resbin.c:531 +#: resbin.c:538 msgid "dialog font point size" -msgstr "diyalog yazýtipi büyüklüðü" +msgstr "diyalog yazıtipi büyüklüğü" -#: resbin.c:539 +#: resbin.c:546 msgid "dialogex font information" -msgstr "dialogex yazýtipi bilgisi" +msgstr "dialogex yazıtipi bilgisi" -#: resbin.c:564 resbin.c:582 +#: resbin.c:572 resbin.c:590 msgid "dialog control" -msgstr "diyalog kontrolü" +msgstr "diyalog kontrolü" -#: resbin.c:574 +#: resbin.c:582 msgid "dialogex control" -msgstr "dialogex kontrolü" +msgstr "dialogex kontrolü" -#: resbin.c:603 +#: resbin.c:611 msgid "dialog control end" msgstr "diyalog kontrol sonu" -#: resbin.c:615 +#: resbin.c:623 msgid "dialog control data" msgstr "diyalog kontrol verisi" -#: resbin.c:658 +#: resbin.c:666 msgid "stringtable string length" -msgstr "dizgetablosu dizge uzunluðu" +msgstr "dizgetablosu dizge uzunluÄŸu" -#: resbin.c:668 +#: resbin.c:676 msgid "stringtable string" msgstr "dizgetablosu dizgesi" -#: resbin.c:701 +#: resbin.c:709 msgid "fontdir header" -msgstr "yazýtipi dizin baþlýðý" +msgstr "yazıtipi dizin baÅŸlığı" -#: resbin.c:714 +#: resbin.c:722 msgid "fontdir" -msgstr "yazýtipi dizini" +msgstr "yazıtipi dizini" -#: resbin.c:730 +#: resbin.c:738 msgid "fontdir device name" -msgstr "yazýtipi aygýt adý" +msgstr "yazıtipi aygıt adı" -#: resbin.c:736 +#: resbin.c:744 msgid "fontdir face name" -msgstr "yazýtipi dizini aile ismi" +msgstr "yazıtipi dizini aile ismi" -#: resbin.c:779 +#: resbin.c:787 msgid "accelerator" -msgstr "hýzlandýrýcý" +msgstr "hızlandırıcı" -#: resbin.c:843 +#: resbin.c:851 msgid "group cursor header" -msgstr "grup gösterge baþlýðý" +msgstr "grup gösterge baÅŸlığı" -#: resbin.c:847 +#: resbin.c:855 #, c-format msgid "unexpected group cursor type %d" -msgstr "beklenmeyen grup gösterge tipi %d" +msgstr "beklenmeyen grup gösterge tipi %d" -#: resbin.c:862 +#: resbin.c:870 msgid "group cursor" -msgstr "grup göstergesi" +msgstr "grup göstergesi" -#: resbin.c:901 +#: resbin.c:909 msgid "group icon header" -msgstr "grup ikon baþlýðý" +msgstr "grup ikon baÅŸlığı" -#: resbin.c:905 +#: resbin.c:913 #, c-format msgid "unexpected group icon type %d" msgstr "beklenmeyen grup ikon tipi %d" -#: resbin.c:920 +#: resbin.c:928 msgid "group icon" msgstr "grup ikonu" -#: resbin.c:991 resbin.c:1210 +#: resbin.c:999 resbin.c:1218 msgid "unexpected version string" -msgstr "dizgenin beklenmeyen sürümü" +msgstr "dizgenin beklenmeyen sürümü" -#: resbin.c:1025 +#: resbin.c:1033 #, c-format msgid "version length %d does not match resource length %lu" -msgstr "sürüm uzunluðu %d, kaynak uzunluðu %lu ile eþleþmiyor" +msgstr "sürüm uzunluÄŸu %d, kaynak uzunluÄŸu %lu ile eÅŸleÅŸmiyor" -#: resbin.c:1029 +#: resbin.c:1037 #, c-format msgid "unexpected version type %d" -msgstr "beklenmeyen sürüm tipi %d" +msgstr "beklenmeyen sürüm tipi %d" -#: resbin.c:1041 +#: resbin.c:1049 #, c-format msgid "unexpected fixed version information length %d" -msgstr "beklenmeyen sabit sürüm bilgi uzunluðu %d" +msgstr "beklenmeyen sabit sürüm bilgi uzunluÄŸu %d" -#: resbin.c:1044 +#: resbin.c:1052 msgid "fixed version info" -msgstr "sabit sürüm bilgisi" +msgstr "sabit sürüm bilgisi" -#: resbin.c:1048 +#: resbin.c:1056 #, c-format msgid "unexpected fixed version signature %lu" -msgstr "beklenmeyen sabit sürüm imzasý %lu" +msgstr "beklenmeyen sabit sürüm imzası %lu" -#: resbin.c:1052 +#: resbin.c:1060 #, c-format msgid "unexpected fixed version info version %lu" -msgstr "beklenmeyen sabit sürüm bilgisi sürümü %lu" +msgstr "beklenmeyen sabit sürüm bilgisi sürümü %lu" -#: resbin.c:1081 +#: resbin.c:1089 msgid "version var info" -msgstr "sürüm deðiþken bilgisi" +msgstr "sürüm deÄŸiÅŸken bilgisi" -#: resbin.c:1098 +#: resbin.c:1106 #, c-format msgid "unexpected stringfileinfo value length %d" -msgstr "beklenmeyen dizge dosya bilgi deðer uzunluðu %d" +msgstr "beklenmeyen dizge dosya bilgi deÄŸer uzunluÄŸu %d" -#: resbin.c:1108 +#: resbin.c:1116 #, c-format msgid "unexpected version stringtable value length %d" -msgstr "beklenmeyen sürüm dizge tablo deðer uzunluðu %d" +msgstr "beklenmeyen sürüm dizge tablo deÄŸer uzunluÄŸu %d" -#: resbin.c:1142 +#: resbin.c:1150 #, c-format msgid "unexpected version string length %d != %d + %d" -msgstr "beklenmeyen sürüm dizge uzunluðu %d != %d + %d" +msgstr "beklenmeyen sürüm dizge uzunluÄŸu %d != %d + %d" -#: resbin.c:1153 +#: resbin.c:1161 #, c-format msgid "unexpected version string length %d < %d" -msgstr "beklenmeyen sürüm dizge uzunluðu %d < %d" +msgstr "beklenmeyen sürüm dizge uzunluÄŸu %d < %d" -#: resbin.c:1170 +#: resbin.c:1178 #, c-format msgid "unexpected varfileinfo value length %d" -msgstr "beklenmeyen deðiþken dosya bilgi deðer uzunluðu %d" +msgstr "beklenmeyen deÄŸiÅŸken dosya bilgi deÄŸer uzunluÄŸu %d" -#: resbin.c:1189 +#: resbin.c:1197 msgid "version varfileinfo" -msgstr "deðiþken dosya bilgi sürümü" +msgstr "deÄŸiÅŸken dosya bilgi sürümü" -#: resbin.c:1204 +#: resbin.c:1212 #, c-format msgid "unexpected version value length %d" -msgstr "beklenmeyen sürüm deðer uzunluðu %d" +msgstr "beklenmeyen sürüm deÄŸer uzunluÄŸu %d" #: rescoff.c:128 msgid "filename required for COFF input" -msgstr "COFF girdisi için dosya adý gerekli" +msgstr "COFF girdisi için dosya adı gerekli" #: rescoff.c:145 #, c-format msgid "%s: no resource section" -msgstr "%s: kaynak bölümü yok" +msgstr "%s: kaynak bölümü yok" #: rescoff.c:152 msgid "can't read resource section" -msgstr "kaynak bölümü okunamýyor" +msgstr "kaynak bölümü okunamıyor" #: rescoff.c:178 #, c-format msgid "%s: %s: address out of bounds" -msgstr "%s: %s: adres sýnýrlarýn dýþýnda" +msgstr "%s: %s: adres sınırların dışında" #: rescoff.c:197 msgid "directory" @@ -3979,7 +4384,7 @@ msgstr "ID altdizini" #: rescoff.c:302 msgid "ID resource" -msgstr "ID kaynaðý" +msgstr "ID kaynağı" #: rescoff.c:328 msgid "resource type unknown" @@ -3999,21 +4404,21 @@ msgstr "kaynak veri boyu" #: rescoff.c:439 msgid "filename required for COFF output" -msgstr "COFF çýktý için dosya adý gerekli" +msgstr "COFF çıktı için dosya adı gerekli" #: rescoff.c:738 msgid "can't get BFD_RELOC_RVA relocation type" -msgstr "BFD_RELOC_RVA yer deðiþtirme tipi alýnamýyor" +msgstr "BFD_RELOC_RVA yer deÄŸiÅŸtirme tipi alınamıyor" #: resrc.c:240 resrc.c:312 #, c-format msgid "can't open temporary file `%s': %s" -msgstr "`%s' geçici dosyasý açýlamýyor: %s" +msgstr "`%s' geçici dosyası açılamıyor: %s" #: resrc.c:246 #, c-format msgid "can't redirect stdout: `%s': %s" -msgstr "standart çýktý yönlendirilemiyor: `%s': %s" +msgstr "standart çıktı yönlendirilemiyor: `%s': %s" #: resrc.c:262 #, c-format @@ -4023,21 +4428,21 @@ msgstr "%s %s: %s" #: resrc.c:308 #, c-format msgid "can't execute `%s': %s" -msgstr "`%s' çalýþtýrýlamýyor: %s" +msgstr "`%s' çalıştırılamıyor: %s" #: resrc.c:317 #, c-format msgid "Using temporary file `%s' to read preprocessor output\n" -msgstr "`%s' geçici dosyasý öniþlemci çýktýsýný okumak için kullanýlýyor\n" +msgstr "`%s' geçici dosyası öniÅŸlemci çıktısını okumak için kullanılıyor\n" #: resrc.c:324 #, c-format msgid "can't popen `%s': %s" -msgstr "`%s' popen yapýlamýyor: %s" +msgstr "`%s' popen yapılamıyor: %s" #: resrc.c:326 msgid "Using popen to read preprocessor output\n" -msgstr "Öniþlemci çýktýsý popen ile okunuyor\n" +msgstr "ÖniÅŸlemci çıktısı popen ile okunuyor\n" #: resrc.c:369 #, c-format @@ -4047,367 +4452,559 @@ msgstr "`%s' denendi\n" #: resrc.c:380 #, c-format msgid "Using `%s'\n" -msgstr "`%s' kullanýlýyor\n" +msgstr "`%s' kullanılıyor\n" -#: resrc.c:541 +#: resrc.c:542 #, c-format msgid "%s:%d: %s\n" msgstr "%s:%d: %s\n" -#: resrc.c:550 +#: resrc.c:551 #, c-format msgid "%s: unexpected EOF" msgstr "%s: beklenmeyen dosya sonu" -#: resrc.c:607 +#: resrc.c:608 #, c-format msgid "%s: read of %lu returned %lu" -msgstr "%s: %lu'nun okunmasý %lu döndürdü" +msgstr "%s: %lu'nun okunması %lu döndürdü" -#: resrc.c:649 resrc.c:903 resrc.c:1176 resrc.c:1330 +#: resrc.c:650 resrc.c:904 resrc.c:1177 resrc.c:1331 #, c-format msgid "stat failed on bitmap file `%s': %s" -msgstr "`%s' bitmap dosyasý durumlanamadý: %s" +msgstr "`%s' bitmap dosyası durumlanamadı: %s" -#: resrc.c:702 +#: resrc.c:703 #, c-format msgid "cursor file `%s' does not contain cursor data" -msgstr "gösterge dosyasý '%s' gösterge verisi içermiyor" +msgstr "gösterge dosyası '%s' gösterge verisi içermiyor" -#: resrc.c:734 resrc.c:1047 +#: resrc.c:735 resrc.c:1048 #, c-format msgid "%s: fseek to %lu failed: %s" -msgstr "%s: %lu'ya fseek baþarýsýz: %s" +msgstr "%s: %lu'ya fseek baÅŸarısız: %s" -#: resrc.c:871 +#: resrc.c:872 msgid "help ID requires DIALOGEX" -msgstr "yardým ID için DIALOGEX gerekli" +msgstr "yardım ID için DIALOGEX gerekli" -#: resrc.c:873 +#: resrc.c:874 msgid "control data requires DIALOGEX" -msgstr "kontrol verisi için DIALOGEX gerekli" +msgstr "kontrol verisi için DIALOGEX gerekli" -#: resrc.c:1016 +#: resrc.c:1017 #, c-format msgid "icon file `%s' does not contain icon data" -msgstr "ikon dosyasý '%s' ikon verisi içermiyor" +msgstr "ikon dosyası '%s' ikon verisi içermiyor" -#: resrc.c:1535 +#: resrc.c:1536 #, c-format msgid "can't open `%s' for output: %s" -msgstr "'%s' çýktý için açýlamadý: %s" +msgstr "'%s' çıktı için açılamadı: %s" + +#: size.c:86 +msgid " Displays the sizes of sections inside binary files\n" +msgstr " Ä°kilik dosyalar içinde bölüm boylarını gösterir\n" + +#: size.c:87 +msgid " If no input file(s) are specified, a.out is assumed\n" +msgstr " EÄŸer girdi dosyası belirtilmezse, a.out varsayılır\n" -#: size.c:79 +#: size.c:88 #, c-format msgid "" -"Usage: %s [-A | --format=sysv | -B | --format=berkeley]\n" -" [-o | --radix=8 | -d | --radix=10 | -h | --radix=16]\n" -" [-V | --version] [--target=bfdname] [--help] [file...]\n" +" The options are:\n" +" -A|-B --format={sysv|berkeley} Select output style (default is %s)\n" +" -o|-d|-h --radix={8|10|16} Display numbers in octal, decimal or hex\n" +" -t --totals Display the total sizes (Berkeley only)\n" +" --target= Set the binary file format\n" +" -h --help Display this information\n" +" -v --version Display the program's version\n" +"\n" msgstr "" -"Kullaným: %s [-A | --format=sysv | -B | --format=berkeley] Biçem\n" -" [-o | --radix=8 | -d | --radix=10 | -h | --radix=16]\n" -" [-V | --version] Sürüm\n" -" [--target=bfd_adý] Hedef\n" -" [--help] Yardým\n" -" [dosya...] [dosya]\n" - -#: size.c:85 -msgid "default is --format=berkeley\n" -msgstr "--format=berkeley öntanýmlý\n" - -#: size.c:87 -msgid "default is --format=sysv\n" -msgstr "--format=sysv öntanýmlý\n" +" Seçenekler:\n" +" -A|-B --format={sysv|berkeley} Çıktı tarzını belirler (%s öntanımlı)\n" +" -o|-d|-h --radix={8|10|16} Rakamları sekizlik, onluk, onaltılık\n" +" olarak gösterir\n" +" -t --totals Toplam boyları gösterir (yalnız\n" +" Berkeley'de)\n" +" --target= Ä°kilik dosya biçemini belirler\n" +" -h --help Bu bilgileri gösterir\n" +" -v --version Sürüm bilgilerini gösterir\n" +"\n" -#: size.c:146 +#: size.c:160 #, c-format msgid "invalid argument to --format: %s" -msgstr "--format'a geçersiz seçenek: %s" +msgstr "--format'a geçersiz seçenek: %s" -#: size.c:173 +#: size.c:187 #, c-format msgid "Invalid radix: %s\n" -msgstr "Geçersiz radix: %s\n" +msgstr "Geçersiz radix: %s\n" -#: srconv.c:1931 -#, c-format -msgid "Usage: %s [-dhVq] in-file [out-file]\n" -msgstr "Kullaným: %s [-dhVq] girdi-dosyasý [çýktý-dosyasý]\n" +#: srconv.c:1953 +msgid "Convert a COFF object file into a SYSROFF object file\n" +msgstr "Bir COFF nesne dosyasını SYSROFF nesne dosyasına çevirir\n" -#: srconv.c:1938 -#, c-format -msgid "%s: Convert a COFF object file into a SYSROFF object file\n" -msgstr "%s: Bir COFF nesne dosyasýný SYSROFF nesne dosyasýna çevirir\n" +#: srconv.c:1954 +msgid "" +" The options are:\n" +" -q --quick (Obsolete - ignoerd)\n" +" -n --noprescan Do not perform a scan to convert commons into defs\n" +" -d --debug Display information about what is being done\n" +" -h --help Display this information\n" +" -v --version Print the program's version number\n" +msgstr "" +" Seçenekler:\n" +" -q --quick (Eski - yoksayılır)\n" +" -n --noprescan common'ları def'lere çevirmek için taramaz\n" +" -d --debug Ne yapıldığı hakkında bilgi verir\n" +" -h --help Bu bilgiyi gösterir\n" +" -v --version Sürüm numarasını gösterir\n" -#: srconv.c:2074 +#: srconv.c:2099 #, c-format msgid "unable to open output file %s" -msgstr "çýktý dosyasý %s açýlamadý" +msgstr "çıktı dosyası %s açılamadı" -#: stabs.c:343 stabs.c:1760 +#: stabs.c:343 stabs.c:1759 msgid "numeric overflow" -msgstr "sayýsal taþma" +msgstr "sayısal taÅŸma" #: stabs.c:354 #, c-format msgid "Bad stab: %s\n" -msgstr "Kötü stab: %s\n" +msgstr "Kötü stab: %s\n" #: stabs.c:364 #, c-format msgid "Warning: %s: %s\n" -msgstr "Uyarý: %s: %s\n" +msgstr "Uyarı: %s: %s\n" -#: stabs.c:486 +#: stabs.c:485 msgid "N_LBRAC not within function\n" -msgstr "N_LBRAC iþlev içerisinde deðil\n" +msgstr "N_LBRAC iÅŸlev içerisinde deÄŸil\n" -#: stabs.c:525 +#: stabs.c:524 msgid "Too many N_RBRACs\n" -msgstr "Fazla sayýda N_RBRAC\n" +msgstr "Fazla sayıda N_RBRAC\n" -#: stabs.c:770 +#: stabs.c:769 msgid "unknown C++ encoded name" -msgstr "Bilinmeyen C++ þifreli ismi" +msgstr "Bilinmeyen C++ ÅŸifreli ismi" #. Complain and keep going, so compilers can invent new #. cross-reference types. -#: stabs.c:1297 +#: stabs.c:1296 msgid "unrecognized cross reference type" -msgstr "tanýnmayan çapraz baþvuru tipi" +msgstr "tanınmayan çapraz baÅŸvuru tipi" #. Does this actually ever happen? Is that why we are worrying #. about dealing with it rather than just calling error_type? -#: stabs.c:1852 +#: stabs.c:1851 msgid "missing index type" msgstr "eksik endeks tipi" -#: stabs.c:2179 +#: stabs.c:2178 msgid "unknown virtual character for baseclass" -msgstr "temel sýnýf için bilinmeyen sanal karakter" +msgstr "temel sınıf için bilinmeyen sanal karakter" -#: stabs.c:2197 +#: stabs.c:2196 msgid "unknown visibility character for baseclass" -msgstr "temel sýnýf için bilinmeyen görünebilirlik karakteri" +msgstr "temel sınıf için bilinmeyen görünebilirlik karakteri" -#: stabs.c:2389 +#: stabs.c:2388 msgid "unnamed $vb type" -msgstr "isimlenmemiþ $vb tipi" +msgstr "isimlenmemiÅŸ $vb tipi" -#: stabs.c:2395 +#: stabs.c:2394 msgid "unrecognized C++ abbreviation" -msgstr "tanýnmayan C++ kýsaltmasý" +msgstr "tanınmayan C++ kısaltması" -#: stabs.c:2475 +#: stabs.c:2474 msgid "unknown visibility character for field" -msgstr "alan için bilinmeyen görünürlük karakteri" +msgstr "alan için bilinmeyen görünürlük karakteri" -#: stabs.c:2731 +#: stabs.c:2730 msgid "const/volatile indicator missing" -msgstr "sabit/deðiþken belirteci eksik" +msgstr "sabit/deÄŸiÅŸken belirteci eksik" -#: stabs.c:2971 +#: stabs.c:2970 #, c-format msgid "No mangling for \"%s\"\n" -msgstr "\"%s\" için karýþtýrma yok\n" +msgstr "\"%s\" için karıştırma yok\n" -#: stabs.c:3284 +#: stabs.c:3283 msgid "Undefined N_EXCL" -msgstr "N_EXCL tanýmsýz" +msgstr "N_EXCL tanımsız" -#: stabs.c:3372 +#: stabs.c:3371 #, c-format msgid "Type file number %d out of range\n" -msgstr "Tip dosya numarasý %d aralýk dýþý\n" +msgstr "Tip dosya numarası %d aralık dışı\n" -#: stabs.c:3377 +#: stabs.c:3376 #, c-format msgid "Type index number %d out of range\n" -msgstr "Tip endeks numarasý %d aralýk dýþý\n" +msgstr "Tip endeks numarası %d aralık dışı\n" -#: stabs.c:3464 +#: stabs.c:3463 #, c-format msgid "Unrecognized XCOFF type %d\n" msgstr "Bilinmeyen XCOFF tipi %d\n" -#: stabs.c:3763 +#: stabs.c:3762 #, c-format msgid "bad mangled name `%s'\n" -msgstr "kötü karýþtýrýlmýþ isim '%s'\n" +msgstr "kötü karıştırılmış isim '%s'\n" -#: stabs.c:3859 +#: stabs.c:3858 msgid "no argument types in mangled string\n" -msgstr "karýþtýrýlmýþ dizgede argüman tipi yok\n" +msgstr "karıştırılmış dizgede argüman tipi yok\n" -#: strings.c:199 +#: strings.c:200 #, c-format msgid "invalid number %s" -msgstr "geçersiz sayý %s" +msgstr "geçersiz sayı %s" -#: strings.c:638 +#: strings.c:640 #, c-format msgid "invalid integer argument %s" -msgstr "geçersiz tamsayý argümaný %s" +msgstr "geçersiz tamsayı argümanı %s" -#: strings.c:648 -#, c-format +#: strings.c:651 +msgid " Display printable strings in [file(s)] (stdin by default)\n" +msgstr " [dosya(lar)]daki yazdırılabilir dizgeleri gösterir (öntanımlı standart girdi)\n" + +#: strings.c:652 msgid "" -"Usage: %s [-afov] [-n min-len] [-min-len] [-t {o,x,d}] [-e {s,b,l,B,L}]\n" -" [-] [--all] [--print-file-name] [--bytes=min-len] [--radix={o,x,d}]\n" -" [--target=bfdname] [--encoding {s,b,l,B,L}] [--help] [--version] file...\n" +" The options are:\n" +" -a - --all Scan the entire file, not just the data section\n" +" -f --print-file-name Print the name of the file before each string\n" +" -n --bytes=[number] Locate & print any NUL-terminated sequence of at\n" +" - least [number] characters (default 4).\n" +" -t --radix={o,x,d} Print the location of the string in base 8, 10 or 16\n" +" -o An alias for --radix=o\n" +" -T --target= Specify the binary file format\n" +" -e --encoding={s,b,l,B,L} Select character size and endianness:\n" +" s = 8-bit, {b,l} = 16-bit, {B,L} = 32-bit\n" +" -h --help Display this information\n" +" -v --version Print the program's version number\n" msgstr "" -"Kullaným: %s [-afov] [-n min-uzun] [-min-len] En az uzunluk\n" -" [-t {o,x,d}] [-e {s,b,l,B,L}] [-]\n" -" [--all] Hepsi\n" -" [--print-file-name] Dosya adýný yazdýrýr\n" -" [--bytes=min-uzun] En az bayt\n" -" [--radix={o,x,d}]\n" -" [--target=bfd_adý] Hedef\n" -" [--encoding {s,b,l,B,L}] Kodlama\n" -" [--help] Yardým\n" -" [--version] Sürüm bilgisi\n" -" dosya... \n" +" Seçenekler:\n" +" -a - --all Yalnız veri bölümünü deÄŸil, bütün dosyayı tarar\n" +" -f --print-file-name Her dizgeden önce dosya adını yazdırır\n" +" -n --bytes=[sayı] En az [sayı] karakterde ve NUL ile sonlanmış olan\n" +" - bütün dizgeleri yazdırır (öntanımlı 4)\n" +" -t --radix={o,x,d} Dizgenin yerini 8'lik, 10'luk veya 16'lık düzende\n" +" yazdırır\n" +" -o --radix=o ile aynı\n" +" -T --target= Ä°kilik dosya biçemini belirtir\n" +" -e --encoding={s,b,l,B,L} Karakter boyu ve sonlamayı seçtirir:\n" +" s = 8-bit, {b,l} = 16-bit, {B,L} = 32-bit\n" +" -h --help Bu bilgiyi gösterir\n" +" -v --version Yazılımın sürüm no'sunu gösterir\n" + +#: sysdump.c:768 +msgid "Print a human readable interpretation of a SYSROFF object file\n" +msgstr "SYSROFF nesne dosyasını insan tarafından okunabilir biçemde yazdırır\n" -#: sysdump.c:733 -#, c-format -msgid "Usage: %s [-hV] in-file\n" -msgstr "Kullaným: %s [-hV] girdi-dosyasý\n" +#: sysdump.c:769 +msgid "" +" The options are:\n" +" -h --help Display this information\n" +" -v --version Print the program's version number\n" +msgstr "" +" Seçenekler:\n" +" -h --help Bu bilgiyi gösterir\n" +" -v --version Yazılımın sürüm no'sunu gösterir\n" -#: sysdump.c:805 +#: sysdump.c:836 #, c-format msgid "cannot open input file %s" -msgstr "%s girdi dosyasý açýlamadý" +msgstr "%s girdi dosyası açılamadı" #: version.c:35 -msgid "Copyright 2001 Free Software Foundation, Inc.\n" -msgstr "Telif Hakký (c) 2001 Free Software Foundation, Inc.\n" +msgid "Copyright 2002 Free Software Foundation, Inc.\n" +msgstr "Telif Hakkı (c) 2002 Free Software Foundation, Inc.\n" #: version.c:36 msgid "" "This program is free software; you may redistribute it under the terms of\n" "the GNU General Public License. This program has absolutely no warranty.\n" msgstr "" -"Bu, bir serbest yazýlýmdýr; GNU Genel Kamu Lisansý koþullarý altýnda deðiþiklik \n" -"yapabilir ve/veya yeniden daðýtabilirsiniz. \n" -"Bu yazýlýmýn herhangi bir garantisi yoktur.\n" +"Bu, bir serbest yazılımdır; GNU Genel Kamu Lisansı koÅŸulları altında deÄŸiÅŸiklik \n" +"yapabilir ve/veya yeniden dağıtabilirsiniz. \n" +"Bu yazılımın herhangi bir garantisi yoktur.\n" -#: windres.c:237 +#: windres.c:239 #, c-format msgid "can't open %s `%s': %s" -msgstr "%s `%s' açýlamadý: %s" +msgstr "%s `%s' açılamadı: %s" -#: windres.c:416 +#: windres.c:418 msgid ": expected to be a directory\n" msgstr ": dizin beklendi\n" -#: windres.c:428 +#: windres.c:430 msgid ": expected to be a leaf\n" msgstr ": yaprak beklendi\n" -#: windres.c:437 +#: windres.c:439 #, c-format msgid "%s: warning: " -msgstr "%s: uyarý: " +msgstr "%s: uyarı: " -#: windres.c:439 +#: windres.c:441 msgid ": duplicate value\n" -msgstr ": çift deðer\n" +msgstr ": çift deÄŸer\n" #: windres.c:602 #, c-format msgid "unknown format type `%s'" -msgstr "bilinmeyen biçem tipi `%s'" +msgstr "bilinmeyen biçem tipi `%s'" #: windres.c:603 #, c-format msgid "%s: supported formats:" -msgstr "%s: desteklenen biçemler:" +msgstr "%s: desteklenen biçemler:" #. Otherwise, we give up. -#: windres.c:690 +#: windres.c:688 #, c-format msgid "can not determine type of file `%s'; use the -I option" -msgstr "`%s' dosyasýnýn tipi belirlenemedi; -I seçeneðini kullanýn" +msgstr "`%s' dosyasının tipi belirlenemedi; -I seçeneÄŸini kullanın" -#: windres.c:704 +#: windres.c:702 #, c-format -msgid "Usage: %s [options] [input-file] [output-file]\n" -msgstr "Kullaným: %s [seçenekler] [girdi-dosyasý] [çýktý-dosyasý]\n" +msgid "Usage: %s [option(s)] [input-file] [output-file]\n" +msgstr "Kullanım: %s [seçenekler] [girdi-dosyası] [çıktı-dosyası]\n" -#: windres.c:706 +#: windres.c:704 msgid "" -"Options:\n" -" -i FILE, --input FILE Name input file\n" -" -o FILE, --output FILE Name output file\n" -" -I FORMAT, --input-format FORMAT\n" -" Specify input format\n" -" -O FORMAT, --output-format FORMAT\n" -" Specify output format\n" -" -F TARGET, --target TARGET Specify COFF target\n" -" --preprocessor PROGRAM Program to use to preprocess rc file\n" -" --include-dir DIR Include directory when preprocessing rc file\n" -" -DSYM[=VAL], --define SYM[=VAL]\n" -" Define SYM when preprocessing rc file\n" -" -v Verbose - tells you what it's doing\n" -" --language VAL Set language when reading rc file\n" -" --use-temp-file Use a temporary file instead of popen to read\n" -" the preprocessor output\n" -" --no-use-temp-file Use popen (default)\n" -msgstr "" -"Seçenekler:\n" -" -i DOSYA, --input DOSYA Girdi dosyasý ismi\n" -" -o DOSYA, --output DOSYA Çýktý dosyasý ismi\n" -" -I BÝÇEM, --input-format BÝÇEM\n" -" Girdi biçemini belirtir\n" -" -O BÝÇEM, --output-format BÝÇEM\n" -" Çýktý biçemini belirtir\n" -" -F HEDEF, --target HEDEF COFF hedefini belirtir\n" -" --preprocessor YAZILIM rc dosyasýný öniþlemek için kullanýlacak yazýlým\n" -" --include-dir DÝZÝN rc dosyasý öniþlenirken dizini dahil et\n" -" -DSYM[=DEÐER], --define SYM[=DEÐER]\n" -" rc dosyasý öniþlenirken SYM'i tanýmlar\n" -" -v Açýklamalý - ne yapýldýðýný anlatýr\n" -" --language DEÐER rc dosyasý okunurken dili belirtir\n" -" --use-temp-file Öniþlemci çýktýsýný okumak için popen yerine geçici dosya kullanýr\n" -" --no-use-temp-file (öntanýmlý) popen kullanýr\n" - -#: windres.c:725 -msgid " --yydebug Turn on parser debugging\n" -msgstr " --yydebug Tarayýcýda hata ayýklamayý etkinleþtirir\n" +" The options are:\n" +" -i --input= Name input file\n" +" -o --output= Name output file\n" +" -I --input-format= Specify input format\n" +" -O --output-format= Specify output format\n" +" -F --target= Specify COFF target\n" +" --preprocessor= Program to use to preprocess rc file\n" +" --include-dir= Include directory when preprocessing rc file\n" +" -D --define [=] Define SYM when preprocessing rc file\n" +" -v --verbose Verbose - tells you what it's doing\n" +" --language= Set language when reading rc file\n" +" --use-temp-file Use a temporary file instead of popen to read\n" +" the preprocessor output\n" +" --no-use-temp-file Use popen (default)\n" +msgstr "" +"Seçenekler:\n" +" -i --input= Girdi dosyası ismi\n" +" -o --output= Çıktı dosyası ismi\n" +" -I --input-format= Girdi biçemini belirtir\n" +" -O --output-format= Çıktı biçemini belirtir\n" +" -F --target= COFF hedefini belirtir\n" +" --preprocessor= rc dosyasını öniÅŸlemek için kullanılacak yazılım\n" +" --include-dir= rc dosyası öniÅŸlenirken dizini dahil et\n" +" -D --define SYM[=DEÄžER] rc dosyası öniÅŸlenirken SYM'i tanımlar\n" +" -v --verbose Açıklamalı - ne yapıldığını anlatır\n" +" --language= rc dosyası okunurken dili belirtir\n" +" --use-temp-file ÖniÅŸlemci çıktısını okumak için popen yerine\n" +" geçici dosya kullanır\n" +" --no-use-temp-file (öntanımlı) popen kullanır\n" + +#: windres.c:719 +msgid " --yydebug Turn on parser debugging\n" +msgstr " --yydebug Tarayıcıda hata ayıklamayı etkinleÅŸtirir\n" -#: windres.c:728 +#: windres.c:722 msgid "" -" --help Print this help message\n" -" --version Print version information\n" +" -h --help Print this help message\n" +" -V --version Print version information\n" msgstr "" -" --help Bu yardýmý gösterir\n" -" --version Sürüm bilgisini gösterir\n" +" -h --help Bu yardımı gösterir\n" +" -V --version Bu sürüm bilgisini gösterir\n" -#: windres.c:731 +#: windres.c:725 msgid "" "FORMAT is one of rc, res, or coff, and is deduced from the file name\n" "extension if not specified. A single file name is an input file.\n" "No input-file is stdin, default rc. No output-file is stdout, default rc.\n" msgstr "" -"BÝÇEM rc, res, veya coff deðerlerinden biri olup, eðer belirtilmezse dosya ismi sonekinden bulunur. Tek bir dosya ismi bir girdi dosyasý kabul edilir\n" -"Girdi dosya ismi verilmezse standart girdi, öntanýmlý rc okunur. \n" -"Çýktý dosya ismi verilmezse standart çýktý, öntanýmlý rc okunur.\n" +"BİÇEM rc, res, veya coff deÄŸerlerinden biri olup, eÄŸer belirtilmezse dosya ismi sonekinden bulunur. Tek bir dosya ismi bir girdi dosyası kabul edilir\n" +"Girdi dosya ismi verilmezse standart girdi, öntanımlı rc okunur. \n" +"Çıktı dosya ismi verilmezse standart çıktı, öntanımlı rc okunur.\n" -#: windres.c:983 +#: windres.c:988 msgid "no resources" msgstr "kaynak yok" -#: wrstabs.c:366 wrstabs.c:2027 +#: wrstabs.c:366 wrstabs.c:2026 #, c-format msgid "string_hash_lookup failed: %s" -msgstr "string_hash_lookup baþarýsýz: %s" +msgstr "string_hash_lookup baÅŸarısız: %s" #: wrstabs.c:666 #, c-format msgid "stab_int_type: bad size %u" -msgstr "stab_int_type: hatalý boy %u" +msgstr "stab_int_type: hatalı boy %u" -#: wrstabs.c:1467 +#: wrstabs.c:1466 #, c-format msgid "%s: warning: unknown size for field `%s' in struct" -msgstr "%s: uyarý: Yapý içinde `%s' alaný için bilinmeyen boy" +msgstr "%s: uyarı: Yapı içinde `%s' alanı için bilinmeyen boy" + +#~ msgid "" +#~ "Usage: %s [-CfsHV] [-b bfdname] [--target=bfdname]\n" +#~ " [-e executable] [--exe=executable] [--demangle[=style]]\n" +#~ " [--basenames] [--functions] [addr addr ...]\n" +#~ msgstr "" +#~ "Kullanım: %s [-CfsHV] [-b bfd_adı] \n" +#~ " [--target=bfd_adı] hedef\n" +#~ " [-e uygulama] [--exe=uygulama] \n" +#~ " [--demangle[=tarz]] düzeltme tarzı\n" +#~ " [--basenames] temel isimler\n" +#~ " [--functions] [adres adres ...] iÅŸlevler\n" + +#~ msgid "" +#~ "Usage: %s [-dhV] [-I bfdname] [-O bfdname] [-T header-file] [-l linker]\n" +#~ " [--input-target=bfdname] [--output-target=bfdname]\n" +#~ " [--header-file=file] [--linker=linker] [--debug]\n" +#~ " [--help] [--version]\n" +#~ " [in-file [out-file]]\n" +#~ msgstr "" +#~ "Kullanım: %s [-dhV] [-I bfd_adı] [-O bfd_adı] [-T baÅŸlık-dosyası]\n" +#~ " [-l baÄŸlayıcı]\n" +#~ " [--input-target=bfd_adı] girdi dosyası adı\n" +#~ " [--output-target=bfd_adı] çıktı dosyası adı\n" +#~ " [--header-file=dosya] baÅŸlık dosyası adı\n" +#~ " [--linker=baÄŸlayıcı] baÄŸlayıcı yazılım adı\n" +#~ " [--debug] hata ayıklama kipi\n" +#~ " [--help] bu yardımı gösterir\n" +#~ " [--version] sürüm bilgisini gösterir\n" +#~ " [girdi-dosyası [çıktı-dosyası]]\n" + +#~ msgid "Usage: %s [OPTION]... [FILE]...\n" +#~ msgstr "Kullanım: %s [SEÇENEK]... [DOSYA]...\n" + +#~ msgid "Usage: %s OPTION... FILE...\n" +#~ msgstr "Kullanım: %s SEÇENEK... DOSYA...\n" + +#~ msgid " Options are:\n" +#~ msgstr " Seçenekler:\n" + +#~ msgid " -a or --all Equivalent to: -h -l -S -s -r -d -V -A -I\n" +#~ msgstr " -a veya --all Buna eÅŸit: -h -l -S -s -r -d -V -A -I\n" + +#~ msgid " -h or --file-header Display the ELF file header\n" +#~ msgstr " -h veya --file-header ELF dosyası baÅŸlığını gösterir\n" + +#~ msgid " -l or --program-headers or --segments\n" +#~ msgstr " -l veya --program-headers veya --segments\n" + +#~ msgid " Display the program headers\n" +#~ msgstr " Yazılım baÅŸlıklarını gösterir\n" + +#~ msgid " -S or --section-headers or --sections\n" +#~ msgstr " -S veya --section-headers veya --sections\n" + +#~ msgid " Display the sections' header\n" +#~ msgstr " Bölüm baÅŸlıklarını gösterir\n" + +#~ msgid " -e or --headers Equivalent to: -h -l -S\n" +#~ msgstr " -e veya --headers Buna eÅŸit: -h -l -S\n" + +#~ msgid " -s or --syms or --symbols Display the symbol table\n" +#~ msgstr " -s veya --syms veya --symbols Sembol tablosunu gösterir\n" + +#~ msgid " -n or --notes Display the core notes (if present)\n" +#~ msgstr " -n veya --notes (EÄŸer varsa) core notlarını gösterir\n" + +#~ msgid " -r or --relocs Display the relocations (if present)\n" +#~ msgstr " -r veya --relocs (EÄŸer varsa) yer deÄŸiÅŸtirmeleri gösterir\n" + +#~ msgid " -u or --unwind Display the unwind info (if present)\n" +#~ msgstr " -u veya --unwind (EÄŸer varsa) geri alma bilgisini gösterir\n" + +#~ msgid " -d or --dynamic Display the dynamic segment (if present)\n" +#~ msgstr " -d veya --dynamic (EÄŸer varsa) dinamik bölümü gösterir\n" + +#~ msgid " -V or --version-info Display the version sections (if present)\n" +#~ msgstr " -V veya --version-info (EÄŸer varsa) sürüm bölümlerini gösterir\n" + +#~ msgid " -A or --arch-specific Display architecture specific information (if any).\n" +#~ msgstr " -A veya --arch-specific (EÄŸer varsa) mimariye özel bilgiyi gösterir.\n" + +#~ msgid " -D or --use-dynamic Use the dynamic section info when displaying symbols\n" +#~ msgstr " -D veya --use-dynamic Sembolleri gösterirken dinamik bölüm bilgisini kullanır\n" + +#~ msgid " -x or --hex-dump=\n" +#~ msgstr " -x veya --hex-dump=\n" + +#~ msgid " Dump the contents of section \n" +#~ msgstr " bölümünün içeriÄŸini gösterir\n" + +#~ msgid " -w[liaprmfs] or --debug-dump[=line,=info,=abbrev,=pubnames,=ranges,=macro,=frames,=str]\n" +#~ msgstr " -w[liaprmfs] veya --debug-dump[=line,=info,=abbrev,=pubnames,=ranges,=macro,=frames,=str]\n" + +#~ msgid " Display the contents of DWARF2 debug sections\n" +#~ msgstr " DWARF2 hata ayıklama bölümlerinin içeriÄŸini gösterir\n" + +#~ msgid " -i or --instruction-dump=\n" +#~ msgstr " -i veya --instruction-dump=\n" + +#~ msgid " -I or --histogram Display histogram of bucket list lengths\n" +#~ msgstr " -I veya --histogram Küme liste uzunluÄŸu geçmiÅŸ grafiÄŸini gösterir\n" + +#~ msgid " -v or --version Display the version number of readelf\n" +#~ msgstr " -v veya --version readelf'in sürüm numarasını gösterir\n" + +#~ msgid " -W or --wide Don't split lines or truncate symbols to fit into 80 columns\n" +#~ msgstr " -W veya --wide 80 sütuna sığdırmak için satırları bölmez veya kesmez\n" + +#~ msgid " -H or --help Display this information\n" +#~ msgstr " -H veya --help Bu bilgiyi gösterir\n" + +#~ msgid "unexpected dialog signature %d" +#~ msgstr "beklenmeyen diyalog imzası %d" + +#~ msgid "" +#~ "Usage: %s [-A | --format=sysv | -B | --format=berkeley]\n" +#~ " [-o | --radix=8 | -d | --radix=10 | -h | --radix=16]\n" +#~ " [-V | --version] [--target=bfdname] [--help] [file...]\n" +#~ msgstr "" +#~ "Kullanım: %s [-A | --format=sysv | -B | --format=berkeley] Biçem\n" +#~ " [-o | --radix=8 | -d | --radix=10 | -h | --radix=16]\n" +#~ " [-V | --version] Sürüm\n" +#~ " [--target=bfd_adı] Hedef\n" +#~ " [--help] Yardım\n" +#~ " [dosya...] [dosya]\n" + +#~ msgid "default is --format=berkeley\n" +#~ msgstr "--format=berkeley öntanımlı\n" + +#~ msgid "default is --format=sysv\n" +#~ msgstr "--format=sysv öntanımlı\n" + +#~ msgid "Usage: %s [-dhVq] in-file [out-file]\n" +#~ msgstr "Kullanım: %s [-dhVq] girdi-dosyası [çıktı-dosyası]\n" + +#~ msgid "" +#~ "Usage: %s [-afov] [-n min-len] [-min-len] [-t {o,x,d}] [-e {s,b,l,B,L}]\n" +#~ " [-] [--all] [--print-file-name] [--bytes=min-len] [--radix={o,x,d}]\n" +#~ " [--target=bfdname] [--encoding {s,b,l,B,L}] [--help] [--version] file...\n" +#~ msgstr "" +#~ "Kullanım: %s [-afov] [-n min-uzun] [-min-len] En az uzunluk\n" +#~ " [-t {o,x,d}] [-e {s,b,l,B,L}] [-]\n" +#~ " [--all] Hepsi\n" +#~ " [--print-file-name] Dosya adını yazdırır\n" +#~ " [--bytes=min-uzun] En az bayt\n" +#~ " [--radix={o,x,d}]\n" +#~ " [--target=bfd_adı] Hedef\n" +#~ " [--encoding {s,b,l,B,L}] Kodlama\n" +#~ " [--help] Yardım\n" +#~ " [--version] Sürüm bilgisi\n" +#~ " dosya... \n" + +#~ msgid "Usage: %s [-hV] in-file\n" +#~ msgstr "Kullanım: %s [-hV] girdi-dosyası\n" diff -Nurpa binutils-2.13/binutils/rcparse.c binutils-2.13.1/binutils/rcparse.c --- binutils-2.13/binutils/rcparse.c 2002-08-05 16:43:45.000000000 -0400 +++ binutils-2.13.1/binutils/rcparse.c 2002-10-30 12:02:38.000000000 -0500 @@ -791,7 +791,7 @@ static const short yycheck[] = 10, 11, 51, 52, 53, 54, 55, 56 }; /* -*-C-*- Note some compilers choke on comments on `#line' lines. */ -#line 3 "/usr/share/bison/bison.simple" +#line 3 "/usr/share/bison-1.35/bison.simple" /* Skeleton output parser for bison, @@ -1104,7 +1104,7 @@ yystpcpy (yydest, yysrc) # endif #endif -#line 315 "/usr/share/bison/bison.simple" +#line 315 "/usr/share/bison-1.35/bison.simple" /* The user can define YYPARSE_PARAM as the name of an argument to be passed @@ -1546,7 +1546,7 @@ case 21: yyval.acc.id = yyvsp[-2].il; yyval.acc.flags |= yyvsp[0].is; if ((yyval.acc.flags & ACC_VIRTKEY) == 0 - && (yyval.acc.flags & (ACC_SHIFT | ACC_CONTROL | ACC_ALT)) != 0) + && (yyval.acc.flags & (ACC_SHIFT | ACC_CONTROL)) != 0) rcparse_warning (_("inappropriate modifiers for non-VIRTKEY")); } break; @@ -3203,7 +3203,7 @@ case 244: break; } -#line 705 "/usr/share/bison/bison.simple" +#line 705 "/usr/share/bison-1.35/bison.simple" yyvsp -= yylen; diff -Nurpa binutils-2.13/binutils/rcparse.y binutils-2.13.1/binutils/rcparse.y --- binutils-2.13/binutils/rcparse.y 2002-05-05 19:19:32.000000000 -0400 +++ binutils-2.13.1/binutils/rcparse.y 2002-09-23 18:13:11.000000000 -0400 @@ -219,7 +219,7 @@ acc_entry: $$.id = $2; $$.flags |= $4; if (($$.flags & ACC_VIRTKEY) == 0 - && ($$.flags & (ACC_SHIFT | ACC_CONTROL | ACC_ALT)) != 0) + && ($$.flags & (ACC_SHIFT | ACC_CONTROL)) != 0) rcparse_warning (_("inappropriate modifiers for non-VIRTKEY")); } ; diff -Nurpa binutils-2.13/binutils/readelf.c binutils-2.13.1/binutils/readelf.c --- binutils-2.13/binutils/readelf.c 2002-07-30 14:18:08.000000000 -0400 +++ binutils-2.13.1/binutils/readelf.c 2002-10-28 13:45:47.000000000 -0500 @@ -7949,7 +7949,8 @@ display_debug_info (section, start, file Elf_Internal_Sym *sym; if (relsec->sh_type != SHT_RELA - || SECTION_HEADER (relsec->sh_info) != section) + || SECTION_HEADER (relsec->sh_info) != section + || relsec->sh_size == 0) continue; if (!slurp_rela_relocs (file, relsec->sh_offset, relsec->sh_size, @@ -7970,7 +7971,8 @@ display_debug_info (section, start, file { sym = symtab + ELF32_R_SYM (rp->r_info); - if (ELF32_ST_TYPE (sym->st_info) != STT_SECTION) + if (ELF32_R_SYM (rp->r_info) != 0 + && ELF32_ST_TYPE (sym->st_info) != STT_SECTION) { warn (_("Skipping unexpected symbol type %u\n"), ELF32_ST_TYPE (sym->st_info)); @@ -7981,7 +7983,8 @@ display_debug_info (section, start, file { sym = symtab + ELF64_R_SYM (rp->r_info); - if (ELF64_ST_TYPE (sym->st_info) != STT_SECTION) + if (ELF64_R_SYM (rp->r_info) != 0 + && ELF64_ST_TYPE (sym->st_info) != STT_SECTION) { warn (_("Skipping unexpected symbol type %u\n"), ELF64_ST_TYPE (sym->st_info)); @@ -7989,7 +7992,7 @@ display_debug_info (section, start, file } } - compunit.cu_abbrev_offset += rp->r_addend; + compunit.cu_abbrev_offset = rp->r_addend; break; } diff -Nurpa binutils-2.13/gas/ChangeLog binutils-2.13.1/gas/ChangeLog --- binutils-2.13/gas/ChangeLog 2002-08-01 22:03:08.000000000 -0400 +++ binutils-2.13.1/gas/ChangeLog 2002-11-06 19:44:22.000000000 -0500 @@ -1,3 +1,189 @@ +2002-11-06 Richard Henderson + + * config/tc-alpha.c (alpha_validate_fix): Move code ... + (alpha_fix_adjustable): ... here. + * config/tc-alpha.h (TC_VALIDATE_FIX): Remove. + +2002-11-05 H.J. Lu + + * config/tc-mips.c (support_64bit_objects): Check *l before it + is freed. + +2002-10-31 David O'Brien + + * config/tc-ia64.c: Cast dwarf2_directive_file to int. + * config/tc-sparc.c: Likewise. + * config/tc-alpha.c: Cast s_alpha_file to int. + * config/tc-alpha.h (TC_INIT_FIX_DATA): info is of type struct + alpha_reloc_tag. + +2002-10-30 Daniel Jacobowitz + + * configure.in: Update ARM CPU patterns. + * configure: Regenerated. + +2002-10-30 Daniel Jacobowitz + + * po/gas.pot: Regenerated. + +2002-10-29 Daniel Jacobowitz + + * itbl-lex.l: Use #include <> for generated headers. + * itbl-ops.c: Likewise. + +2002-08-24 Andreas Schwab + + * config/tc-m68k.c (tc_m68k_fix_adjustable): Don't adjust symbols + in merge sections. + +2002-10-28 Daniel Jacobowitz + + * doc/gasp.texi: Fix typo in last typo fix. + +2002-10-28 Daniel Jacobowitz + + Merge from mainline: + 2002-10-21 Richard Sandiford + * config/tc-mips.c (mips_need_elf_addend_fixup): Return true + for relocs against symbols in a merged section. + + Thu Oct 10 14:31:30 2002 J"orn Rennecke + * config/tc-sh.c (assemble_ppi): Initialize reg_x / reg_y / reg_n + inside loop. + +2002-10-17 Johannes Stezenbach + + * itbl-parse.y (entry): Provide empty action. + +2002-10-14 Momchil Velikov + + * config/tc-v850.c (CHECK_): Remove token pasting operator. + +2002-10-11 David O'Brien + + * gas/gasp.texi: Fix typo in noting that gasp is now deprecated. + +2002-10-11 Michel Six + Alan Modra + + * config/tc-i386.c (output_jump): Set fx_signed for loop/jcxz. + (md_estimate_size_before_relax): Likewise for 8 bit branches. + +2002-09-24 Alan Modra + + * config/tc-i386.c (process_operands): Warn about "lea" segment + overrides. + +2002-09-23 Daniel Jacobowitz + + Merge from mainline: + 2002-09-22 Mark Elbrecht + * write.c: Delete set_segment_vma and prototype. Update all callers. + + 2002-09-19 Jakub Jelinek + * config/tc-i386.c (tc_i386_fix_adjustable): Handle + BFD_RELOC_386_TLS_IE and BFD_RELOC_386_TLS_GOTIE. + (BFD_RELOC_386_TLS_IE, BFD_RELOC_386_TLS_GOTIE): Define to 0 + if not defined. + (lex_got): Handle @GOTNTPOFF and @INDNTPOFF. + (md_apply_fix3, tc_gen_reloc): Handle BFD_RELOC_386_TLS_IE and + BFD_RELOC_386_TLS_GOTIE. + + 2002-09-16 Chris Demetriou + * config/tc-mips.c (IS_SEXT_32BIT_NUM): Move closer to top of file. + (IS_SEXT_16BIT_NUM): New macro. + (macro_build_ldst_constoffset): New function, to build a set of + instructions to do a load or store from a constant offset relative + to a given register. + (macro, s_cprestore): Use macro_build_ldst_constoffset to implement + .cprestore pseudo-op. + + 2002-09-16 Elias Athanasopoulos + * dwarf2dbg.c (out_debug_abbrev): Add support for the DW_AT_name field. + (out_debug_info): Likewise. + + 2002-09-13 Nick Clifton + * config/tc-ppc.c (md_assemble): Do not count FAKE operands + when deciding if any operands have been skipped. + + 2002-09-11 Jakub Jelinek + * config/tc-i386.c (md_apply_fix3): Allow addend for + BFD_RELOC_386_TLS_LDO_32, BFD_RELOC_386_TLS_LE and + BFD_RELOC_386_TLS_LE_32. + + 2002-09-11 Nick Clifton + * po/tr.po: Updated Turkish translation. + + 2002-09-04 Nick Clifton + * config/tc-ppc.c (md_begin): Do not insert non-BookE32 + instructions into the hash table if the target cpu is the BookE32. + + 2002-08-20 Richard Sandiford + * config/tc-mips.c (macro2): Implement rotates by zero using shifts + by zero. + + 2002-08-15 Alexandre Oliva + * config/tc-mips.c (macro_build_jalr): Make sure we generate + the fix-up against on the right frag. + (s_cpsetup): Likewise. Parse third argument as expression, to + handle global symbols and forward/backward labels correctly. + + 2002-08-14 Nick Clifton + * read.c (stringer): Catch attempts to create strings in the abs + section. + + 2002-08-12 Richard Sandiford + * config/tc-mips.c (mips_ip): Don't work out the value of + constant %hi()s here. + + 2002-08-10 Alan Modra + * config/tc-i386.c (tc_i386_fix_adjustable): Test OUTPUT_FLAVOR + for ELF, and don't bother checking ELF relocs when non-ELF. + (i386_immediate): Allow absolute_section expressions for aout. + (i386_displacement): Likewise. Also test bfd_is_com_section. + (md_estimate_size_before_relax): Test OUTPUT_FLAVOR for ELF. + (md_apply_fix3): Hack for bfd_install_relocation when fx_pcrel, + not when fx_addsy. Remove dead code. + + 2002-08-06 George France + * config/tc-alpha.c (cpu_types): Enabled ev67, ev68, -m21264a + and m21264b processor names and cpu types. + * doc/c-alpha.texi: Documented new types. + + 2002-08-06 Alan Modra + * config/tc-ppc.c (md_apply_fix3): Adjust 16 bit XCOFF reloc offset. + + 2002-08-03 Jakub Jelinek + * config/tc-i386.c (output_insn): Save frag_now and frag_now_fix () + at start of insn, pass it to output_disp and output_imm. + (output_disp): Added arguments. If _GLOBAL_OFFSET_TABLE_ is seen + in displacement for R_386_32 reloc, use R_386_GOTPC and compute + properly addend. + (output_imm): Added arguments. Compute properly addend for + R_386_GOTPC. + (md_apply_fix3): Remove R_386_GOTPC handling. + + 2002-07-31 Momchil Velikov + * config/tc-v850.c (md_assemble): Fix range check for immediate + operand. + + 2002-07-04 Bruno Haible + * config/tc-i386.h (ELF_TARGET_FORMAT): New macro. + (TARGET_FORMAT): Use ELF_TARGET_FORMAT instead of "elf32-i386". + * config/tc-i386.c (i386_target_format): Likewise. + * config/tc-alpha.h (ELF_TARGET_FORMAT): New macro. + (TARGET_FORMAT): Use ELF_TARGET_FORMAT instead of "elf64-alpha". + +2002-08-26 Alan Modra + + * config/tc-w65.c (md_section_align): Fix typo. + (md_parse_option): Return 0, not 1. + +2002-08-20 Maciej W. Rozycki + + * config/tc-mips.c (macro): Handle a register plus a 16-bit + immediate offset in "dla" and "la" expansions. + 2002-08-01 Daniel Jacobowitz Merge from mainline: diff -Nurpa binutils-2.13/gas/config/tc-alpha.c binutils-2.13.1/gas/config/tc-alpha.c --- binutils-2.13/gas/config/tc-alpha.c 2002-06-02 04:36:10.000000000 -0400 +++ binutils-2.13.1/gas/config/tc-alpha.c 2002-11-06 19:44:23.000000000 -0500 @@ -576,6 +576,10 @@ static const struct cpu_type { |AXP_OPCODE_MAX) }, { "21264", (AXP_OPCODE_BASE|AXP_OPCODE_EV6|AXP_OPCODE_BWX |AXP_OPCODE_MAX|AXP_OPCODE_CIX) }, + { "21264a", (AXP_OPCODE_BASE|AXP_OPCODE_EV6|AXP_OPCODE_BWX + |AXP_OPCODE_MAX|AXP_OPCODE_CIX) }, + { "21264b", (AXP_OPCODE_BASE|AXP_OPCODE_EV6|AXP_OPCODE_BWX + |AXP_OPCODE_MAX|AXP_OPCODE_CIX) }, { "ev4", AXP_OPCODE_BASE }, { "ev45", AXP_OPCODE_BASE }, @@ -584,6 +588,8 @@ static const struct cpu_type { { "ev56", AXP_OPCODE_BASE|AXP_OPCODE_BWX }, { "pca56", AXP_OPCODE_BASE|AXP_OPCODE_BWX|AXP_OPCODE_MAX }, { "ev6", AXP_OPCODE_BASE|AXP_OPCODE_BWX|AXP_OPCODE_MAX|AXP_OPCODE_CIX }, + { "ev67", AXP_OPCODE_BASE|AXP_OPCODE_BWX|AXP_OPCODE_MAX|AXP_OPCODE_CIX }, + { "ev68", AXP_OPCODE_BASE|AXP_OPCODE_BWX|AXP_OPCODE_MAX|AXP_OPCODE_CIX }, { "all", AXP_OPCODE_BASE }, { 0, 0 } @@ -1102,9 +1108,9 @@ md_show_usage (stream) Alpha options:\n\ -32addr treat addresses as 32-bit values\n\ -F lack floating point instructions support\n\ --mev4 | -mev45 | -mev5 | -mev56 | -mpca56 | -mev6 | -mall\n\ +-mev4 | -mev45 | -mev5 | -mev56 | -mpca56 | -mev6 | -mev67 | -mev68 | -mall\n\ specify variant of Alpha architecture\n\ --m21064 | -m21066 | -m21164 | -m21164a | -m21164pc | -m21264\n\ +-m21064 | -m21066 | -m21164 | -m21164a | -m21164pc | -m21264 | -m21264a | -m21264b\n\ these variants include PALcode opcodes\n"), stream); #ifdef OBJ_EVAX @@ -1406,49 +1412,6 @@ alpha_define_label (sym) alpha_insn_label = sym; } -/* If we have a BRSGP reloc to a local symbol, adjust it to BRADDR and - let it get resolved at assembly time. */ - -void -alpha_validate_fix (f) - fixS *f; -{ -#ifdef OBJ_ELF - int offset = 0; - const char *name; - - if (f->fx_r_type != BFD_RELOC_ALPHA_BRSGP) - return; - - if (! S_IS_DEFINED (f->fx_addsy)) - return; - - switch (S_GET_OTHER (f->fx_addsy) & STO_ALPHA_STD_GPLOAD) - { - case STO_ALPHA_NOPV: - break; - case STO_ALPHA_STD_GPLOAD: - offset = 8; - break; - default: - if (S_IS_LOCAL (f->fx_addsy)) - name = ""; - else - name = S_GET_NAME (f->fx_addsy); - as_bad_where (f->fx_file, f->fx_line, - _("!samegp reloc against symbol without .prologue: %s"), - name); - break; - } - - if (! (S_IS_EXTERN (f->fx_addsy) || S_IS_WEAK (f->fx_addsy))) - { - f->fx_r_type = BFD_RELOC_23_PCREL_S2; - f->fx_offset += offset; - } -#endif -} - /* Return true if we must always emit a reloc for a type and false if there is some hope of resolving it at assembly time. */ @@ -1518,7 +1481,6 @@ alpha_fix_adjustable (f) case BFD_RELOC_ALPHA_GPDISP_HI16: case BFD_RELOC_ALPHA_GPDISP_LO16: case BFD_RELOC_ALPHA_GPDISP: - case BFD_RELOC_ALPHA_BRSGP: return 0; case BFD_RELOC_ALPHA_LITERAL: @@ -1556,6 +1518,39 @@ alpha_fix_adjustable (f) we're preventing this in the other assemblers. Follow for now. */ return 0; + case BFD_RELOC_ALPHA_BRSGP: + /* If we have a BRSGP reloc to a local symbol, adjust it to BRADDR and + let it get resolved at assembly time. */ + { + symbolS *sym = f->fx_addsy; + const char *name; + int offset = 0; + + if (! S_IS_DEFINED (sym)) + return 0; + + switch (S_GET_OTHER (sym) & STO_ALPHA_STD_GPLOAD) + { + case STO_ALPHA_NOPV: + break; + case STO_ALPHA_STD_GPLOAD: + offset = 8; + break; + default: + if (S_IS_LOCAL (sym)) + name = ""; + else + name = S_GET_NAME (sym); + as_bad_where (f->fx_file, f->fx_line, + _("!samegp reloc against symbol without .prologue: %s"), + name); + break; + } + f->fx_r_type = BFD_RELOC_23_PCREL_S2; + f->fx_offset += offset; + return 1; + } + default: return 1; } @@ -5488,7 +5483,7 @@ const pseudo_typeS md_pseudo_table[] = { {"fmask", s_alpha_mask, 1}, {"frame", s_alpha_frame, 0}, {"prologue", s_alpha_prologue, 0}, - {"file", s_alpha_file, 5}, + {"file", (void (*) PARAMS ((int))) s_alpha_file, 5}, {"loc", s_alpha_loc, 9}, {"stabs", s_alpha_stab, 's'}, {"stabn", s_alpha_stab, 'n'}, diff -Nurpa binutils-2.13/gas/config/tc-alpha.h binutils-2.13.1/gas/config/tc-alpha.h --- binutils-2.13/gas/config/tc-alpha.h 2002-02-09 17:55:05.000000000 -0500 +++ binutils-2.13.1/gas/config/tc-alpha.h 2002-11-06 19:44:23.000000000 -0500 @@ -28,10 +28,17 @@ #define TARGET_ARCH bfd_arch_alpha +#ifdef TE_FreeBSD +#define ELF_TARGET_FORMAT "elf64-alpha-freebsd" +#endif +#ifndef ELF_TARGET_FORMAT +#define ELF_TARGET_FORMAT "elf64-alpha" +#endif + #define TARGET_FORMAT (OUTPUT_FLAVOR == bfd_target_ecoff_flavour \ ? "ecoff-littlealpha" \ : OUTPUT_FLAVOR == bfd_target_elf_flavour \ - ? "elf64-alpha" \ + ? ELF_TARGET_FORMAT \ : OUTPUT_FLAVOR == bfd_target_evax_flavour \ ? "vms-alpha" \ : "unknown-format") @@ -39,14 +46,12 @@ #define NEED_LITERAL_POOL #define REPEAT_CONS_EXPRESSIONS -extern void alpha_validate_fix PARAMS ((struct fix *)); extern int alpha_force_relocation PARAMS ((struct fix *)); extern int alpha_fix_adjustable PARAMS ((struct fix *)); extern unsigned long alpha_gprmask, alpha_fprmask; extern valueT alpha_gp_value; -#define TC_VALIDATE_FIX(FIXP,SEGTYPE,SKIP) alpha_validate_fix (FIXP) #define TC_FORCE_RELOCATION(FIXP) alpha_force_relocation (FIXP) #define tc_fix_adjustable(FIXP) alpha_fix_adjustable (FIXP) #define RELOC_REQUIRES_SYMBOL @@ -145,7 +150,7 @@ struct alpha_fix_tag #define TC_INIT_FIX_DATA(fixP) \ do { \ fixP->tc_fix_data.next_reloc = (struct fix *)0; \ - fixP->tc_fix_data.info = (struct alpha_literal_tag *)0; \ + fixP->tc_fix_data.info = (struct alpha_reloc_tag *)0; \ } while (0) /* Work with DEBUG5 to print fields in tc_fix_type. */ diff -Nurpa binutils-2.13/gas/config/tc-i386.c binutils-2.13.1/gas/config/tc-i386.c --- binutils-2.13/gas/config/tc-i386.c 2002-07-11 23:47:36.000000000 -0400 +++ binutils-2.13.1/gas/config/tc-i386.c 2002-10-10 20:33:01.000000000 -0400 @@ -104,8 +104,10 @@ static void output_insn PARAMS ((void)); static void output_branch PARAMS ((void)); static void output_jump PARAMS ((void)); static void output_interseg_jump PARAMS ((void)); -static void output_imm PARAMS ((void)); -static void output_disp PARAMS ((void)); +static void output_imm PARAMS ((fragS *insn_start_frag, + offsetT insn_start_off)); +static void output_disp PARAMS ((fragS *insn_start_frag, + offsetT insn_start_off)); #ifndef I386COFF static void s_bss PARAMS ((int)); #endif @@ -1186,9 +1188,12 @@ reloc (size, pcrel, sign, other) int tc_i386_fix_adjustable (fixP) - fixS *fixP; + fixS *fixP ATTRIBUTE_UNUSED; { #if defined (OBJ_ELF) || defined (OBJ_MAYBE_ELF) + if (OUTPUT_FLAVOR != bfd_target_elf_flavour) + return 1; + /* Prevent all adjustments to global symbols, or else dynamic linking will not work correctly. */ if (S_IS_EXTERNAL (fixP->fx_addsy) @@ -1199,7 +1204,7 @@ tc_i386_fix_adjustable (fixP) && (S_GET_SEGMENT (fixP->fx_addsy)->flags & SEC_MERGE) != 0 && fixP->fx_pcrel)) return 0; -#endif + /* adjust_reloc_syms doesn't know about the GOT. */ if (fixP->fx_r_type == BFD_RELOC_386_GOTOFF || fixP->fx_r_type == BFD_RELOC_386_PLT32 @@ -1208,6 +1213,8 @@ tc_i386_fix_adjustable (fixP) || fixP->fx_r_type == BFD_RELOC_386_TLS_LDM || fixP->fx_r_type == BFD_RELOC_386_TLS_LDO_32 || fixP->fx_r_type == BFD_RELOC_386_TLS_IE_32 + || fixP->fx_r_type == BFD_RELOC_386_TLS_IE + || fixP->fx_r_type == BFD_RELOC_386_TLS_GOTIE || fixP->fx_r_type == BFD_RELOC_386_TLS_LE_32 || fixP->fx_r_type == BFD_RELOC_386_TLS_LE || fixP->fx_r_type == BFD_RELOC_X86_64_PLT32 @@ -1216,6 +1223,7 @@ tc_i386_fix_adjustable (fixP) || fixP->fx_r_type == BFD_RELOC_VTABLE_INHERIT || fixP->fx_r_type == BFD_RELOC_VTABLE_ENTRY) return 0; +#endif return 1; } #else @@ -1233,6 +1241,8 @@ tc_i386_fix_adjustable (fixP) #define BFD_RELOC_386_TLS_LDM 0 #define BFD_RELOC_386_TLS_LDO_32 0 #define BFD_RELOC_386_TLS_IE_32 0 +#define BFD_RELOC_386_TLS_IE 0 +#define BFD_RELOC_386_TLS_GOTIE 0 #define BFD_RELOC_386_TLS_LE_32 0 #define BFD_RELOC_386_TLS_LE 0 #define BFD_RELOC_X86_64_PLT32 0 @@ -2579,9 +2589,8 @@ process_operands () else if (i.tm.opcode_modifier & Modrm) { /* The opcode is completed (modulo i.tm.extension_opcode which - must be put into the modrm byte). - Now, we make the modrm & index base bytes based on all the - info we've collected. */ + must be put into the modrm byte). Now, we make the modrm and + index base bytes based on all the info we've collected. */ default_seg = build_modrm_byte (); } @@ -2608,12 +2617,14 @@ process_operands () default_seg = &ds; } - /* If a segment was explicitly specified, - and the specified segment is not the default, - use an opcode prefix to select it. - If we never figured out what the default segment is, - then default_seg will be zero at this point, - and the specified segment prefix will always be used. */ + if (i.tm.base_opcode == 0x8d /* lea */ && i.seg[0] && !quiet_warnings) + as_warn (_("segment override on `lea' is ineffectual")); + + /* If a segment was explicitly specified, and the specified segment + is not the default, use an opcode prefix to select it. If we + never figured out what the default segment is, then default_seg + will be zero at this point, and the specified segment prefix will + always be used. */ if ((i.seg[0]) && (i.seg[0] != default_seg)) { if (!add_prefix (i.seg[0]->seg_prefix)) @@ -2964,6 +2975,7 @@ output_jump () { char *p; int size; + fixS *fixP; if (i.tm.opcode_modifier & JumpByte) { @@ -3014,8 +3026,14 @@ output_jump () p = frag_more (1 + size); *p++ = i.tm.base_opcode; - fix_new_exp (frag_now, p - frag_now->fr_literal, size, - i.op[0].disps, 1, reloc (size, 1, 1, i.reloc[0])); + fixP = fix_new_exp (frag_now, p - frag_now->fr_literal, size, + i.op[0].disps, 1, reloc (size, 1, 1, i.reloc[0])); + + /* All jumps handled here are signed, but don't use a signed limit + check for 32 and 16 bit jumps as we want to allow wrap around at + 4G and 64k respectively. */ + if (size == 1) + fixP->fx_signed = 1; } static void @@ -3082,14 +3100,21 @@ output_interseg_jump () md_number_to_chars (p + size, (valueT) i.op[0].imms->X_add_number, 2); } + static void output_insn () { + fragS *insn_start_frag; + offsetT insn_start_off; + /* Tie dwarf2 debug info to the address at the start of the insn. We can't do this after the insn has been output as the current frag may have been closed off. eg. by frag_var. */ dwarf2_emit_insn (0); + insn_start_frag = frag_now; + insn_start_off = frag_now_fix (); + /* Output jumps. */ if (i.tm.opcode_modifier & Jump) output_branch (); @@ -3160,10 +3185,10 @@ output_insn () } if (i.disp_operands) - output_disp (); + output_disp (insn_start_frag, insn_start_off); if (i.imm_operands) - output_imm (); + output_imm (insn_start_frag, insn_start_off); } #ifdef DEBUG386 @@ -3175,7 +3200,9 @@ output_insn () } static void -output_disp () +output_disp (insn_start_frag, insn_start_off) + fragS *insn_start_frag; + offsetT insn_start_off; { char *p; unsigned int n; @@ -3205,6 +3232,7 @@ output_disp () } else { + RELOC_ENUM reloc_type; int size = 4; int sign = 0; int pcrel = (i.flags[n] & Operand_PCrel) != 0; @@ -3247,16 +3275,50 @@ output_disp () } p = frag_more (size); + reloc_type = reloc (size, pcrel, sign, i.reloc[n]); +#ifdef BFD_ASSEMBLER + if (reloc_type == BFD_RELOC_32 + && GOT_symbol + && GOT_symbol == i.op[n].disps->X_add_symbol + && (i.op[n].disps->X_op == O_symbol + || (i.op[n].disps->X_op == O_add + && ((symbol_get_value_expression + (i.op[n].disps->X_op_symbol)->X_op) + == O_subtract)))) + { + offsetT add; + + if (insn_start_frag == frag_now) + add = (p - frag_now->fr_literal) - insn_start_off; + else + { + fragS *fr; + + add = insn_start_frag->fr_fix - insn_start_off; + for (fr = insn_start_frag->fr_next; + fr && fr != frag_now; fr = fr->fr_next) + add += fr->fr_fix; + add += p - frag_now->fr_literal; + } + + /* We don't support dynamic linking on x86-64 yet. */ + if (flag_code == CODE_64BIT) + abort (); + reloc_type = BFD_RELOC_386_GOTPC; + i.op[n].disps->X_add_number += add; + } +#endif fix_new_exp (frag_now, p - frag_now->fr_literal, size, - i.op[n].disps, pcrel, - reloc (size, pcrel, sign, i.reloc[n])); + i.op[n].disps, pcrel, reloc_type); } } } } static void -output_imm () +output_imm (insn_start_frag, insn_start_off) + fragS *insn_start_frag; + offsetT insn_start_off; { char *p; unsigned int n; @@ -3309,6 +3371,48 @@ output_imm () p = frag_more (size); reloc_type = reloc (size, 0, sign, i.reloc[n]); #ifdef BFD_ASSEMBLER + /* This is tough to explain. We end up with this one if we + * have operands that look like + * "_GLOBAL_OFFSET_TABLE_+[.-.L284]". The goal here is to + * obtain the absolute address of the GOT, and it is strongly + * preferable from a performance point of view to avoid using + * a runtime relocation for this. The actual sequence of + * instructions often look something like: + * + * call .L66 + * .L66: + * popl %ebx + * addl $_GLOBAL_OFFSET_TABLE_+[.-.L66],%ebx + * + * The call and pop essentially return the absolute address + * of the label .L66 and store it in %ebx. The linker itself + * will ultimately change the first operand of the addl so + * that %ebx points to the GOT, but to keep things simple, the + * .o file must have this operand set so that it generates not + * the absolute address of .L66, but the absolute address of + * itself. This allows the linker itself simply treat a GOTPC + * relocation as asking for a pcrel offset to the GOT to be + * added in, and the addend of the relocation is stored in the + * operand field for the instruction itself. + * + * Our job here is to fix the operand so that it would add + * the correct offset so that %ebx would point to itself. The + * thing that is tricky is that .-.L66 will point to the + * beginning of the instruction, so we need to further modify + * the operand so that it will point to itself. There are + * other cases where you have something like: + * + * .long $_GLOBAL_OFFSET_TABLE_+[.-.L66] + * + * and here no correction would be required. Internally in + * the assembler we treat operands of this form as not being + * pcrel since the '.' is explicitly mentioned, and I wonder + * whether it would simplify matters to do it this way. Who + * knows. In earlier versions of the PIC patches, the + * pcrel_adjust field was used to store the correction, but + * since the expression is not pcrel, I felt it would be + * confusing to do it this way. */ + if (reloc_type == BFD_RELOC_32 && GOT_symbol && GOT_symbol == i.op[n].imms->X_add_symbol @@ -3318,11 +3422,26 @@ output_imm () (i.op[n].imms->X_op_symbol)->X_op) == O_subtract)))) { + offsetT add; + + if (insn_start_frag == frag_now) + add = (p - frag_now->fr_literal) - insn_start_off; + else + { + fragS *fr; + + add = insn_start_frag->fr_fix - insn_start_off; + for (fr = insn_start_frag->fr_next; + fr && fr != frag_now; fr = fr->fr_next) + add += fr->fr_fix; + add += p - frag_now->fr_literal; + } + /* We don't support dynamic linking on x86-64 yet. */ if (flag_code == CODE_64BIT) abort (); reloc_type = BFD_RELOC_386_GOTPC; - i.op[n].imms->X_add_number += 3; + i.op[n].imms->X_add_number += add; } #endif fix_new_exp (frag_now, p - frag_now->fr_literal, size, @@ -3363,6 +3482,8 @@ lex_got (reloc, adjust) { "TPOFF", { BFD_RELOC_386_TLS_LE_32, 0, 0 } }, { "NTPOFF", { BFD_RELOC_386_TLS_LE, 0, 0 } }, { "DTPOFF", { BFD_RELOC_386_TLS_LDO_32, 0, 0 } }, + { "GOTNTPOFF",{ BFD_RELOC_386_TLS_GOTIE, 0, 0 } }, + { "INDNTPOFF",{ BFD_RELOC_386_TLS_IE, 0, 0 } }, { "GOT", { BFD_RELOC_386_GOT32, 0, BFD_RELOC_X86_64_GOT32 } } }; char *cp; @@ -3546,6 +3667,7 @@ i386_immediate (imm_start) #ifdef BFD_ASSEMBLER && OUTPUT_FLAVOR == bfd_target_aout_flavour #endif + && exp_seg != absolute_section && exp_seg != text_section && exp_seg != data_section && exp_seg != bss_section @@ -3760,10 +3882,15 @@ i386_displacement (disp_start, disp_end) #ifdef BFD_ASSEMBLER && OUTPUT_FLAVOR == bfd_target_aout_flavour #endif + && exp_seg != absolute_section && exp_seg != text_section && exp_seg != data_section && exp_seg != bss_section - && exp_seg != undefined_section) + && exp_seg != undefined_section +#ifdef BFD_ASSEMBLER + && !bfd_is_com_section (exp_seg) +#endif + ) { #ifdef BFD_ASSEMBLER as_bad (_("unimplemented segment %s in operand"), exp_seg->name); @@ -4189,8 +4316,9 @@ md_estimate_size_before_relax (fragP, se shared library. */ if (S_GET_SEGMENT (fragP->fr_symbol) != segment #if defined (OBJ_ELF) || defined (OBJ_MAYBE_ELF) - || S_IS_EXTERNAL (fragP->fr_symbol) - || S_IS_WEAK (fragP->fr_symbol) + || (OUTPUT_FLAVOR == bfd_target_elf_flavour + && (S_IS_EXTERNAL (fragP->fr_symbol) + || S_IS_WEAK (fragP->fr_symbol))) #endif ) { @@ -4247,11 +4375,14 @@ md_estimate_size_before_relax (fragP, se case COND_JUMP: if (no_cond_jump_promotion && fragP->fr_var == NO_RELOC) { + fixS *fixP; + fragP->fr_fix += 1; - fix_new (fragP, old_fr_fix, 1, - fragP->fr_symbol, - fragP->fr_offset, 1, - BFD_RELOC_8_PCREL); + fixP = fix_new (fragP, old_fr_fix, 1, + fragP->fr_symbol, + fragP->fr_offset, 1, + BFD_RELOC_8_PCREL); + fixP->fx_signed = 1; break; } @@ -4464,15 +4595,16 @@ md_apply_fix3 (fixP, valP, seg) } } - /* This is a hack. There should be a better way to handle this. - This covers for the fact that bfd_install_relocation will - subtract the current location (for partial_inplace, PC relative - relocations); see more below. */ - if ((fixP->fx_r_type == BFD_RELOC_32_PCREL - || fixP->fx_r_type == BFD_RELOC_16_PCREL - || fixP->fx_r_type == BFD_RELOC_8_PCREL) - && fixP->fx_addsy && !use_rela_relocations) - { + if (fixP->fx_pcrel + && (fixP->fx_r_type == BFD_RELOC_32_PCREL + || fixP->fx_r_type == BFD_RELOC_16_PCREL + || fixP->fx_r_type == BFD_RELOC_8_PCREL) + && !use_rela_relocations) + { + /* This is a hack. There should be a better way to handle this. + This covers for the fact that bfd_install_relocation will + subtract the current location (for partial_inplace, PC relative + relocations); see more below. */ #ifndef OBJ_AOUT if (OUTPUT_FLAVOR == bfd_target_elf_flavour #ifdef TE_PE @@ -4523,61 +4655,16 @@ md_apply_fix3 (fixP, valP, seg) runtime we merely add the offset to the actual PLT entry. */ value = -4; break; - case BFD_RELOC_386_GOTPC: - -/* This is tough to explain. We end up with this one if we have - * operands that look like "_GLOBAL_OFFSET_TABLE_+[.-.L284]". The goal - * here is to obtain the absolute address of the GOT, and it is strongly - * preferable from a performance point of view to avoid using a runtime - * relocation for this. The actual sequence of instructions often look - * something like: - * - * call .L66 - * .L66: - * popl %ebx - * addl $_GLOBAL_OFFSET_TABLE_+[.-.L66],%ebx - * - * The call and pop essentially return the absolute address of - * the label .L66 and store it in %ebx. The linker itself will - * ultimately change the first operand of the addl so that %ebx points to - * the GOT, but to keep things simple, the .o file must have this operand - * set so that it generates not the absolute address of .L66, but the - * absolute address of itself. This allows the linker itself simply - * treat a GOTPC relocation as asking for a pcrel offset to the GOT to be - * added in, and the addend of the relocation is stored in the operand - * field for the instruction itself. - * - * Our job here is to fix the operand so that it would add the correct - * offset so that %ebx would point to itself. The thing that is tricky is - * that .-.L66 will point to the beginning of the instruction, so we need - * to further modify the operand so that it will point to itself. - * There are other cases where you have something like: - * - * .long $_GLOBAL_OFFSET_TABLE_+[.-.L66] - * - * and here no correction would be required. Internally in the assembler - * we treat operands of this form as not being pcrel since the '.' is - * explicitly mentioned, and I wonder whether it would simplify matters - * to do it this way. Who knows. In earlier versions of the PIC patches, - * the pcrel_adjust field was used to store the correction, but since the - * expression is not pcrel, I felt it would be confusing to do it this - * way. */ - value -= 1; - break; case BFD_RELOC_386_GOT32: case BFD_RELOC_386_TLS_GD: case BFD_RELOC_386_TLS_LDM: - case BFD_RELOC_386_TLS_LDO_32: case BFD_RELOC_386_TLS_IE_32: - case BFD_RELOC_386_TLS_LE_32: - case BFD_RELOC_386_TLS_LE: + case BFD_RELOC_386_TLS_IE: + case BFD_RELOC_386_TLS_GOTIE: case BFD_RELOC_X86_64_GOT32: value = 0; /* Fully resolved at runtime. No addend. */ break; - case BFD_RELOC_386_GOTOFF: - case BFD_RELOC_X86_64_GOTPCREL: - break; case BFD_RELOC_VTABLE_INHERIT: case BFD_RELOC_VTABLE_ENTRY: @@ -4870,7 +4957,7 @@ i386_target_format () { if (flag_code == CODE_64BIT) use_rela_relocations = 1; - return flag_code == CODE_64BIT ? "elf64-x86-64" : "elf32-i386"; + return flag_code == CODE_64BIT ? "elf64-x86-64" : ELF_TARGET_FORMAT; } #endif default: @@ -5044,6 +5131,8 @@ tc_gen_reloc (section, fixp) case BFD_RELOC_386_TLS_LDM: case BFD_RELOC_386_TLS_LDO_32: case BFD_RELOC_386_TLS_IE_32: + case BFD_RELOC_386_TLS_IE: + case BFD_RELOC_386_TLS_GOTIE: case BFD_RELOC_386_TLS_LE_32: case BFD_RELOC_386_TLS_LE: case BFD_RELOC_X86_64_32S: diff -Nurpa binutils-2.13/gas/config/tc-i386.h binutils-2.13.1/gas/config/tc-i386.h --- binutils-2.13/gas/config/tc-i386.h 2002-07-09 05:46:18.000000000 -0400 +++ binutils-2.13.1/gas/config/tc-i386.h 2002-09-23 18:14:22.000000000 -0400 @@ -98,13 +98,20 @@ extern unsigned long i386_mach PARAMS (( #define AOUT_TARGET_FORMAT "a.out-i386" #endif +#ifdef TE_FreeBSD +#define ELF_TARGET_FORMAT "elf32-i386-freebsd" +#endif +#ifndef ELF_TARGET_FORMAT +#define ELF_TARGET_FORMAT "elf32-i386" +#endif + #if ((defined (OBJ_MAYBE_COFF) && defined (OBJ_MAYBE_AOUT)) \ || defined (OBJ_ELF) || defined (OBJ_MAYBE_ELF)) extern const char *i386_target_format PARAMS ((void)); #define TARGET_FORMAT i386_target_format () #else #ifdef OBJ_ELF -#define TARGET_FORMAT "elf32-i386" +#define TARGET_FORMAT ELF_TARGET_FORMAT #endif #ifdef OBJ_AOUT #define TARGET_FORMAT AOUT_TARGET_FORMAT diff -Nurpa binutils-2.13/gas/config/tc-ia64.c binutils-2.13.1/gas/config/tc-ia64.c --- binutils-2.13/gas/config/tc-ia64.c 2002-05-23 09:12:47.000000000 -0400 +++ binutils-2.13.1/gas/config/tc-ia64.c 2002-10-31 04:32:05.000000000 -0500 @@ -4827,7 +4827,7 @@ const pseudo_typeS md_pseudo_table[] = { "body", dot_body, 0 }, { "prologue", dot_prologue, 0 }, { "endp", dot_endp, 0 }, - { "file", dwarf2_directive_file, 0 }, + { "file", (void (*) PARAMS ((int))) dwarf2_directive_file, 0 }, { "loc", dwarf2_directive_loc, 0 }, { "fframe", dot_fframe, 0 }, diff -Nurpa binutils-2.13/gas/config/tc-m68k.c binutils-2.13.1/gas/config/tc-m68k.c --- binutils-2.13/gas/config/tc-m68k.c 2002-06-08 03:37:15.000000000 -0400 +++ binutils-2.13.1/gas/config/tc-m68k.c 2002-10-28 13:45:48.000000000 -0500 @@ -848,6 +848,10 @@ tc_m68k_fix_adjustable (fixP) if (! relaxable_symbol (fixP->fx_addsy)) return 0; + /* Don't adjust symbols in merge sections. */ + if ((S_GET_SEGMENT (fixP->fx_addsy)->flags & SEC_MERGE) != 0) + return 0; + /* adjust_reloc_syms doesn't know about the GOT */ switch (fixP->fx_r_type) { diff -Nurpa binutils-2.13/gas/config/tc-mips.c binutils-2.13.1/gas/config/tc-mips.c --- binutils-2.13/gas/config/tc-mips.c 2002-08-01 22:03:09.000000000 -0400 +++ binutils-2.13.1/gas/config/tc-mips.c 2002-11-05 17:03:43.000000000 -0500 @@ -682,6 +682,17 @@ static const unsigned int mips16_to_32_r #define RELAX_MIPS16_LONG_BRANCH(i) (((i) & 0x2000) != 0) #define RELAX_MIPS16_MARK_LONG_BRANCH(i) ((i) | 0x2000) #define RELAX_MIPS16_CLEAR_LONG_BRANCH(i) ((i) &~ 0x2000) + +/* Is the given value a sign-extended 32-bit value? */ +#define IS_SEXT_32BIT_NUM(x) \ + (((x) &~ (offsetT) 0x7fffffff) == 0 \ + || (((x) &~ (offsetT) 0x7fffffff) == ~ (offsetT) 0x7fffffff)) + +/* Is the given value a sign-extended 16-bit value? */ +#define IS_SEXT_16BIT_NUM(x) \ + (((x) &~ (offsetT) 0x7fff) == 0 \ + || (((x) &~ (offsetT) 0x7fff) == ~ (offsetT) 0x7fff)) + /* Prototypes for static functions. */ @@ -718,6 +729,9 @@ static void mips16_macro_build PARAMS (( static void macro_build_jalr PARAMS ((int, expressionS *)); static void macro_build_lui PARAMS ((char *place, int *counter, expressionS * ep, int regnum)); +static void macro_build_ldst_constoffset PARAMS ((char *place, int *counter, + expressionS * ep, const char *op, + int valreg, int breg)); static void set_at PARAMS ((int *counter, int reg, int unsignedp)); static void check_absolute_expr PARAMS ((struct mips_cl_insn * ip, expressionS *)); @@ -3028,12 +3042,18 @@ macro_build_jalr (icnt, ep) int icnt; expressionS *ep; { + char *f; + if (HAVE_NEWABI) - frag_more (0); + { + frag_grow (4); + f = frag_more (0); + } macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "jalr", "d,s", RA, PIC_CALL_REG); if (HAVE_NEWABI) - fix_new_exp (frag_now, 0, 0, ep, false, BFD_RELOC_MIPS_JALR); + fix_new_exp (frag_now, f - frag_now->fr_literal, + 0, ep, false, BFD_RELOC_MIPS_JALR); } /* @@ -3105,6 +3125,52 @@ macro_build_lui (place, counter, ep, reg append_insn (place, &insn, &high_expr, r, false); } +/* Generate a sequence of instructions to do a load or store from a constant + offset off of a base register (breg) into/from a target register (treg), + using AT if necessary. */ +static void +macro_build_ldst_constoffset (place, counter, ep, op, treg, breg) + char *place; + int *counter; + expressionS *ep; + const char *op; + int treg, breg; +{ + assert (ep->X_op == O_constant); + + /* Right now, this routine can only handle signed 32-bit contants. */ + if (! IS_SEXT_32BIT_NUM(ep->X_add_number)) + as_warn (_("operand overflow")); + + if (IS_SEXT_16BIT_NUM(ep->X_add_number)) + { + /* Signed 16-bit offset will fit in the op. Easy! */ + macro_build (place, counter, ep, op, "t,o(b)", treg, + (int) BFD_RELOC_LO16, breg); + } + else + { + /* 32-bit offset, need multiple instructions and AT, like: + lui $tempreg,const_hi (BFD_RELOC_HI16_S) + addu $tempreg,$tempreg,$breg + $treg,const_lo($tempreg) (BFD_RELOC_LO16) + to handle the complete offset. */ + macro_build_lui (place, counter, ep, AT); + if (place != NULL) + place += 4; + macro_build (place, counter, (expressionS *) NULL, + HAVE_32BIT_ADDRESSES ? "addu" : "daddu", + "d,v,t", AT, AT, breg); + if (place != NULL) + place += 4; + macro_build (place, counter, ep, op, "t,o(b)", treg, + (int) BFD_RELOC_LO16, AT); + + if (mips_opts.noat) + as_warn (_("Macro used $at after \".set noat\"")); + } +} + /* set_at() * Generates code to set the $at register to true (one) * if reg is less than the immediate expression. @@ -3219,11 +3285,6 @@ check_absolute_expr (ip, ex) ? 1 \ : 0) -/* Is the given value a sign-extended 32-bit value? */ -#define IS_SEXT_32BIT_NUM(x) \ - (((x) &~ (offsetT) 0x7fffffff) == 0 \ - || (((x) &~ (offsetT) 0x7fffffff) == ~ (offsetT) 0x7fffffff)) - /* load_register() * This routine generates the least number of instructions neccessary to load * an absolute expression value into a register. @@ -4462,6 +4523,16 @@ macro (ip) if (! dbl && HAVE_64BIT_OBJECTS) as_warn (_("la used to load 64-bit address")); + if (offset_expr.X_op == O_constant + && offset_expr.X_add_number >= -0x8000 + && offset_expr.X_add_number < 0x8000) + { + macro_build ((char *) NULL, &icnt, &offset_expr, + (dbl || HAVE_64BIT_ADDRESSES) ? "daddiu" : "addiu", + "t,r,j", treg, sreg, (int) BFD_RELOC_LO16); + return; + } + if (treg == breg) { tempreg = AT; @@ -5064,10 +5135,9 @@ macro (ip) mips_cprestore_valid = 1; } expr1.X_add_number = mips_cprestore_offset; - macro_build ((char *) NULL, &icnt, &expr1, - HAVE_32BIT_ADDRESSES ? "lw" : "ld", "t,o(b)", - mips_gp_register, (int) BFD_RELOC_LO16, - mips_frame_reg); + macro_build_ldst_constoffset ((char *) NULL, &icnt, &expr1, + HAVE_32BIT_ADDRESSES ? "lw" : "ld", + mips_gp_register, mips_frame_reg); } } } @@ -5197,10 +5267,9 @@ macro (ip) macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "nop", ""); expr1.X_add_number = mips_cprestore_offset; - macro_build ((char *) NULL, &icnt, &expr1, - HAVE_32BIT_ADDRESSES ? "lw" : "ld", "t,o(b)", - mips_gp_register, (int) BFD_RELOC_LO16, - mips_frame_reg); + macro_build_ldst_constoffset ((char *) NULL, &icnt, &expr1, + HAVE_32BIT_ADDRESSES ? "lw" : "ld", + mips_gp_register, mips_frame_reg); } } } @@ -6654,22 +6723,27 @@ macro2 (ip) case M_DROL_I: { unsigned int rot; - char *l, *r; if (imm_expr.X_op != O_constant) as_bad (_("rotate count too large")); rot = imm_expr.X_add_number & 0x3f; - if (! rot) - break; - l = (rot < 0x20) ? "dsll" : "dsll32"; - r = ((0x40 - rot) < 0x20) ? "dsrl" : "dsrl32"; - rot &= 0x1f; - macro_build ((char *) NULL, &icnt, (expressionS *) NULL, l, - "d,w,<", AT, sreg, rot); - macro_build ((char *) NULL, &icnt, (expressionS *) NULL, r, - "d,w,<", dreg, sreg, (0x20 - rot) & 0x1f); - macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "or", - "d,v,t", dreg, dreg, AT); + if (rot == 0) + macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "dsrl", + "d,w,<", dreg, sreg, 0); + else + { + char *l, *r; + + l = (rot < 0x20) ? "dsll" : "dsll32"; + r = ((0x40 - rot) < 0x20) ? "dsrl" : "dsrl32"; + rot &= 0x1f; + macro_build ((char *) NULL, &icnt, (expressionS *) NULL, l, + "d,w,<", AT, sreg, rot); + macro_build ((char *) NULL, &icnt, (expressionS *) NULL, r, + "d,w,<", dreg, sreg, (0x20 - rot) & 0x1f); + macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "or", + "d,v,t", dreg, dreg, AT); + } } break; @@ -6680,14 +6754,18 @@ macro2 (ip) if (imm_expr.X_op != O_constant) as_bad (_("rotate count too large")); rot = imm_expr.X_add_number & 0x1f; - if (! rot) - break; - macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "sll", - "d,w,<", AT, sreg, rot); - macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "srl", - "d,w,<", dreg, sreg, (0x20 - rot) & 0x1f); - macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "or", - "d,v,t", dreg, dreg, AT); + if (rot == 0) + macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "srl", + "d,w,<", dreg, sreg, 0); + else + { + macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "sll", + "d,w,<", AT, sreg, rot); + macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "srl", + "d,w,<", dreg, sreg, (0x20 - rot) & 0x1f); + macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "or", + "d,v,t", dreg, dreg, AT); + } } break; @@ -6716,22 +6794,27 @@ macro2 (ip) case M_DROR_I: { unsigned int rot; - char *l, *r; if (imm_expr.X_op != O_constant) as_bad (_("rotate count too large")); rot = imm_expr.X_add_number & 0x3f; - if (! rot) - break; - r = (rot < 0x20) ? "dsrl" : "dsrl32"; - l = ((0x40 - rot) < 0x20) ? "dsll" : "dsll32"; - rot &= 0x1f; - macro_build ((char *) NULL, &icnt, (expressionS *) NULL, r, - "d,w,<", AT, sreg, rot); - macro_build ((char *) NULL, &icnt, (expressionS *) NULL, l, - "d,w,<", dreg, sreg, (0x20 - rot) & 0x1f); - macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "or", - "d,v,t", dreg, dreg, AT); + if (rot == 0) + macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "dsrl", + "d,w,<", dreg, sreg, 0); + else + { + char *l, *r; + + r = (rot < 0x20) ? "dsrl" : "dsrl32"; + l = ((0x40 - rot) < 0x20) ? "dsll" : "dsll32"; + rot &= 0x1f; + macro_build ((char *) NULL, &icnt, (expressionS *) NULL, r, + "d,w,<", AT, sreg, rot); + macro_build ((char *) NULL, &icnt, (expressionS *) NULL, l, + "d,w,<", dreg, sreg, (0x20 - rot) & 0x1f); + macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "or", + "d,v,t", dreg, dreg, AT); + } } break; @@ -6742,14 +6825,18 @@ macro2 (ip) if (imm_expr.X_op != O_constant) as_bad (_("rotate count too large")); rot = imm_expr.X_add_number & 0x1f; - if (! rot) - break; - macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "srl", - "d,w,<", AT, sreg, rot); - macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "sll", - "d,w,<", dreg, sreg, (0x20 - rot) & 0x1f); - macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "or", - "d,v,t", dreg, dreg, AT); + if (rot == 0) + macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "srl", + "d,w,<", dreg, sreg, 0); + else + { + macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "srl", + "d,w,<", AT, sreg, rot); + macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "sll", + "d,w,<", dreg, sreg, (0x20 - rot) & 0x1f); + macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "or", + "d,v,t", dreg, dreg, AT); + } } break; @@ -8530,9 +8617,11 @@ mips_ip (str, ip) { if (c != S_EX_LO) { - if (imm_expr.X_op == O_constant) - imm_expr.X_add_number = - (imm_expr.X_add_number >> 16) & 0xffff; + if (c == S_EX_HI) + { + *imm_reloc = BFD_RELOC_HI16_S; + imm_unmatched_hi = true; + } #ifdef OBJ_ELF else if (c == S_EX_HIGHEST) *imm_reloc = BFD_RELOC_MIPS_HIGHEST; @@ -8558,11 +8647,6 @@ mips_ip (str, ip) } } #endif - else if (c == S_EX_HI) - { - *imm_reloc = BFD_RELOC_HI16_S; - imm_unmatched_hi = true; - } else *imm_reloc = BFD_RELOC_HI16; } @@ -8663,10 +8747,7 @@ mips_ip (str, ip) { if (c != S_EX_LO) { - if (imm_expr.X_op == O_constant) - imm_expr.X_add_number = - (imm_expr.X_add_number >> 16) & 0xffff; - else if (c == S_EX_HI) + if (c == S_EX_HI) { *imm_reloc = BFD_RELOC_HI16_S; imm_unmatched_hi = true; @@ -8700,9 +8781,9 @@ mips_ip (str, ip) else if (imm_expr.X_op == O_constant) imm_expr.X_add_number &= 0xffff; } - if (imm_expr.X_op == O_constant - && (imm_expr.X_add_number < 0 - || imm_expr.X_add_number >= 0x10000)) + else if (imm_expr.X_op == O_constant + && (imm_expr.X_add_number < 0 + || imm_expr.X_add_number >= 0x10000)) as_bad (_("lui expression not in range 0..65535")); s = expr_end; continue; @@ -9823,6 +9904,7 @@ md_number_to_chars (buf, val, n) static int support_64bit_objects(void) { const char **list, **l; + int yes; list = bfd_target_list (); for (l = list; *l != NULL; l++) @@ -9835,8 +9917,9 @@ static int support_64bit_objects(void) || strcmp (*l, "elf64-littlemips") == 0) #endif break; + yes = (*l != NULL); free (list); - return (*l != NULL); + return yes; } #endif /* OBJ_ELF */ @@ -10873,7 +10956,7 @@ mips_need_elf_addend_fixup (fixP) if (symbol_used_in_reloc_p (fixP->fx_addsy) && (((bfd_get_section_flags (stdoutput, S_GET_SEGMENT (fixP->fx_addsy)) - & SEC_LINK_ONCE) != 0) + & (SEC_LINK_ONCE | SEC_MERGE)) != 0) || !strncmp (segment_name (S_GET_SEGMENT (fixP->fx_addsy)), ".gnu.linkonce", sizeof (".gnu.linkonce") - 1))) @@ -11911,7 +11994,7 @@ s_cpsetup (ignore) expressionS ex_sym; int reg1; int icnt = 0; - char *sym; + char *f; /* If we are not generating SVR4 PIC code, .cpsetup is ignored. We also need NewABI support. */ @@ -11950,15 +12033,7 @@ s_cpsetup (ignore) else ++input_line_pointer; SKIP_WHITESPACE (); - sym = input_line_pointer; - while (ISALNUM (*input_line_pointer)) - ++input_line_pointer; - *input_line_pointer = 0; - - ex_sym.X_op = O_symbol; - ex_sym.X_add_symbol = symbol_find_or_make (sym); - ex_sym.X_op_symbol = NULL; - ex_sym.X_add_number = 0; + expression (&ex_sym); if (mips_cpreturn_register == -1) { @@ -11974,14 +12049,25 @@ s_cpsetup (ignore) macro_build ((char *) NULL, &icnt, (expressionS *) NULL, "daddu", "d,v,t", mips_cpreturn_register, mips_gp_register, 0); + /* Ensure there's room for the next two instructions, so that `f' + doesn't end up with an address in the wrong frag. */ + frag_grow (8); + f = frag_more (0); macro_build ((char *) NULL, &icnt, &ex_sym, "lui", "t,u", mips_gp_register, (int) BFD_RELOC_GPREL16); - fix_new (frag_now, prev_insn_where, 0, NULL, 0, 0, BFD_RELOC_MIPS_SUB); - fix_new (frag_now, prev_insn_where, 0, NULL, 0, 0, BFD_RELOC_HI16_S); + fix_new (frag_now, f - frag_now->fr_literal, + 0, NULL, 0, 0, BFD_RELOC_MIPS_SUB); + fix_new (frag_now, f - frag_now->fr_literal, + 0, NULL, 0, 0, BFD_RELOC_HI16_S); + + f = frag_more (0); macro_build ((char *) NULL, &icnt, &ex_sym, "addiu", "t,r,j", mips_gp_register, mips_gp_register, (int) BFD_RELOC_GPREL16); - fix_new (frag_now, prev_insn_where, 0, NULL, 0, 0, BFD_RELOC_MIPS_SUB); - fix_new (frag_now, prev_insn_where, 0, NULL, 0, 0, BFD_RELOC_LO16); + fix_new (frag_now, f - frag_now->fr_literal, + 0, NULL, 0, 0, BFD_RELOC_MIPS_SUB); + fix_new (frag_now, f - frag_now->fr_literal, + 0, NULL, 0, 0, BFD_RELOC_LO16); + macro_build ((char *) NULL, &icnt, (expressionS *) NULL, HAVE_64BIT_ADDRESSES ? "daddu" : "addu", "d,v,t", mips_gp_register, mips_gp_register, reg1); @@ -12032,8 +12118,9 @@ s_cprestore (ignore) ex.X_op_symbol = NULL; ex.X_add_number = mips_cprestore_offset; - macro_build ((char *) NULL, &icnt, &ex, HAVE_32BIT_ADDRESSES ? "sw" : "sd", - "t,o(b)", mips_gp_register, (int) BFD_RELOC_LO16, SP); + macro_build_ldst_constoffset ((char *) NULL, &icnt, &ex, + HAVE_32BIT_ADDRESSES ? "sw" : "sd", + mips_gp_register, SP); demand_empty_rest_of_line (); } diff -Nurpa binutils-2.13/gas/config/tc-ppc.c binutils-2.13.1/gas/config/tc-ppc.c --- binutils-2.13/gas/config/tc-ppc.c 2002-07-26 00:23:02.000000000 -0400 +++ binutils-2.13.1/gas/config/tc-ppc.c 2002-09-23 18:14:23.000000000 -0400 @@ -1169,6 +1169,14 @@ md_begin () || ((op->flags & (PPC_OPCODE_32 | PPC_OPCODE_64)) == (ppc_cpu & (PPC_OPCODE_32 | PPC_OPCODE_64))) || (ppc_cpu & PPC_OPCODE_64_BRIDGE) != 0) + /* Certain instructions (eg: extsw) do not exist in the + 32-bit BookE instruction set, but they do exist in the + 64-bit BookE instruction set, and other PPC instruction + sets. Check to see if the opcode has the BOOKE64 flag set. + If it does make sure that the target CPU is not the BookE32. */ + && ((op->flags & PPC_OPCODE_BOOKE64) == 0 + || (ppc_cpu & PPC_OPCODE_BOOKE64) == PPC_OPCODE_BOOKE64 + || (ppc_cpu & PPC_OPCODE_BOOKE) == 0) && ((op->flags & (PPC_OPCODE_POWER4 | PPC_OPCODE_NOPOWER4)) == 0 || ((op->flags & PPC_OPCODE_POWER4) == (ppc_cpu & PPC_OPCODE_POWER4)))) @@ -1916,6 +1924,8 @@ md_assemble (str) if ((operand->flags & PPC_OPERAND_OPTIONAL) != 0) { unsigned int opcount; + unsigned int num_operands_expected; + unsigned int i; /* There is an optional operand. Count the number of commas in the input line. */ @@ -1932,10 +1942,16 @@ md_assemble (str) } } + /* Compute the number of expected operands. + Do not count fake operands. */ + for (num_operands_expected = 0, i = 0; opcode->operands[i]; i ++) + if ((powerpc_operands [opcode->operands[i]].flags & PPC_OPERAND_FAKE) == 0) + ++ num_operands_expected; + /* If there are fewer operands in the line then are called for by the instruction, we want to skip the optional operand. */ - if (opcount < strlen (opcode->operands)) + if (opcount < num_operands_expected) skip_optional = 1; break; @@ -5223,7 +5239,14 @@ md_apply_fix3 (fixP, valP, seg) else if ((operand->flags & PPC_OPERAND_RELATIVE) != 0 && operand->bits == 16 && operand->shift == 0) - fixP->fx_r_type = BFD_RELOC_PPC_B16; + { + fixP->fx_r_type = BFD_RELOC_PPC_B16; +#ifdef OBJ_XCOFF + fixP->fx_size = 2; + if (target_big_endian) + fixP->fx_where += 2; +#endif + } else if ((operand->flags & PPC_OPERAND_ABSOLUTE) != 0 && operand->bits == 26 && operand->shift == 0) @@ -5231,7 +5254,14 @@ md_apply_fix3 (fixP, valP, seg) else if ((operand->flags & PPC_OPERAND_ABSOLUTE) != 0 && operand->bits == 16 && operand->shift == 0) - fixP->fx_r_type = BFD_RELOC_PPC_BA16; + { + fixP->fx_r_type = BFD_RELOC_PPC_BA16; +#ifdef OBJ_XCOFF + fixP->fx_size = 2; + if (target_big_endian) + fixP->fx_where += 2; +#endif + } #if defined (OBJ_XCOFF) || defined (OBJ_ELF) else if ((operand->flags & PPC_OPERAND_PARENS) != 0 && operand->bits == 16 diff -Nurpa binutils-2.13/gas/config/tc-sh.c binutils-2.13.1/gas/config/tc-sh.c --- binutils-2.13/gas/config/tc-sh.c 2002-06-19 10:31:07.000000000 -0400 +++ binutils-2.13.1/gas/config/tc-sh.c 2002-10-28 13:45:49.000000000 -0500 @@ -2122,16 +2122,16 @@ assemble_ppi (op_end, opcode) int move_code; unsigned int size; - /* Some insn ignore one or more register fields, e.g. psts machl,a0. - Make sure we encode a defined insn pattern. */ - reg_x = 0; - reg_y = 0; - reg_n = 0; - for (;;) { sh_operand_info operand[3]; + /* Some insn ignore one or more register fields, e.g. psts machl,a0. + Make sure we encode a defined insn pattern. */ + reg_x = 0; + reg_y = 0; + reg_n = 0; + if (opcode->arg[0] != A_END) op_end = get_operands (opcode, op_end, operand); opcode = get_specific (opcode, operand); diff -Nurpa binutils-2.13/gas/config/tc-sparc.c binutils-2.13.1/gas/config/tc-sparc.c --- binutils-2.13/gas/config/tc-sparc.c 2002-06-08 03:37:15.000000000 -0400 +++ binutils-2.13.1/gas/config/tc-sparc.c 2002-10-31 04:32:05.000000000 -0500 @@ -159,7 +159,7 @@ const pseudo_typeS md_pseudo_table[] = {"uaword", s_uacons, 4}, {"uaxword", s_uacons, 8}, #ifdef OBJ_ELF - {"file", dwarf2_directive_file, 0}, + {"file", (void (*) PARAMS ((int))) dwarf2_directive_file, 0}, {"loc", dwarf2_directive_loc, 0}, /* These are specific to sparc/svr4. */ {"2byte", s_uacons, 2}, diff -Nurpa binutils-2.13/gas/config/tc-v850.c binutils-2.13.1/gas/config/tc-v850.c --- binutils-2.13/gas/config/tc-v850.c 2002-06-08 03:37:16.000000000 -0400 +++ binutils-2.13.1/gas/config/tc-v850.c 2002-10-14 07:30:07.000000000 -0400 @@ -1461,7 +1461,7 @@ v850_reloc_prefix (operand) } #define CHECK_(name, reloc) \ - if (strncmp (input_line_pointer, name##"(", strlen (name) + 1) == 0) \ + if (strncmp (input_line_pointer, name "(", strlen (name) + 1) == 0) \ { \ input_line_pointer += strlen (name); \ return reloc; \ @@ -1961,7 +1961,7 @@ md_assemble (str) if (((insn & 0x07e0) == 0x0200) && ex.X_op == O_constant && (ex.X_add_number < (-(1 << (operand->bits - 1))) - || ex.X_add_number > ((1 << operand->bits) - 1))) + || ex.X_add_number > ((1 << (operand->bits - 1)) - 1))) errmsg = _("immediate operand is too large"); } diff -Nurpa binutils-2.13/gas/config/tc-w65.c binutils-2.13.1/gas/config/tc-w65.c --- binutils-2.13/gas/config/tc-w65.c 2002-06-08 03:37:16.000000000 -0400 +++ binutils-2.13.1/gas/config/tc-w65.c 2002-08-26 04:57:17.000000000 -0400 @@ -846,7 +846,7 @@ md_parse_option (c, a) int c; char *a; { - return 1; + return 0; } void @@ -980,7 +980,7 @@ md_section_align (seg, size) void md_apply_fix3 (fixP, valP, seg) fixS *fixP; - vauleT * valP; + valueT * valP; segT seg ATTRIBUTE_UNUSED; { long val = * (long *) valP; diff -Nurpa binutils-2.13/gas/configure binutils-2.13.1/gas/configure --- binutils-2.13/gas/configure 2002-07-08 22:41:16.000000000 -0400 +++ binutils-2.13.1/gas/configure 2002-10-30 12:13:18.000000000 -0500 @@ -1647,7 +1647,7 @@ else if { (eval echo configure:1648: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; }; then for file in conftest.*; do case $file in - *.c | *.o | *.obj) ;; + *.$ac_ext | *.c | *.o | *.obj) ;; *) ac_cv_exeext=`echo $file | sed -e s/conftest//` ;; esac done @@ -2267,14 +2267,8 @@ for this_target in $target $canon_target endian= case ${cpu} in alpha*) cpu_type=alpha ;; - armeb) cpu_type=arm endian=big ;; - arm*) cpu_type=arm endian=little ;; - armb*) cpu_type=arm endian=little ;; - armv*l) cpu_type=arm endian=little ;; - armv*b) cpu_type=arm endian=big ;; - xscale*) cpu_type=arm endian=little ;; - strongarm*) cpu_type=arm endian=little ;; - thumb*) cpu_type=arm endian=little ;; + arm*b|xscale*b|strongarm*b) cpu_type=arm endian=big ;; + arm*|xscale*|strongarm*) cpu_type=arm endian=little ;; hppa*) cpu_type=hppa ;; i[3456]86) cpu_type=i386 arch=i386;; x86_64) cpu_type=i386 arch=x86_64;; @@ -3155,7 +3149,7 @@ EOF # Extract the first word of "gcc", so it can be a program name with args. set dummy gcc; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:3159: checking for $ac_word" >&5 +echo "configure:3153: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_prog_CC'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -3185,7 +3179,7 @@ if test -z "$CC"; then # Extract the first word of "cc", so it can be a program name with args. set dummy cc; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:3189: checking for $ac_word" >&5 +echo "configure:3183: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_prog_CC'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -3236,7 +3230,7 @@ fi # Extract the first word of "cl", so it can be a program name with args. set dummy cl; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:3240: checking for $ac_word" >&5 +echo "configure:3234: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_prog_CC'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -3268,7 +3262,7 @@ fi fi echo $ac_n "checking whether the C compiler ($CC $CFLAGS $LDFLAGS) works""... $ac_c" 1>&6 -echo "configure:3272: checking whether the C compiler ($CC $CFLAGS $LDFLAGS) works" >&5 +echo "configure:3266: checking whether the C compiler ($CC $CFLAGS $LDFLAGS) works" >&5 ac_ext=c # CFLAGS is not in ac_cpp because -g, -O, etc. are not valid cpp options. @@ -3279,12 +3273,12 @@ cross_compiling=$ac_cv_prog_cc_cross cat > conftest.$ac_ext << EOF -#line 3283 "configure" +#line 3277 "configure" #include "confdefs.h" main(){return(0);} EOF -if { (eval echo configure:3288: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:3282: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then ac_cv_prog_cc_works=yes # If we can't run a trivial program, we are probably using a cross compiler. if (./conftest; exit) 2>/dev/null; then @@ -3310,12 +3304,12 @@ if test $ac_cv_prog_cc_works = no; then { echo "configure: error: installation or configuration problem: C compiler cannot create executables." 1>&2; exit 1; } fi echo $ac_n "checking whether the C compiler ($CC $CFLAGS $LDFLAGS) is a cross-compiler""... $ac_c" 1>&6 -echo "configure:3314: checking whether the C compiler ($CC $CFLAGS $LDFLAGS) is a cross-compiler" >&5 +echo "configure:3308: checking whether the C compiler ($CC $CFLAGS $LDFLAGS) is a cross-compiler" >&5 echo "$ac_t""$ac_cv_prog_cc_cross" 1>&6 cross_compiling=$ac_cv_prog_cc_cross echo $ac_n "checking whether we are using GNU C""... $ac_c" 1>&6 -echo "configure:3319: checking whether we are using GNU C" >&5 +echo "configure:3313: checking whether we are using GNU C" >&5 if eval "test \"`echo '$''{'ac_cv_prog_gcc'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -3324,7 +3318,7 @@ else yes; #endif EOF -if { ac_try='${CC-cc} -E conftest.c'; { (eval echo configure:3328: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }; } | egrep yes >/dev/null 2>&1; then +if { ac_try='${CC-cc} -E conftest.c'; { (eval echo configure:3322: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }; } | egrep yes >/dev/null 2>&1; then ac_cv_prog_gcc=yes else ac_cv_prog_gcc=no @@ -3343,7 +3337,7 @@ ac_test_CFLAGS="${CFLAGS+set}" ac_save_CFLAGS="$CFLAGS" CFLAGS= echo $ac_n "checking whether ${CC-cc} accepts -g""... $ac_c" 1>&6 -echo "configure:3347: checking whether ${CC-cc} accepts -g" >&5 +echo "configure:3341: checking whether ${CC-cc} accepts -g" >&5 if eval "test \"`echo '$''{'ac_cv_prog_cc_g'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -3380,7 +3374,7 @@ do # Extract the first word of "$ac_prog", so it can be a program name with args. set dummy $ac_prog; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:3384: checking for $ac_word" >&5 +echo "configure:3378: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_prog_YACC'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -3411,7 +3405,7 @@ done test -n "$YACC" || YACC="yacc" echo $ac_n "checking how to run the C preprocessor""... $ac_c" 1>&6 -echo "configure:3415: checking how to run the C preprocessor" >&5 +echo "configure:3409: checking how to run the C preprocessor" >&5 # On Suns, sometimes $CPP names a directory. if test -n "$CPP" && test -d "$CPP"; then CPP= @@ -3426,13 +3420,13 @@ else # On the NeXT, cc -E runs the code through the compiler's parser, # not just through cpp. cat > conftest.$ac_ext < Syntax Error EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:3436: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:3430: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out | grep -v "^conftest.${ac_ext}\$"` if test -z "$ac_err"; then : @@ -3443,13 +3437,13 @@ else rm -rf conftest* CPP="${CC-cc} -E -traditional-cpp" cat > conftest.$ac_ext < Syntax Error EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:3453: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:3447: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out | grep -v "^conftest.${ac_ext}\$"` if test -z "$ac_err"; then : @@ -3460,13 +3454,13 @@ else rm -rf conftest* CPP="${CC-cc} -nologo -E" cat > conftest.$ac_ext < Syntax Error EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:3470: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:3464: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out | grep -v "^conftest.${ac_ext}\$"` if test -z "$ac_err"; then : @@ -3496,7 +3490,7 @@ do # Extract the first word of "$ac_prog", so it can be a program name with args. set dummy $ac_prog; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:3500: checking for $ac_word" >&5 +echo "configure:3494: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_prog_LEX'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -3529,7 +3523,7 @@ test -n "$LEX" || LEX="$missing_dir/miss # Extract the first word of "flex", so it can be a program name with args. set dummy flex; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:3533: checking for $ac_word" >&5 +echo "configure:3527: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_prog_LEX'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -3563,7 +3557,7 @@ then *) ac_lib=l ;; esac echo $ac_n "checking for yywrap in -l$ac_lib""... $ac_c" 1>&6 -echo "configure:3567: checking for yywrap in -l$ac_lib" >&5 +echo "configure:3561: checking for yywrap in -l$ac_lib" >&5 ac_lib_var=`echo $ac_lib'_'yywrap | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -3571,7 +3565,7 @@ else ac_save_LIBS="$LIBS" LIBS="-l$ac_lib $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:3580: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -3605,7 +3599,7 @@ fi fi echo $ac_n "checking lex output file root""... $ac_c" 1>&6 -echo "configure:3609: checking lex output file root" >&5 +echo "configure:3603: checking lex output file root" >&5 if eval "test \"`echo '$''{'ac_cv_prog_lex_root'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -3626,7 +3620,7 @@ echo "$ac_t""$ac_cv_prog_lex_root" 1>&6 LEX_OUTPUT_ROOT=$ac_cv_prog_lex_root echo $ac_n "checking whether yytext is a pointer""... $ac_c" 1>&6 -echo "configure:3630: checking whether yytext is a pointer" >&5 +echo "configure:3624: checking whether yytext is a pointer" >&5 if eval "test \"`echo '$''{'ac_cv_prog_lex_yytext_pointer'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -3638,14 +3632,14 @@ echo 'extern char *yytext;' >>$LEX_OUTPU ac_save_LIBS="$LIBS" LIBS="$LIBS $LEXLIB" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:3643: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* ac_cv_prog_lex_yytext_pointer=yes else @@ -3671,7 +3665,7 @@ ALL_LINGUAS="fr tr es" # Extract the first word of "ranlib", so it can be a program name with args. set dummy ranlib; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:3675: checking for $ac_word" >&5 +echo "configure:3669: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_prog_RANLIB'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -3699,12 +3693,12 @@ else fi echo $ac_n "checking for ANSI C header files""... $ac_c" 1>&6 -echo "configure:3703: checking for ANSI C header files" >&5 +echo "configure:3697: checking for ANSI C header files" >&5 if eval "test \"`echo '$''{'ac_cv_header_stdc'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < #include @@ -3712,7 +3706,7 @@ else #include EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:3716: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:3710: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out | grep -v "^conftest.${ac_ext}\$"` if test -z "$ac_err"; then rm -rf conftest* @@ -3729,7 +3723,7 @@ rm -f conftest* if test $ac_cv_header_stdc = yes; then # SunOS 4.x string.h does not declare mem*, contrary to ANSI. cat > conftest.$ac_ext < EOF @@ -3747,7 +3741,7 @@ fi if test $ac_cv_header_stdc = yes; then # ISC 2.0.2 stdlib.h does not declare free, contrary to ANSI. cat > conftest.$ac_ext < EOF @@ -3768,7 +3762,7 @@ if test "$cross_compiling" = yes; then : else cat > conftest.$ac_ext < #define ISLOWER(c) ('a' <= (c) && (c) <= 'z') @@ -3779,7 +3773,7 @@ if (XOR (islower (i), ISLOWER (i)) || to exit (0); } EOF -if { (eval echo configure:3783: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext} && (./conftest; exit) 2>/dev/null +if { (eval echo configure:3777: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext} && (./conftest; exit) 2>/dev/null then : else @@ -3803,12 +3797,12 @@ EOF fi echo $ac_n "checking for working const""... $ac_c" 1>&6 -echo "configure:3807: checking for working const" >&5 +echo "configure:3801: checking for working const" >&5 if eval "test \"`echo '$''{'ac_cv_c_const'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:3855: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* ac_cv_c_const=yes else @@ -3878,21 +3872,21 @@ EOF fi echo $ac_n "checking for inline""... $ac_c" 1>&6 -echo "configure:3882: checking for inline" >&5 +echo "configure:3876: checking for inline" >&5 if eval "test \"`echo '$''{'ac_cv_c_inline'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else ac_cv_c_inline=no for ac_kw in inline __inline__ __inline; do cat > conftest.$ac_ext <&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:3890: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* ac_cv_c_inline=$ac_kw; break else @@ -3918,12 +3912,12 @@ EOF esac echo $ac_n "checking for off_t""... $ac_c" 1>&6 -echo "configure:3922: checking for off_t" >&5 +echo "configure:3916: checking for off_t" >&5 if eval "test \"`echo '$''{'ac_cv_type_off_t'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < #if STDC_HEADERS @@ -3951,12 +3945,12 @@ EOF fi echo $ac_n "checking for size_t""... $ac_c" 1>&6 -echo "configure:3955: checking for size_t" >&5 +echo "configure:3949: checking for size_t" >&5 if eval "test \"`echo '$''{'ac_cv_type_size_t'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < #if STDC_HEADERS @@ -3986,19 +3980,19 @@ fi # The Ultrix 4.2 mips builtin alloca declared by alloca.h only works # for constant arguments. Useless! echo $ac_n "checking for working alloca.h""... $ac_c" 1>&6 -echo "configure:3990: checking for working alloca.h" >&5 +echo "configure:3984: checking for working alloca.h" >&5 if eval "test \"`echo '$''{'ac_cv_header_alloca_h'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < int main() { char *p = alloca(2 * sizeof(int)); ; return 0; } EOF -if { (eval echo configure:4002: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:3996: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* ac_cv_header_alloca_h=yes else @@ -4019,12 +4013,12 @@ EOF fi echo $ac_n "checking for alloca""... $ac_c" 1>&6 -echo "configure:4023: checking for alloca" >&5 +echo "configure:4017: checking for alloca" >&5 if eval "test \"`echo '$''{'ac_cv_func_alloca_works'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:4050: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* ac_cv_func_alloca_works=yes else @@ -4084,12 +4078,12 @@ EOF echo $ac_n "checking whether alloca needs Cray hooks""... $ac_c" 1>&6 -echo "configure:4088: checking whether alloca needs Cray hooks" >&5 +echo "configure:4082: checking whether alloca needs Cray hooks" >&5 if eval "test \"`echo '$''{'ac_cv_os_cray'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&6 if test $ac_cv_os_cray = yes; then for ac_func in _getb67 GETB67 getb67; do echo $ac_n "checking for $ac_func""... $ac_c" 1>&6 -echo "configure:4118: checking for $ac_func" >&5 +echo "configure:4112: checking for $ac_func" >&5 if eval "test \"`echo '$''{'ac_cv_func_$ac_func'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:4140: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_func_$ac_func=yes" else @@ -4169,7 +4163,7 @@ done fi echo $ac_n "checking stack direction for C alloca""... $ac_c" 1>&6 -echo "configure:4173: checking stack direction for C alloca" >&5 +echo "configure:4167: checking stack direction for C alloca" >&5 if eval "test \"`echo '$''{'ac_cv_c_stack_direction'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -4177,7 +4171,7 @@ else ac_cv_c_stack_direction=0 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext} && (./conftest; exit) 2>/dev/null +if { (eval echo configure:4194: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext} && (./conftest; exit) 2>/dev/null then ac_cv_c_stack_direction=1 else @@ -4217,21 +4211,21 @@ EOF fi -for ac_hdr in stdlib.h unistd.h sys/stat.h sys/types.h +for ac_hdr in unistd.h do ac_safe=`echo "$ac_hdr" | sed 'y%./+-%__p_%'` echo $ac_n "checking for $ac_hdr""... $ac_c" 1>&6 -echo "configure:4225: checking for $ac_hdr" >&5 +echo "configure:4219: checking for $ac_hdr" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:4235: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:4229: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out | grep -v "^conftest.${ac_ext}\$"` if test -z "$ac_err"; then rm -rf conftest* @@ -4260,12 +4254,12 @@ done for ac_func in getpagesize do echo $ac_n "checking for $ac_func""... $ac_c" 1>&6 -echo "configure:4264: checking for $ac_func" >&5 +echo "configure:4258: checking for $ac_func" >&5 if eval "test \"`echo '$''{'ac_cv_func_$ac_func'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:4286: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_func_$ac_func=yes" else @@ -4313,7 +4307,7 @@ fi done echo $ac_n "checking for working mmap""... $ac_c" 1>&6 -echo "configure:4317: checking for working mmap" >&5 +echo "configure:4311: checking for working mmap" >&5 if eval "test \"`echo '$''{'ac_cv_func_mmap_fixed_mapped'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -4321,7 +4315,7 @@ else ac_cv_func_mmap_fixed_mapped=no else cat > conftest.$ac_ext < #include -#if HAVE_SYS_TYPES_H -# include -#endif - -#if HAVE_STDLIB_H -# include -#endif - -#if HAVE_SYS_STAT_H -# include -#endif - -#if HAVE_UNISTD_H -# include -#endif - /* This mess was copied from the GNU getpagesize.h. */ #ifndef HAVE_GETPAGESIZE +# ifdef HAVE_UNISTD_H +# include +# endif /* Assume that all systems that can run configure have sys/param.h. */ # ifndef HAVE_SYS_PARAM_H @@ -4474,7 +4455,7 @@ main() } EOF -if { (eval echo configure:4478: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext} && (./conftest; exit) 2>/dev/null +if { (eval echo configure:4459: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext} && (./conftest; exit) 2>/dev/null then ac_cv_func_mmap_fixed_mapped=yes else @@ -4502,17 +4483,17 @@ unistd.h values.h sys/param.h do ac_safe=`echo "$ac_hdr" | sed 'y%./+-%__p_%'` echo $ac_n "checking for $ac_hdr""... $ac_c" 1>&6 -echo "configure:4506: checking for $ac_hdr" >&5 +echo "configure:4487: checking for $ac_hdr" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:4516: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:4497: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out | grep -v "^conftest.${ac_ext}\$"` if test -z "$ac_err"; then rm -rf conftest* @@ -4542,12 +4523,12 @@ done __argz_count __argz_stringify __argz_next do echo $ac_n "checking for $ac_func""... $ac_c" 1>&6 -echo "configure:4546: checking for $ac_func" >&5 +echo "configure:4527: checking for $ac_func" >&5 if eval "test \"`echo '$''{'ac_cv_func_$ac_func'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:4555: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_func_$ac_func=yes" else @@ -4599,12 +4580,12 @@ done for ac_func in stpcpy do echo $ac_n "checking for $ac_func""... $ac_c" 1>&6 -echo "configure:4603: checking for $ac_func" >&5 +echo "configure:4584: checking for $ac_func" >&5 if eval "test \"`echo '$''{'ac_cv_func_$ac_func'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:4612: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_func_$ac_func=yes" else @@ -4661,19 +4642,19 @@ EOF if test $ac_cv_header_locale_h = yes; then echo $ac_n "checking for LC_MESSAGES""... $ac_c" 1>&6 -echo "configure:4665: checking for LC_MESSAGES" >&5 +echo "configure:4646: checking for LC_MESSAGES" >&5 if eval "test \"`echo '$''{'am_cv_val_LC_MESSAGES'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < int main() { return LC_MESSAGES ; return 0; } EOF -if { (eval echo configure:4677: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:4658: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* am_cv_val_LC_MESSAGES=yes else @@ -4694,7 +4675,7 @@ EOF fi fi echo $ac_n "checking whether NLS is requested""... $ac_c" 1>&6 -echo "configure:4698: checking whether NLS is requested" >&5 +echo "configure:4679: checking whether NLS is requested" >&5 # Check whether --enable-nls or --disable-nls was given. if test "${enable_nls+set}" = set; then enableval="$enable_nls" @@ -4714,7 +4695,7 @@ fi EOF echo $ac_n "checking whether included gettext is requested""... $ac_c" 1>&6 -echo "configure:4718: checking whether included gettext is requested" >&5 +echo "configure:4699: checking whether included gettext is requested" >&5 # Check whether --with-included-gettext or --without-included-gettext was given. if test "${with_included_gettext+set}" = set; then withval="$with_included_gettext" @@ -4733,17 +4714,17 @@ fi ac_safe=`echo "libintl.h" | sed 'y%./+-%__p_%'` echo $ac_n "checking for libintl.h""... $ac_c" 1>&6 -echo "configure:4737: checking for libintl.h" >&5 +echo "configure:4718: checking for libintl.h" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:4747: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:4728: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out | grep -v "^conftest.${ac_ext}\$"` if test -z "$ac_err"; then rm -rf conftest* @@ -4760,19 +4741,19 @@ fi if eval "test \"`echo '$ac_cv_header_'$ac_safe`\" = yes"; then echo "$ac_t""yes" 1>&6 echo $ac_n "checking for gettext in libc""... $ac_c" 1>&6 -echo "configure:4764: checking for gettext in libc" >&5 +echo "configure:4745: checking for gettext in libc" >&5 if eval "test \"`echo '$''{'gt_cv_func_gettext_libc'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < int main() { return (int) gettext ("") ; return 0; } EOF -if { (eval echo configure:4776: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:4757: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* gt_cv_func_gettext_libc=yes else @@ -4788,7 +4769,7 @@ echo "$ac_t""$gt_cv_func_gettext_libc" 1 if test "$gt_cv_func_gettext_libc" != "yes"; then echo $ac_n "checking for bindtextdomain in -lintl""... $ac_c" 1>&6 -echo "configure:4792: checking for bindtextdomain in -lintl" >&5 +echo "configure:4773: checking for bindtextdomain in -lintl" >&5 ac_lib_var=`echo intl'_'bindtextdomain | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -4796,7 +4777,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lintl $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:4792: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -4823,19 +4804,19 @@ fi if eval "test \"`echo '$ac_cv_lib_'$ac_lib_var`\" = yes"; then echo "$ac_t""yes" 1>&6 echo $ac_n "checking for gettext in libintl""... $ac_c" 1>&6 -echo "configure:4827: checking for gettext in libintl" >&5 +echo "configure:4808: checking for gettext in libintl" >&5 if eval "test \"`echo '$''{'gt_cv_func_gettext_libintl'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:4820: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* gt_cv_func_gettext_libintl=yes else @@ -4863,7 +4844,7 @@ EOF # Extract the first word of "msgfmt", so it can be a program name with args. set dummy msgfmt; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:4867: checking for $ac_word" >&5 +echo "configure:4848: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_path_MSGFMT'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -4897,12 +4878,12 @@ fi for ac_func in dcgettext do echo $ac_n "checking for $ac_func""... $ac_c" 1>&6 -echo "configure:4901: checking for $ac_func" >&5 +echo "configure:4882: checking for $ac_func" >&5 if eval "test \"`echo '$''{'ac_cv_func_$ac_func'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:4910: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_func_$ac_func=yes" else @@ -4952,7 +4933,7 @@ done # Extract the first word of "gmsgfmt", so it can be a program name with args. set dummy gmsgfmt; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:4956: checking for $ac_word" >&5 +echo "configure:4937: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_path_GMSGFMT'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -4988,7 +4969,7 @@ fi # Extract the first word of "xgettext", so it can be a program name with args. set dummy xgettext; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:4992: checking for $ac_word" >&5 +echo "configure:4973: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_path_XGETTEXT'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -5020,7 +5001,7 @@ else fi cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:5013: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* CATOBJEXT=.gmo DATADIRNAME=share @@ -5060,7 +5041,7 @@ fi # Extract the first word of "msgfmt", so it can be a program name with args. set dummy msgfmt; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:5064: checking for $ac_word" >&5 +echo "configure:5045: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_path_MSGFMT'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -5094,7 +5075,7 @@ fi # Extract the first word of "gmsgfmt", so it can be a program name with args. set dummy gmsgfmt; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:5098: checking for $ac_word" >&5 +echo "configure:5079: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_path_GMSGFMT'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -5130,7 +5111,7 @@ fi # Extract the first word of "xgettext", so it can be a program name with args. set dummy xgettext; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:5134: checking for $ac_word" >&5 +echo "configure:5115: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_path_XGETTEXT'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -5220,7 +5201,7 @@ fi LINGUAS= else echo $ac_n "checking for catalogs to be installed""... $ac_c" 1>&6 -echo "configure:5224: checking for catalogs to be installed" >&5 +echo "configure:5205: checking for catalogs to be installed" >&5 NEW_LINGUAS= for lang in ${LINGUAS=$ALL_LINGUAS}; do case "$ALL_LINGUAS" in @@ -5248,17 +5229,17 @@ echo "configure:5224: checking for catal if test "$CATOBJEXT" = ".cat"; then ac_safe=`echo "linux/version.h" | sed 'y%./+-%__p_%'` echo $ac_n "checking for linux/version.h""... $ac_c" 1>&6 -echo "configure:5252: checking for linux/version.h" >&5 +echo "configure:5233: checking for linux/version.h" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:5262: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:5243: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out | grep -v "^conftest.${ac_ext}\$"` if test -z "$ac_err"; then rm -rf conftest* @@ -5321,7 +5302,7 @@ fi echo $ac_n "checking whether to enable maintainer-specific portions of Makefiles""... $ac_c" 1>&6 -echo "configure:5325: checking whether to enable maintainer-specific portions of Makefiles" >&5 +echo "configure:5306: checking whether to enable maintainer-specific portions of Makefiles" >&5 # Check whether --enable-maintainer-mode or --disable-maintainer-mode was given. if test "${enable_maintainer_mode+set}" = set; then enableval="$enable_maintainer_mode" @@ -5346,7 +5327,7 @@ fi echo $ac_n "checking for executable suffix""... $ac_c" 1>&6 -echo "configure:5350: checking for executable suffix" >&5 +echo "configure:5331: checking for executable suffix" >&5 if eval "test \"`echo '$''{'ac_cv_exeext'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -5356,10 +5337,10 @@ else rm -f conftest* echo 'int main () { return 0; }' > conftest.$ac_ext ac_cv_exeext= - if { (eval echo configure:5360: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; }; then + if { (eval echo configure:5341: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; }; then for file in conftest.*; do case $file in - *.c | *.o | *.obj) ;; + *.$ac_ext | *.c | *.o | *.obj) ;; *) ac_cv_exeext=`echo $file | sed -e s/conftest//` ;; esac done @@ -5381,17 +5362,17 @@ for ac_hdr in string.h stdlib.h memory.h do ac_safe=`echo "$ac_hdr" | sed 'y%./+-%__p_%'` echo $ac_n "checking for $ac_hdr""... $ac_c" 1>&6 -echo "configure:5385: checking for $ac_hdr" >&5 +echo "configure:5366: checking for $ac_hdr" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:5395: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:5376: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out | grep -v "^conftest.${ac_ext}\$"` if test -z "$ac_err"; then rm -rf conftest* @@ -5421,7 +5402,7 @@ done # Put this here so that autoconf's "cross-compiling" message doesn't confuse # people who are not cross-compiling but are compiling cross-assemblers. echo $ac_n "checking whether compiling a cross-assembler""... $ac_c" 1>&6 -echo "configure:5425: checking whether compiling a cross-assembler" >&5 +echo "configure:5406: checking whether compiling a cross-assembler" >&5 if test "${host}" = "${target}"; then cross_gas=no else @@ -5436,19 +5417,19 @@ echo "$ac_t""$cross_gas" 1>&6 # The Ultrix 4.2 mips builtin alloca declared by alloca.h only works # for constant arguments. Useless! echo $ac_n "checking for working alloca.h""... $ac_c" 1>&6 -echo "configure:5440: checking for working alloca.h" >&5 +echo "configure:5421: checking for working alloca.h" >&5 if eval "test \"`echo '$''{'ac_cv_header_alloca_h'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < int main() { char *p = alloca(2 * sizeof(int)); ; return 0; } EOF -if { (eval echo configure:5452: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:5433: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* ac_cv_header_alloca_h=yes else @@ -5469,12 +5450,12 @@ EOF fi echo $ac_n "checking for alloca""... $ac_c" 1>&6 -echo "configure:5473: checking for alloca" >&5 +echo "configure:5454: checking for alloca" >&5 if eval "test \"`echo '$''{'ac_cv_func_alloca_works'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:5487: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* ac_cv_func_alloca_works=yes else @@ -5534,12 +5515,12 @@ EOF echo $ac_n "checking whether alloca needs Cray hooks""... $ac_c" 1>&6 -echo "configure:5538: checking whether alloca needs Cray hooks" >&5 +echo "configure:5519: checking whether alloca needs Cray hooks" >&5 if eval "test \"`echo '$''{'ac_cv_os_cray'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&6 if test $ac_cv_os_cray = yes; then for ac_func in _getb67 GETB67 getb67; do echo $ac_n "checking for $ac_func""... $ac_c" 1>&6 -echo "configure:5568: checking for $ac_func" >&5 +echo "configure:5549: checking for $ac_func" >&5 if eval "test \"`echo '$''{'ac_cv_func_$ac_func'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:5577: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_func_$ac_func=yes" else @@ -5619,7 +5600,7 @@ done fi echo $ac_n "checking stack direction for C alloca""... $ac_c" 1>&6 -echo "configure:5623: checking stack direction for C alloca" >&5 +echo "configure:5604: checking stack direction for C alloca" >&5 if eval "test \"`echo '$''{'ac_cv_c_stack_direction'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -5627,7 +5608,7 @@ else ac_cv_c_stack_direction=0 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext} && (./conftest; exit) 2>/dev/null +if { (eval echo configure:5631: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext} && (./conftest; exit) 2>/dev/null then ac_cv_c_stack_direction=1 else @@ -5668,21 +5649,21 @@ EOF fi echo $ac_n "checking for inline""... $ac_c" 1>&6 -echo "configure:5672: checking for inline" >&5 +echo "configure:5653: checking for inline" >&5 if eval "test \"`echo '$''{'ac_cv_c_inline'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else ac_cv_c_inline=no for ac_kw in inline __inline__ __inline; do cat > conftest.$ac_ext <&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:5667: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* ac_cv_c_inline=$ac_kw; break else @@ -5712,12 +5693,12 @@ esac for ac_func in unlink remove do echo $ac_n "checking for $ac_func""... $ac_c" 1>&6 -echo "configure:5716: checking for $ac_func" >&5 +echo "configure:5697: checking for $ac_func" >&5 if eval "test \"`echo '$''{'ac_cv_func_$ac_func'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:5725: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_func_$ac_func=yes" else @@ -5769,12 +5750,12 @@ done for ac_func in sbrk do echo $ac_n "checking for $ac_func""... $ac_c" 1>&6 -echo "configure:5773: checking for $ac_func" >&5 +echo "configure:5754: checking for $ac_func" >&5 if eval "test \"`echo '$''{'ac_cv_func_$ac_func'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:5782: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_func_$ac_func=yes" else @@ -5832,7 +5813,7 @@ case $host in ;; *-ncr-sysv4.3*) echo $ac_n "checking for _mwvalidcheckl in -lmw""... $ac_c" 1>&6 -echo "configure:5836: checking for _mwvalidcheckl in -lmw" >&5 +echo "configure:5817: checking for _mwvalidcheckl in -lmw" >&5 ac_lib_var=`echo mw'_'_mwvalidcheckl | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -5840,7 +5821,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lmw $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:5836: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -5872,7 +5853,7 @@ else fi echo $ac_n "checking for main in -lm""... $ac_c" 1>&6 -echo "configure:5876: checking for main in -lm" >&5 +echo "configure:5857: checking for main in -lm" >&5 ac_lib_var=`echo m'_'main | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -5880,14 +5861,14 @@ else ac_save_LIBS="$LIBS" LIBS="-lm $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:5872: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -5910,7 +5891,7 @@ fi ;; *) echo $ac_n "checking for main in -lm""... $ac_c" 1>&6 -echo "configure:5914: checking for main in -lm" >&5 +echo "configure:5895: checking for main in -lm" >&5 ac_lib_var=`echo m'_'main | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -5918,14 +5899,14 @@ else ac_save_LIBS="$LIBS" LIBS="-lm $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:5910: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -5956,12 +5937,12 @@ esac # enough, but on some of those systems, the assert macro relies on requoting # working properly! echo $ac_n "checking for working assert macro""... $ac_c" 1>&6 -echo "configure:5960: checking for working assert macro" >&5 +echo "configure:5941: checking for working assert macro" >&5 if eval "test \"`echo '$''{'gas_cv_assert_ok'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < #include @@ -5977,7 +5958,7 @@ assert (a == b ; return 0; } EOF -if { (eval echo configure:5981: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:5962: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* gas_cv_assert_ok=yes else @@ -6018,12 +5999,12 @@ gas_test_headers=" " echo $ac_n "checking whether declaration is required for strstr""... $ac_c" 1>&6 -echo "configure:6022: checking whether declaration is required for strstr" >&5 +echo "configure:6003: checking whether declaration is required for strstr" >&5 if eval "test \"`echo '$''{'gas_cv_decl_needed_strstr'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:6019: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* gas_cv_decl_needed_strstr=no else @@ -6055,12 +6036,12 @@ fi echo $ac_n "checking whether declaration is required for malloc""... $ac_c" 1>&6 -echo "configure:6059: checking whether declaration is required for malloc" >&5 +echo "configure:6040: checking whether declaration is required for malloc" >&5 if eval "test \"`echo '$''{'gas_cv_decl_needed_malloc'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:6056: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* gas_cv_decl_needed_malloc=no else @@ -6092,12 +6073,12 @@ fi echo $ac_n "checking whether declaration is required for free""... $ac_c" 1>&6 -echo "configure:6096: checking whether declaration is required for free" >&5 +echo "configure:6077: checking whether declaration is required for free" >&5 if eval "test \"`echo '$''{'gas_cv_decl_needed_free'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:6093: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* gas_cv_decl_needed_free=no else @@ -6129,12 +6110,12 @@ fi echo $ac_n "checking whether declaration is required for sbrk""... $ac_c" 1>&6 -echo "configure:6133: checking whether declaration is required for sbrk" >&5 +echo "configure:6114: checking whether declaration is required for sbrk" >&5 if eval "test \"`echo '$''{'gas_cv_decl_needed_sbrk'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:6130: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* gas_cv_decl_needed_sbrk=no else @@ -6166,12 +6147,12 @@ fi echo $ac_n "checking whether declaration is required for environ""... $ac_c" 1>&6 -echo "configure:6170: checking whether declaration is required for environ" >&5 +echo "configure:6151: checking whether declaration is required for environ" >&5 if eval "test \"`echo '$''{'gas_cv_decl_needed_environ'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:6167: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* gas_cv_decl_needed_environ=no else @@ -6206,12 +6187,12 @@ fi # for it? echo $ac_n "checking whether declaration is required for errno""... $ac_c" 1>&6 -echo "configure:6210: checking whether declaration is required for errno" >&5 +echo "configure:6191: checking whether declaration is required for errno" >&5 if eval "test \"`echo '$''{'gas_cv_decl_needed_errno'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then +if { (eval echo configure:6211: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest${ac_exeext}; then rm -rf conftest* gas_cv_decl_needed_errno=no else diff -Nurpa binutils-2.13/gas/configure.in binutils-2.13.1/gas/configure.in --- binutils-2.13/gas/configure.in 2002-07-08 22:41:16.000000000 -0400 +++ binutils-2.13.1/gas/configure.in 2002-10-30 12:13:19.000000000 -0500 @@ -115,14 +115,8 @@ changequote([,])dnl endian= case ${cpu} in alpha*) cpu_type=alpha ;; - armeb) cpu_type=arm endian=big ;; - arm*) cpu_type=arm endian=little ;; - armb*) cpu_type=arm endian=little ;; - armv*l) cpu_type=arm endian=little ;; - armv*b) cpu_type=arm endian=big ;; - xscale*) cpu_type=arm endian=little ;; - strongarm*) cpu_type=arm endian=little ;; - thumb*) cpu_type=arm endian=little ;; + arm*b|xscale*b|strongarm*b) cpu_type=arm endian=big ;; + arm*|xscale*|strongarm*) cpu_type=arm endian=little ;; hppa*) cpu_type=hppa ;; changequote(,)dnl i[3456]86) cpu_type=i386 arch=i386;; diff -Nurpa binutils-2.13/gas/doc/as.info binutils-2.13.1/gas/doc/as.info --- binutils-2.13/gas/doc/as.info 2002-08-06 09:31:33.000000000 -0400 +++ binutils-2.13.1/gas/doc/as.info 2002-11-07 17:39:55.000000000 -0500 @@ -20,412 +20,412 @@ Free Documentation License".  Indirect: as.info-1: 746 -as.info-2: 50206 -as.info-3: 100160 -as.info-4: 149620 -as.info-5: 199441 -as.info-6: 249421 -as.info-7: 296328 -as.info-8: 350312 -as.info-9: 398428 -as.info-10: 430834 -as.info-11: 449258 +as.info-2: 50208 +as.info-3: 100162 +as.info-4: 149622 +as.info-5: 199479 +as.info-6: 249459 +as.info-7: 296366 +as.info-8: 350350 +as.info-9: 398466 +as.info-10: 430872 +as.info-11: 449296  Tag Table: (Indirect) Node: Top746 -Node: Overview1666 -Node: Manual20618 -Node: GNU Assembler21557 -Node: Object Formats22723 -Node: Command Line23170 -Node: Input Files24252 -Node: Object26231 -Node: Errors27178 -Node: Invoking28368 -Node: a30274 -Node: D32033 -Node: f32253 -Node: I32756 -Node: K33295 -Node: L33594 -Node: listing34426 -Node: M36012 -Node: MD40408 -Node: o40827 -Node: R41275 -Node: statistics42291 -Node: traditional-format42691 -Node: v43157 -Node: W43425 -Node: Z44325 -Node: Syntax44840 -Node: Preprocessing45430 -Node: Whitespace46990 -Node: Comments47380 -Node: Symbol Intro49523 -Node: Statements50206 -Node: Constants52120 -Node: Characters52746 -Node: Strings53239 -Node: Chars55392 -Node: Numbers56133 -Node: Integers56664 -Node: Bignums57307 -Node: Flonums57650 -Node: Sections59383 -Node: Secs Background59757 -Node: Ld Sections64783 -Node: As Sections67179 -Node: Sub-Sections68084 -Node: bss71083 -Node: Symbols72028 -Node: Labels72675 -Node: Setting Symbols73401 -Node: Symbol Names73766 -Node: Dot78239 -Node: Symbol Attributes78681 -Node: Symbol Value79413 -Node: Symbol Type80449 -Node: a.out Symbols80828 -Node: Symbol Desc81078 -Node: Symbol Other81360 -Node: COFF Symbols81516 -Node: SOM Symbols82145 -Node: Expressions82578 -Node: Empty Exprs83326 -Node: Integer Exprs83668 -Node: Arguments84058 -Node: Operators85155 -Node: Prefix Ops85481 -Node: Infix Ops85800 -Node: Pseudo Ops88188 -Node: Abort93007 -Node: ABORT93408 -Node: Align93670 -Node: Ascii95859 -Node: Asciz96160 -Node: Balign96400 -Node: Byte98258 -Node: Comm98491 -Node: Data99850 -Node: Def100160 -Node: Desc100528 -Node: Dim101021 -Node: Double101412 -Node: Eject101743 -Node: Else101911 -Node: Elseif102201 -Node: End102485 -Node: Endef102693 -Node: Endfunc103016 -Node: Endif103184 -Node: Equ103437 -Node: Equiv103740 -Node: Err104136 -Node: Exitm104439 -Node: Extern104599 -Node: Fail104853 -Node: File105291 -Node: Fill105900 -Node: Float106857 -Node: Func107191 -Node: Global107771 -Node: Hidden108514 -Node: hword109083 -Node: Ident109404 -Node: If109704 -Node: Incbin112295 -Node: Include112983 -Node: Int113527 -Node: Internal113901 -Node: Irp114536 -Node: Irpc115335 -Node: Lcomm116154 -Node: Lflags116895 -Node: Line117082 -Node: Linkonce118105 -Node: Ln119325 -Node: MRI119473 -Node: List119800 -Node: Long120403 -Node: Macro120573 -Node: Nolist122957 -Node: Octa123373 -Node: Org123699 -Node: P2align124974 -Node: Previous126895 -Node: PopSection127582 -Node: Print128083 -Node: Protected128305 -Node: Psize128942 -Node: Purgem129619 -Node: PushSection129833 -Node: Quad130416 -Node: Rept130862 -Node: Sbttl131268 -Node: Scl131626 -Node: Section132122 -Node: Set135881 -Node: Short136433 -Node: Single136746 -Node: Size137083 -Node: Sleb128137820 -Node: Skip138135 -Node: Space138450 -Node: Stab139335 -Node: String141330 -Node: Struct141749 -Node: SubSection142465 -Node: Symver143019 -Node: Tag145403 -Node: Text145911 -Node: Title146223 -Node: Type146595 -Node: Uleb128147702 -Node: Val148017 -Node: Version148378 -Node: VTableEntry148644 -Node: VTableInherit148925 -Node: Weak149359 -Node: Word149620 -Node: Deprecated151454 -Node: Machine Dependencies151679 -Node: AMD29K-Dependent154155 -Node: AMD29K Options154538 -Node: AMD29K Syntax154712 -Node: AMD29K-Macros154976 -Node: AMD29K-Chars155227 -Node: AMD29K-Regs155490 -Node: AMD29K Floating Point156754 -Node: AMD29K Directives156960 -Node: AMD29K Opcodes158368 -Node: Alpha-Dependent158704 -Node: Alpha Notes159135 -Node: Alpha Options159407 -Node: Alpha Syntax161557 -Node: Alpha-Chars162017 -Node: Alpha-Regs162235 -Node: Alpha-Relocs162606 -Node: Alpha Floating Point168583 -Node: Alpha Directives168796 -Node: Alpha Opcodes173822 -Node: ARC-Dependent174108 -Node: ARC Options174483 -Node: ARC Syntax175535 -Node: ARC-Chars175755 -Node: ARC-Regs175874 -Node: ARC Floating Point175985 -Node: ARC Directives176287 -Node: ARC Opcodes177569 -Node: ARM-Dependent177769 -Node: ARM Options178143 -Node: ARM Syntax183278 -Node: ARM-Chars183498 -Node: ARM-Regs184009 -Node: ARM Floating Point184181 -Node: ARM Directives184371 -Node: ARM Opcodes186438 -Node: CRIS-Dependent188488 -Node: CRIS-Opts188790 -Node: CRIS-Expand190528 -Node: CRIS-Syntax191353 -Node: CRIS-Chars191679 -Node: CRIS-Pic192217 -Ref: crispic192400 -Node: CRIS-Regs195915 -Node: CRIS-Pseudos196319 -Ref: crisnous197082 -Node: D10V-Dependent198144 -Node: D10V-Opts198487 -Node: D10V-Syntax199441 -Node: D10V-Size199961 -Node: D10V-Subs200921 -Node: D10V-Chars201943 -Node: D10V-Regs203529 -Node: D10V-Addressing204560 -Node: D10V-Word205233 -Node: D10V-Float205734 -Node: D10V-Opcodes206036 -Node: D30V-Dependent206420 -Node: D30V-Opts206765 -Node: D30V-Syntax207431 -Node: D30V-Size207954 -Node: D30V-Subs208912 -Node: D30V-Chars209934 -Node: D30V-Guarded212219 -Node: D30V-Regs212887 -Node: D30V-Addressing214013 -Node: D30V-Float214668 -Node: D30V-Opcodes214970 -Node: H8/300-Dependent215354 -Node: H8/300 Options215758 -Node: H8/300 Syntax215939 -Node: H8/300-Chars216226 -Node: H8/300-Regs216510 -Node: H8/300-Addressing217414 -Node: H8/300 Floating Point218440 -Node: H8/300 Directives218756 -Node: H8/300 Opcodes219276 -Node: H8/500-Dependent227629 -Node: H8/500 Options228033 -Node: H8/500 Syntax228214 -Node: H8/500-Chars228501 -Node: H8/500-Regs228792 -Node: H8/500-Addressing229548 -Node: H8/500 Floating Point230165 -Node: H8/500 Directives230481 -Node: H8/500 Opcodes230800 -Node: HPPA-Dependent235913 -Node: HPPA Notes236338 -Node: HPPA Options237085 -Node: HPPA Syntax237269 -Node: HPPA Floating Point238528 -Node: HPPA Directives238723 -Node: HPPA Opcodes245314 -Node: ESA/390-Dependent245562 -Node: ESA/390 Notes246012 -Node: ESA/390 Options246792 -Node: ESA/390 Syntax246991 -Node: ESA/390 Floating Point249152 -Node: ESA/390 Directives249421 -Node: ESA/390 Opcodes252698 -Node: i386-Dependent252949 -Node: i386-Options254007 -Node: i386-Syntax254618 -Node: i386-Mnemonics257021 -Node: i386-Regs259475 -Node: i386-Prefixes261509 -Node: i386-Memory264257 -Node: i386-Jumps267183 -Node: i386-Float268293 -Node: i386-SIMD270111 -Node: i386-16bit271209 -Node: i386-Bugs273234 -Node: i386-Arch273973 -Node: i386-Notes275837 -Node: i860-Dependent276682 -Node: Notes-i860277068 -Node: Options-i860277562 -Node: Directives-i860278567 -Node: Opcodes for i860279229 -Node: i960-Dependent281348 -Node: Options-i960281740 -Node: Floating Point-i960285621 -Node: Directives-i960285878 -Node: Opcodes for i960287898 -Node: callj-i960288504 -Node: Compare-and-branch-i960288979 -Node: M32R-Dependent290868 -Node: M32R-Opts291131 -Node: M32R-Warnings292883 -Node: M68K-Dependent295871 -Node: M68K-Opts296328 -Node: M68K-Syntax302619 -Node: M68K-Moto-Syntax304447 -Node: M68K-Float307025 -Node: M68K-Directives307534 -Node: M68K-opcodes308129 -Node: M68K-Branch308341 -Node: M68K-Chars312527 -Node: M68HC11-Dependent312922 -Node: M68HC11-Opts313325 -Node: M68HC11-Syntax316028 -Node: M68HC11-Float316844 -Node: M68HC11-opcodes317357 -Node: M68HC11-Branch317525 -Node: M88K-Dependent320032 -Node: M88K Directives320273 -Node: MIPS-Dependent321781 -Node: MIPS Opts322791 -Node: MIPS Object328750 -Node: MIPS Stabs330305 -Node: MIPS ISA331016 -Node: MIPS autoextend332146 -Node: MIPS insn332857 -Node: MIPS option stack333343 -Node: MIPS ASE instruction generation overrides334106 -Node: MMIX-Dependent334868 -Node: MMIX-Opts335234 -Node: MMIX-Expand338053 -Node: MMIX-Syntax339357 -Ref: mmixsite339703 -Node: MMIX-Chars340544 -Node: MMIX-Symbols341183 -Node: MMIX-Regs343236 -Node: MMIX-Pseudos344246 -Ref: MMIX-loc344369 -Ref: MMIX-local345449 -Ref: MMIX-is345981 -Ref: MMIX-greg346252 -Ref: GREG-base347171 -Ref: MMIX-byte348488 -Ref: MMIX-constants348959 -Ref: MMIX-prefix349604 -Ref: MMIX-spec349978 -Node: MMIX-mmixal350312 -Node: PDP-11-Dependent353798 -Node: PDP-11-Options354177 -Node: PDP-11-Pseudos359174 -Node: PDP-11-Syntax359508 -Node: PDP-11-Mnemonics360248 -Node: PDP-11-Synthetic360539 -Node: PJ-Dependent360746 -Node: PJ Options360961 -Node: PPC-Dependent361228 -Node: PowerPC-Opts361444 -Node: SH-Dependent363296 -Node: SH Options363678 -Node: SH Syntax364110 -Node: SH-Chars364369 -Node: SH-Regs364648 -Node: SH-Addressing365247 -Node: SH Floating Point366141 -Node: SH Directives366437 -Node: SH Opcodes366793 -Node: SH64-Dependent371040 -Node: SH64 Options371395 -Node: SH64 Syntax372820 -Node: SH64-Chars373089 -Node: SH64-Regs373374 -Node: SH64-Addressing374455 -Node: SH64 Directives375623 -Node: SH64 Opcodes376720 -Node: Sparc-Dependent377424 -Node: Sparc-Opts377797 -Node: Sparc-Aligned-Data380043 -Node: Sparc-Float380887 -Node: Sparc-Directives381077 -Node: Z8000-Dependent383026 -Node: Z8000 Options383985 -Node: Z8000 Syntax384160 -Node: Z8000-Chars384436 -Node: Z8000-Regs384654 -Node: Z8000-Addressing385444 -Node: Z8000 Directives386387 -Node: Z8000 Opcodes387985 -Node: Vax-Dependent397921 -Node: VAX-Opts398428 -Node: VAX-float402152 -Node: VAX-directives402773 -Node: VAX-opcodes403622 -Node: VAX-branch404000 -Node: VAX-operands406496 -Node: VAX-no407248 -Node: V850-Dependent407474 -Node: V850 Options407860 -Node: V850 Syntax409673 -Node: V850-Chars409899 -Node: V850-Regs410049 -Node: V850 Floating Point411586 -Node: V850 Directives411781 -Node: V850 Opcodes412681 -Node: Reporting Bugs417966 -Node: Bug Criteria418689 -Node: Bug Reporting419449 -Node: Acknowledgements426017 -Ref: Acknowledgements-Footnote-1430808 -Node: GNU Free Documentation License430834 -Node: Index449258 +Node: Overview1668 +Node: Manual20620 +Node: GNU Assembler21559 +Node: Object Formats22725 +Node: Command Line23172 +Node: Input Files24254 +Node: Object26233 +Node: Errors27180 +Node: Invoking28370 +Node: a30276 +Node: D32035 +Node: f32255 +Node: I32758 +Node: K33297 +Node: L33596 +Node: listing34428 +Node: M36014 +Node: MD40410 +Node: o40829 +Node: R41277 +Node: statistics42293 +Node: traditional-format42693 +Node: v43159 +Node: W43427 +Node: Z44327 +Node: Syntax44842 +Node: Preprocessing45432 +Node: Whitespace46992 +Node: Comments47382 +Node: Symbol Intro49525 +Node: Statements50208 +Node: Constants52122 +Node: Characters52748 +Node: Strings53241 +Node: Chars55394 +Node: Numbers56135 +Node: Integers56666 +Node: Bignums57309 +Node: Flonums57652 +Node: Sections59385 +Node: Secs Background59759 +Node: Ld Sections64785 +Node: As Sections67181 +Node: Sub-Sections68086 +Node: bss71085 +Node: Symbols72030 +Node: Labels72677 +Node: Setting Symbols73403 +Node: Symbol Names73768 +Node: Dot78241 +Node: Symbol Attributes78683 +Node: Symbol Value79415 +Node: Symbol Type80451 +Node: a.out Symbols80830 +Node: Symbol Desc81080 +Node: Symbol Other81362 +Node: COFF Symbols81518 +Node: SOM Symbols82147 +Node: Expressions82580 +Node: Empty Exprs83328 +Node: Integer Exprs83670 +Node: Arguments84060 +Node: Operators85157 +Node: Prefix Ops85483 +Node: Infix Ops85802 +Node: Pseudo Ops88190 +Node: Abort93009 +Node: ABORT93410 +Node: Align93672 +Node: Ascii95861 +Node: Asciz96162 +Node: Balign96402 +Node: Byte98260 +Node: Comm98493 +Node: Data99852 +Node: Def100162 +Node: Desc100530 +Node: Dim101023 +Node: Double101414 +Node: Eject101745 +Node: Else101913 +Node: Elseif102203 +Node: End102487 +Node: Endef102695 +Node: Endfunc103018 +Node: Endif103186 +Node: Equ103439 +Node: Equiv103742 +Node: Err104138 +Node: Exitm104441 +Node: Extern104601 +Node: Fail104855 +Node: File105293 +Node: Fill105902 +Node: Float106859 +Node: Func107193 +Node: Global107773 +Node: Hidden108516 +Node: hword109085 +Node: Ident109406 +Node: If109706 +Node: Incbin112297 +Node: Include112985 +Node: Int113529 +Node: Internal113903 +Node: Irp114538 +Node: Irpc115337 +Node: Lcomm116156 +Node: Lflags116897 +Node: Line117084 +Node: Linkonce118107 +Node: Ln119327 +Node: MRI119475 +Node: List119802 +Node: Long120405 +Node: Macro120575 +Node: Nolist122959 +Node: Octa123375 +Node: Org123701 +Node: P2align124976 +Node: Previous126897 +Node: PopSection127584 +Node: Print128085 +Node: Protected128307 +Node: Psize128944 +Node: Purgem129621 +Node: PushSection129835 +Node: Quad130418 +Node: Rept130864 +Node: Sbttl131270 +Node: Scl131628 +Node: Section132124 +Node: Set135883 +Node: Short136435 +Node: Single136748 +Node: Size137085 +Node: Sleb128137822 +Node: Skip138137 +Node: Space138452 +Node: Stab139337 +Node: String141332 +Node: Struct141751 +Node: SubSection142467 +Node: Symver143021 +Node: Tag145405 +Node: Text145913 +Node: Title146225 +Node: Type146597 +Node: Uleb128147704 +Node: Val148019 +Node: Version148380 +Node: VTableEntry148646 +Node: VTableInherit148927 +Node: Weak149361 +Node: Word149622 +Node: Deprecated151456 +Node: Machine Dependencies151681 +Node: AMD29K-Dependent154157 +Node: AMD29K Options154540 +Node: AMD29K Syntax154714 +Node: AMD29K-Macros154978 +Node: AMD29K-Chars155229 +Node: AMD29K-Regs155492 +Node: AMD29K Floating Point156756 +Node: AMD29K Directives156962 +Node: AMD29K Opcodes158370 +Node: Alpha-Dependent158706 +Node: Alpha Notes159137 +Node: Alpha Options159409 +Node: Alpha Syntax161595 +Node: Alpha-Chars162055 +Node: Alpha-Regs162273 +Node: Alpha-Relocs162644 +Node: Alpha Floating Point168621 +Node: Alpha Directives168834 +Node: Alpha Opcodes173860 +Node: ARC-Dependent174146 +Node: ARC Options174521 +Node: ARC Syntax175573 +Node: ARC-Chars175793 +Node: ARC-Regs175912 +Node: ARC Floating Point176023 +Node: ARC Directives176325 +Node: ARC Opcodes177607 +Node: ARM-Dependent177807 +Node: ARM Options178181 +Node: ARM Syntax183316 +Node: ARM-Chars183536 +Node: ARM-Regs184047 +Node: ARM Floating Point184219 +Node: ARM Directives184409 +Node: ARM Opcodes186476 +Node: CRIS-Dependent188526 +Node: CRIS-Opts188828 +Node: CRIS-Expand190566 +Node: CRIS-Syntax191391 +Node: CRIS-Chars191717 +Node: CRIS-Pic192255 +Ref: crispic192438 +Node: CRIS-Regs195953 +Node: CRIS-Pseudos196357 +Ref: crisnous197120 +Node: D10V-Dependent198182 +Node: D10V-Opts198525 +Node: D10V-Syntax199479 +Node: D10V-Size199999 +Node: D10V-Subs200959 +Node: D10V-Chars201981 +Node: D10V-Regs203567 +Node: D10V-Addressing204598 +Node: D10V-Word205271 +Node: D10V-Float205772 +Node: D10V-Opcodes206074 +Node: D30V-Dependent206458 +Node: D30V-Opts206803 +Node: D30V-Syntax207469 +Node: D30V-Size207992 +Node: D30V-Subs208950 +Node: D30V-Chars209972 +Node: D30V-Guarded212257 +Node: D30V-Regs212925 +Node: D30V-Addressing214051 +Node: D30V-Float214706 +Node: D30V-Opcodes215008 +Node: H8/300-Dependent215392 +Node: H8/300 Options215796 +Node: H8/300 Syntax215977 +Node: H8/300-Chars216264 +Node: H8/300-Regs216548 +Node: H8/300-Addressing217452 +Node: H8/300 Floating Point218478 +Node: H8/300 Directives218794 +Node: H8/300 Opcodes219314 +Node: H8/500-Dependent227667 +Node: H8/500 Options228071 +Node: H8/500 Syntax228252 +Node: H8/500-Chars228539 +Node: H8/500-Regs228830 +Node: H8/500-Addressing229586 +Node: H8/500 Floating Point230203 +Node: H8/500 Directives230519 +Node: H8/500 Opcodes230838 +Node: HPPA-Dependent235951 +Node: HPPA Notes236376 +Node: HPPA Options237123 +Node: HPPA Syntax237307 +Node: HPPA Floating Point238566 +Node: HPPA Directives238761 +Node: HPPA Opcodes245352 +Node: ESA/390-Dependent245600 +Node: ESA/390 Notes246050 +Node: ESA/390 Options246830 +Node: ESA/390 Syntax247029 +Node: ESA/390 Floating Point249190 +Node: ESA/390 Directives249459 +Node: ESA/390 Opcodes252736 +Node: i386-Dependent252987 +Node: i386-Options254045 +Node: i386-Syntax254656 +Node: i386-Mnemonics257059 +Node: i386-Regs259513 +Node: i386-Prefixes261547 +Node: i386-Memory264295 +Node: i386-Jumps267221 +Node: i386-Float268331 +Node: i386-SIMD270149 +Node: i386-16bit271247 +Node: i386-Bugs273272 +Node: i386-Arch274011 +Node: i386-Notes275875 +Node: i860-Dependent276720 +Node: Notes-i860277106 +Node: Options-i860277600 +Node: Directives-i860278605 +Node: Opcodes for i860279267 +Node: i960-Dependent281386 +Node: Options-i960281778 +Node: Floating Point-i960285659 +Node: Directives-i960285916 +Node: Opcodes for i960287936 +Node: callj-i960288542 +Node: Compare-and-branch-i960289017 +Node: M32R-Dependent290906 +Node: M32R-Opts291169 +Node: M32R-Warnings292921 +Node: M68K-Dependent295909 +Node: M68K-Opts296366 +Node: M68K-Syntax302657 +Node: M68K-Moto-Syntax304485 +Node: M68K-Float307063 +Node: M68K-Directives307572 +Node: M68K-opcodes308167 +Node: M68K-Branch308379 +Node: M68K-Chars312565 +Node: M68HC11-Dependent312960 +Node: M68HC11-Opts313363 +Node: M68HC11-Syntax316066 +Node: M68HC11-Float316882 +Node: M68HC11-opcodes317395 +Node: M68HC11-Branch317563 +Node: M88K-Dependent320070 +Node: M88K Directives320311 +Node: MIPS-Dependent321819 +Node: MIPS Opts322829 +Node: MIPS Object328788 +Node: MIPS Stabs330343 +Node: MIPS ISA331054 +Node: MIPS autoextend332184 +Node: MIPS insn332895 +Node: MIPS option stack333381 +Node: MIPS ASE instruction generation overrides334144 +Node: MMIX-Dependent334906 +Node: MMIX-Opts335272 +Node: MMIX-Expand338091 +Node: MMIX-Syntax339395 +Ref: mmixsite339741 +Node: MMIX-Chars340582 +Node: MMIX-Symbols341221 +Node: MMIX-Regs343274 +Node: MMIX-Pseudos344284 +Ref: MMIX-loc344407 +Ref: MMIX-local345487 +Ref: MMIX-is346019 +Ref: MMIX-greg346290 +Ref: GREG-base347209 +Ref: MMIX-byte348526 +Ref: MMIX-constants348997 +Ref: MMIX-prefix349642 +Ref: MMIX-spec350016 +Node: MMIX-mmixal350350 +Node: PDP-11-Dependent353836 +Node: PDP-11-Options354215 +Node: PDP-11-Pseudos359212 +Node: PDP-11-Syntax359546 +Node: PDP-11-Mnemonics360286 +Node: PDP-11-Synthetic360577 +Node: PJ-Dependent360784 +Node: PJ Options360999 +Node: PPC-Dependent361266 +Node: PowerPC-Opts361482 +Node: SH-Dependent363334 +Node: SH Options363716 +Node: SH Syntax364148 +Node: SH-Chars364407 +Node: SH-Regs364686 +Node: SH-Addressing365285 +Node: SH Floating Point366179 +Node: SH Directives366475 +Node: SH Opcodes366831 +Node: SH64-Dependent371078 +Node: SH64 Options371433 +Node: SH64 Syntax372858 +Node: SH64-Chars373127 +Node: SH64-Regs373412 +Node: SH64-Addressing374493 +Node: SH64 Directives375661 +Node: SH64 Opcodes376758 +Node: Sparc-Dependent377462 +Node: Sparc-Opts377835 +Node: Sparc-Aligned-Data380081 +Node: Sparc-Float380925 +Node: Sparc-Directives381115 +Node: Z8000-Dependent383064 +Node: Z8000 Options384023 +Node: Z8000 Syntax384198 +Node: Z8000-Chars384474 +Node: Z8000-Regs384692 +Node: Z8000-Addressing385482 +Node: Z8000 Directives386425 +Node: Z8000 Opcodes388023 +Node: Vax-Dependent397959 +Node: VAX-Opts398466 +Node: VAX-float402190 +Node: VAX-directives402811 +Node: VAX-opcodes403660 +Node: VAX-branch404038 +Node: VAX-operands406534 +Node: VAX-no407286 +Node: V850-Dependent407512 +Node: V850 Options407898 +Node: V850 Syntax409711 +Node: V850-Chars409937 +Node: V850-Regs410087 +Node: V850 Floating Point411624 +Node: V850 Directives411819 +Node: V850 Opcodes412719 +Node: Reporting Bugs418004 +Node: Bug Criteria418727 +Node: Bug Reporting419487 +Node: Acknowledgements426055 +Ref: Acknowledgements-Footnote-1430846 +Node: GNU Free Documentation License430872 +Node: Index449296  End Tag Table diff -Nurpa binutils-2.13/gas/doc/as.info-1 binutils-2.13.1/gas/doc/as.info-1 --- binutils-2.13/gas/doc/as.info-1 2002-08-06 09:31:33.000000000 -0400 +++ binutils-2.13.1/gas/doc/as.info-1 2002-11-07 17:39:55.000000000 -0500 @@ -23,7 +23,7 @@ File: as.info, Node: Top, Next: Overvi Using as ******** - This file is a user guide to the GNU assembler `as' version 2.13. + This file is a user guide to the GNU assembler `as' version 2.13.1. This document is distributed under the terms of the GNU Free Documentation License. A copy of the license is included in the diff -Nurpa binutils-2.13/gas/doc/as.info-4 binutils-2.13.1/gas/doc/as.info-4 --- binutils-2.13/gas/doc/as.info-4 2002-08-06 09:31:33.000000000 -0400 +++ binutils-2.13.1/gas/doc/as.info-4 2002-11-07 17:39:55.000000000 -0500 @@ -337,10 +337,10 @@ Options `.arch' directive. The following processor names are recognized: `21064', `21064a', - `21066', `21068', `21164', `21164a', `21164pc', `21264', `ev4', - `ev5', `lca45', `ev5', `ev56', `pca56', `ev6'. The special name - `all' may be used to allow the assembler to accept instructions - valid for any Alpha processor. + `21066', `21068', `21164', `21164a', `21164pc', `21264', `21264a', + `21264b', `ev4', `ev5', `lca45', `ev5', `ev56', `pca56', `ev6', + `ev67', `ev68'. The special name `all' may be used to allow the + assembler to accept instructions valid for any Alpha processor. In order to support existing practice in OSF/1 with respect to `.arch', and existing practice within `MILO' (the Linux ARC diff -Nurpa binutils-2.13/gas/doc/c-alpha.texi binutils-2.13.1/gas/doc/c-alpha.texi --- binutils-2.13/gas/doc/c-alpha.texi 2002-05-30 18:34:41.000000000 -0400 +++ binutils-2.13.1/gas/doc/c-alpha.texi 2002-09-23 18:14:24.000000000 -0400 @@ -55,13 +55,17 @@ The following processor names are recogn @code{21164a}, @code{21164pc}, @code{21264}, +@code{21264a}, +@code{21264b}, @code{ev4}, @code{ev5}, @code{lca45}, @code{ev5}, @code{ev56}, @code{pca56}, -@code{ev6}. +@code{ev6}, +@code{ev67}, +@code{ev68}. The special name @code{all} may be used to allow the assembler to accept instructions valid for any Alpha processor. diff -Nurpa binutils-2.13/gas/doc/gasp.texi binutils-2.13.1/gas/doc/gasp.texi --- binutils-2.13/gas/doc/gasp.texi 2002-02-21 13:09:08.000000000 -0500 +++ binutils-2.13.1/gas/doc/gasp.texi 2002-10-28 13:45:50.000000000 -0500 @@ -110,7 +110,7 @@ output. @emph{Note} The use of @sc{gasp} has now been deprecated. Anything that it could do can now be done by the macro facilities built into -@sc{gas} itself. At some point in the future the @{gasp} sources will +@sc{gas} itself. At some point in the future the @sc{gasp} sources will be removed entirely from the binutils distribution. Here is a small example to give the flavor of @sc{gasp}. This input to diff -Nurpa binutils-2.13/gas/doc/gasver.texi binutils-2.13.1/gas/doc/gasver.texi --- binutils-2.13/gas/doc/gasver.texi 2002-08-06 09:31:33.000000000 -0400 +++ binutils-2.13.1/gas/doc/gasver.texi 2002-11-07 17:39:55.000000000 -0500 @@ -1 +1 @@ -@set VERSION 2.13 +@set VERSION 2.13.1 diff -Nurpa binutils-2.13/gas/dwarf2dbg.c binutils-2.13.1/gas/dwarf2dbg.c --- binutils-2.13/gas/dwarf2dbg.c 2002-08-01 11:03:02.000000000 -0400 +++ binutils-2.13.1/gas/dwarf2dbg.c 2002-09-23 18:14:22.000000000 -0400 @@ -1148,6 +1148,7 @@ out_debug_abbrev (abbrev_seg) out_abbrev (DW_AT_low_pc, DW_FORM_addr); out_abbrev (DW_AT_high_pc, DW_FORM_addr); } + out_abbrev (DW_AT_name, DW_FORM_string); out_abbrev (DW_AT_comp_dir, DW_FORM_string); out_abbrev (DW_AT_producer, DW_FORM_string); out_abbrev (DW_AT_language, DW_FORM_data2); @@ -1223,6 +1224,16 @@ out_debug_info (info_seg, abbrev_seg, li emit_expr (&expr, sizeof_address); } + /* DW_AT_name. We don't have the actual file name that was present + on the command line, so assume files[1] is the main input file. + We're not supposed to get called unless at least one line number + entry was emitted, so this should always be defined. */ + if (!files || files_in_use < 1) + abort (); + len = strlen (files[1].filename) + 1; + p = frag_more (len); + memcpy (p, files[1].filename, len); + /* DW_AT_comp_dir */ comp_dir = getpwd (); len = strlen (comp_dir) + 1; diff -Nurpa binutils-2.13/gas/itbl-lex.c binutils-2.13.1/gas/itbl-lex.c --- binutils-2.13/gas/itbl-lex.c 2002-08-05 16:43:46.000000000 -0400 +++ binutils-2.13.1/gas/itbl-lex.c 2002-10-30 12:02:38.000000000 -0500 @@ -1,7 +1,7 @@ /* A lexical scanner generated by flex */ /* Scanner skeleton version: - * $Header: /cvs/src/src/gas/Attic/itbl-lex.c,v 1.1.8.1 2002/08/05 20:43:46 drow Exp $ + * $Header: /cvs/src/src/gas/Attic/itbl-lex.c,v 1.1.8.2 2002/10/30 17:02:38 drow Exp $ */ #define FLEX_SCANNER @@ -428,7 +428,8 @@ char *yytext; #include #include #include -#include "itbl-parse.h" + +#include #ifdef DEBUG #define DBG(x) printf x @@ -439,7 +440,7 @@ char *yytext; #endif int insntbl_line = 1; -#line 443 "lex.yy.c" +#line 444 "lex.yy.c" /* Macros after this point can all be overridden by user definitions in * section 1. @@ -601,10 +602,10 @@ YY_DECL register char *yy_cp, *yy_bp; register int yy_act; -#line 43 "itbl-lex.l" +#line 44 "itbl-lex.l" -#line 608 "lex.yy.c" +#line 609 "lex.yy.c" if ( yy_init ) { @@ -689,49 +690,49 @@ do_action: /* This label is used only to case 1: YY_RULE_SETUP -#line 45 "itbl-lex.l" +#line 46 "itbl-lex.l" { return CREG; } YY_BREAK case 2: YY_RULE_SETUP -#line 48 "itbl-lex.l" +#line 49 "itbl-lex.l" { return DREG; } YY_BREAK case 3: YY_RULE_SETUP -#line 51 "itbl-lex.l" +#line 52 "itbl-lex.l" { return GREG; } YY_BREAK case 4: YY_RULE_SETUP -#line 54 "itbl-lex.l" +#line 55 "itbl-lex.l" { return IMMED; } YY_BREAK case 5: YY_RULE_SETUP -#line 57 "itbl-lex.l" +#line 58 "itbl-lex.l" { return ADDR; } YY_BREAK case 6: YY_RULE_SETUP -#line 60 "itbl-lex.l" +#line 61 "itbl-lex.l" { return INSN; } YY_BREAK case 7: YY_RULE_SETUP -#line 63 "itbl-lex.l" +#line 64 "itbl-lex.l" { yytext[yyleng] = 0; yylval.processor = strtoul (yytext+1, 0, 0); @@ -740,7 +741,7 @@ YY_RULE_SETUP YY_BREAK case 8: YY_RULE_SETUP -#line 68 "itbl-lex.l" +#line 69 "itbl-lex.l" { yytext[yyleng] = 0; yylval.num = strtoul (yytext, 0, 0); @@ -749,7 +750,7 @@ YY_RULE_SETUP YY_BREAK case 9: YY_RULE_SETUP -#line 73 "itbl-lex.l" +#line 74 "itbl-lex.l" { yytext[yyleng] = 0; yylval.num = strtoul (yytext, 0, 0); @@ -758,7 +759,7 @@ YY_RULE_SETUP YY_BREAK case 10: YY_RULE_SETUP -#line 78 "itbl-lex.l" +#line 79 "itbl-lex.l" { yytext[yyleng] = 0; yylval.str = strdup (yytext); @@ -767,7 +768,7 @@ YY_RULE_SETUP YY_BREAK case 11: YY_RULE_SETUP -#line 83 "itbl-lex.l" +#line 84 "itbl-lex.l" { int c; while ((c = input ()) != EOF) @@ -782,7 +783,7 @@ YY_RULE_SETUP YY_BREAK case 12: YY_RULE_SETUP -#line 94 "itbl-lex.l" +#line 95 "itbl-lex.l" { insntbl_line++; MDBG (("in lex, NL = %d (x%x)\n", NL, NL)); @@ -791,13 +792,13 @@ YY_RULE_SETUP YY_BREAK case 13: YY_RULE_SETUP -#line 99 "itbl-lex.l" +#line 100 "itbl-lex.l" { } YY_BREAK case 14: YY_RULE_SETUP -#line 101 "itbl-lex.l" +#line 102 "itbl-lex.l" { MDBG (("char = %x, %d\n", yytext[0], yytext[0])); return yytext[0]; @@ -805,10 +806,10 @@ YY_RULE_SETUP YY_BREAK case 15: YY_RULE_SETUP -#line 105 "itbl-lex.l" +#line 106 "itbl-lex.l" ECHO; YY_BREAK -#line 812 "lex.yy.c" +#line 813 "lex.yy.c" case YY_STATE_EOF(INITIAL): yyterminate(); @@ -1698,7 +1699,7 @@ int main() return 0; } #endif -#line 105 "itbl-lex.l" +#line 106 "itbl-lex.l" #ifndef yywrap diff -Nurpa binutils-2.13/gas/itbl-lex.l binutils-2.13.1/gas/itbl-lex.l --- binutils-2.13/gas/itbl-lex.l 2001-09-19 01:33:19.000000000 -0400 +++ binutils-2.13.1/gas/itbl-lex.l 2002-10-29 22:54:28.000000000 -0500 @@ -22,7 +22,8 @@ #include #include #include -#include "itbl-parse.h" + +#include #ifdef DEBUG #define DBG(x) printf x diff -Nurpa binutils-2.13/gas/itbl-ops.c binutils-2.13.1/gas/itbl-ops.c --- binutils-2.13/gas/itbl-ops.c 2001-10-11 08:20:25.000000000 -0400 +++ binutils-2.13.1/gas/itbl-ops.c 2002-10-29 22:54:28.000000000 -0500 @@ -92,7 +92,7 @@ #include #include #include "itbl-ops.h" -#include "itbl-parse.h" +#include /* #define DEBUG */ diff -Nurpa binutils-2.13/gas/itbl-parse.c binutils-2.13.1/gas/itbl-parse.c --- binutils-2.13/gas/itbl-parse.c 2002-08-05 16:43:47.000000000 -0400 +++ binutils-2.13.1/gas/itbl-parse.c 2002-11-07 13:53:42.000000000 -0500 @@ -358,9 +358,9 @@ static const short yyrhs[] = /* YYRLINE[YYN] -- source line where rule number YYN was defined. */ static const short yyrline[] = { - 0, 300, 304, 306, 309, 316, 316, 324, 325, 328, - 330, 331, 334, 340, 345, 352, 361, 366, 370, 376, - 382, 388, 395, 402, 410, 416, 421, 428, 436, 444 + 0, 300, 304, 306, 309, 316, 316, 325, 326, 329, + 331, 332, 335, 341, 346, 353, 362, 367, 371, 377, + 383, 389, 396, 403, 411, 417, 422, 429, 437, 445 }; #endif @@ -451,7 +451,7 @@ static const short yycheck[] = 36, 45, 6, 38, 13, 16 }; /* -*-C-*- Note some compilers choke on comments on `#line' lines. */ -#line 3 "/usr/share/bison/bison.simple" +#line 3 "/usr/share/bison-1.35/bison.simple" /* Skeleton output parser for bison, @@ -764,7 +764,7 @@ yystpcpy (yydest, yysrc) # endif #endif -#line 315 "/usr/share/bison/bison.simple" +#line 315 "/usr/share/bison-1.35/bison.simple" /* The user can define YYPARSE_PARAM as the name of an argument to be passed @@ -1174,29 +1174,33 @@ case 5: insn=itbl_add_insn (yyvsp[-5].num, yyvsp[-3].str, yyvsp[-2].val, sbit, ebit, yyvsp[0].val); } break; +case 6: +#line 324 "itbl-parse.y" +{} + break; case 12: -#line 336 "itbl-parse.y" +#line 337 "itbl-parse.y" { DBGL2 (("ftype\n")); yyval.num = yyvsp[0].num; } break; case 13: -#line 341 "itbl-parse.y" +#line 342 "itbl-parse.y" { DBGL2 (("addr\n")); yyval.num = ADDR; } break; case 14: -#line 346 "itbl-parse.y" +#line 347 "itbl-parse.y" { DBGL2 (("immed\n")); yyval.num = IMMED; } break; case 15: -#line 354 "itbl-parse.y" +#line 355 "itbl-parse.y" { DBG (("line %d: field type=%d sbit=%d ebit=%d, flags=0x%x\n", insntbl_line, yyvsp[-2].num, sbit, ebit, yyvsp[0].val)); @@ -1204,38 +1208,38 @@ case 15: } break; case 16: -#line 363 "itbl-parse.y" +#line 364 "itbl-parse.y" { yyval.val = yyvsp[-2].num | yyvsp[0].val; } break; case 17: -#line 367 "itbl-parse.y" +#line 368 "itbl-parse.y" { yyval.val = yyvsp[-1].val; } break; case 18: -#line 371 "itbl-parse.y" +#line 372 "itbl-parse.y" { yyval.val = yyvsp[0].num; } break; case 19: -#line 378 "itbl-parse.y" +#line 379 "itbl-parse.y" { DBGL2 (("flags=%d\n", yyvsp[0].val)); yyval.val = yyvsp[0].val; } break; case 20: -#line 383 "itbl-parse.y" +#line 384 "itbl-parse.y" { yyval.val = 0; } break; case 21: -#line 390 "itbl-parse.y" +#line 391 "itbl-parse.y" { DBGL2 (("range %d %d\n", yyvsp[-2].num, yyvsp[0].num)); sbit = yyvsp[-2].num; @@ -1243,56 +1247,56 @@ case 21: } break; case 22: -#line 396 "itbl-parse.y" +#line 397 "itbl-parse.y" { sbit = 31; ebit = 0; } break; case 23: -#line 404 "itbl-parse.y" +#line 405 "itbl-parse.y" { DBGL2 (("pnum=%d\n",yyvsp[0].num)); yyval.num = yyvsp[0].num; } break; case 24: -#line 412 "itbl-parse.y" +#line 413 "itbl-parse.y" { DBGL2 (("dreg\n")); yyval.num = DREG; } break; case 25: -#line 417 "itbl-parse.y" +#line 418 "itbl-parse.y" { DBGL2 (("creg\n")); yyval.num = CREG; } break; case 26: -#line 422 "itbl-parse.y" +#line 423 "itbl-parse.y" { DBGL2 (("greg\n")); yyval.num = GREG; } break; case 27: -#line 430 "itbl-parse.y" +#line 431 "itbl-parse.y" { DBGL2 (("name=%s\n",yyvsp[0].str)); yyval.str = yyvsp[0].str; } break; case 28: -#line 438 "itbl-parse.y" +#line 439 "itbl-parse.y" { DBGL2 (("num=%d\n",yyvsp[0].num)); yyval.num = yyvsp[0].num; } break; case 29: -#line 446 "itbl-parse.y" +#line 447 "itbl-parse.y" { DBGL2 (("val=x%x\n",yyvsp[0].num)); yyval.val = yyvsp[0].num; @@ -1300,7 +1304,7 @@ case 29: break; } -#line 705 "/usr/share/bison/bison.simple" +#line 705 "/usr/share/bison-1.35/bison.simple" yyvsp -= yylen; @@ -1531,7 +1535,7 @@ yyreturn: #endif return yyresult; } -#line 451 "itbl-parse.y" +#line 452 "itbl-parse.y" static int diff -Nurpa binutils-2.13/gas/itbl-parse.y binutils-2.13.1/gas/itbl-parse.y --- binutils-2.13/gas/itbl-parse.y 2001-03-08 18:24:22.000000000 -0500 +++ binutils-2.13.1/gas/itbl-parse.y 2002-10-16 21:29:54.000000000 -0400 @@ -321,6 +321,7 @@ entry: insn=itbl_add_insn ($1, $3, $4, sbit, ebit, $6); } fieldspecs NL + {} | NL | error NL ; diff -Nurpa binutils-2.13/gas/po/gas.pot binutils-2.13.1/gas/po/gas.pot --- binutils-2.13/gas/po/gas.pot 2002-07-23 16:17:50.000000000 -0400 +++ binutils-2.13.1/gas/po/gas.pot 2002-10-30 11:29:43.000000000 -0500 @@ -1,12 +1,13 @@ # SOME DESCRIPTIVE TITLE. -# Copyright (C) YEAR Free Software Foundation, Inc. +# Copyright (C) YEAR THE PACKAGE'S COPYRIGHT HOLDER +# This file is distributed under the same license as the PACKAGE package. # FIRST AUTHOR , YEAR. # #, fuzzy msgid "" msgstr "" "Project-Id-Version: PACKAGE VERSION\n" -"POT-Creation-Date: 2002-07-23 15:57-0400\n" +"POT-Creation-Date: 2002-10-30 10:07-0500\n" "PO-Revision-Date: YEAR-MO-DA HO:MI+ZONE\n" "Last-Translator: FULL NAME \n" "Language-Team: LANGUAGE \n" @@ -346,7 +347,7 @@ msgstr "" #. * We have a GROSS internal error. #. * This should never happen. #. -#: atof-generic.c:437 config/tc-m68k.c:2879 +#: atof-generic.c:437 config/tc-m68k.c:2883 msgid "failed sanity check" msgstr "" @@ -443,7 +444,7 @@ msgstr "" msgid "%s: bad type for weak symbol" msgstr "" -#: config/obj-aout.c:458 config/obj-coff.c:2941 write.c:1952 +#: config/obj-aout.c:458 config/obj-coff.c:2941 write.c:1927 #, c-format msgid "%s: global symbols not supported in common sections" msgstr "" @@ -552,12 +553,12 @@ msgstr "" msgid "unsupported section attribute '%c'" msgstr "" -#: config/obj-coff.c:1483 config/obj-coff.c:3755 config/tc-ppc.c:4222 +#: config/obj-coff.c:1483 config/obj-coff.c:3755 config/tc-ppc.c:4243 #, c-format msgid "unknown section attribute '%c'" msgstr "" -#: config/obj-coff.c:1513 config/tc-ppc.c:4240 config/tc-tic54x.c:4339 +#: config/obj-coff.c:1513 config/tc-ppc.c:4261 config/tc-tic54x.c:4339 #: read.c:2560 #, c-format msgid "error setting flags for \"%s\": %s" @@ -640,7 +641,7 @@ msgstr "" #. This is a COBR instruction. They have only a 13-bit #. displacement and are only to be used for local branches: #. flag as error, don't generate relocation. -#: config/obj-coff.c:4416 config/tc-i960.c:3227 write.c:2845 +#: config/obj-coff.c:4416 config/tc-i960.c:3227 write.c:2820 msgid "can't use COBR format with external label" msgstr "" @@ -672,7 +673,7 @@ msgid ".COMMon length (%d.) <0! Ignored. msgstr "" #: config/obj-elf.c:330 ecoff.c:3397 read.c:1403 read.c:1504 read.c:2142 -#: read.c:2231 read.c:2861 read.c:4942 symbols.c:361 symbols.c:460 +#: read.c:2231 read.c:2861 read.c:4951 symbols.c:361 symbols.c:460 #, c-format msgid "symbol `%s' is already defined" msgstr "" @@ -1016,7 +1017,7 @@ msgstr "" #. Probably a memory allocation problem? Give up now. #: config/tc-a29k.c:330 config/tc-dlx.c:369 config/tc-hppa.c:1464 -#: config/tc-mips.c:1063 config/tc-mips.c:1105 config/tc-or32.c:230 +#: config/tc-mips.c:1077 config/tc-mips.c:1119 config/tc-or32.c:230 #: config/tc-sparc.c:853 msgid "Broken assembler. No assembly attempted." msgstr "" @@ -1025,7 +1026,7 @@ msgstr "" #: config/tc-d30v.c:552 config/tc-h8300.c:333 config/tc-h8500.c:284 #: config/tc-mcore.c:655 config/tc-mmix.c:475 config/tc-mn10200.c:940 #: config/tc-mn10300.c:1318 config/tc-or32.c:336 config/tc-or32.c:392 -#: config/tc-ppc.c:2122 config/tc-s390.c:1062 config/tc-sh.c:1272 +#: config/tc-ppc.c:2143 config/tc-s390.c:1062 config/tc-sh.c:1272 #: config/tc-sh64.c:2228 config/tc-tic80.c:283 config/tc-v850.c:1984 #: config/tc-w65.c:241 config/tc-z8k.c:343 msgid "missing operand" @@ -1054,7 +1055,7 @@ msgid "Immediate value of %ld is too lar msgstr "" #: config/tc-a29k.c:543 config/tc-i860.c:340 config/tc-i860.c:832 -#: config/tc-m68k.c:3181 config/tc-m68k.c:3210 config/tc-sparc.c:2550 +#: config/tc-m68k.c:3185 config/tc-m68k.c:3214 config/tc-sparc.c:2550 msgid "failed sanity check." msgstr "" @@ -1090,402 +1091,403 @@ msgstr "" msgid "Invalid register in & expression" msgstr "" -#: config/tc-alpha.c:816 +#: config/tc-alpha.c:822 #, c-format msgid "internal error: can't hash opcode `%s': %s" msgstr "" -#: config/tc-alpha.c:851 +#: config/tc-alpha.c:857 #, c-format msgid "internal error: can't hash macro `%s': %s" msgstr "" -#: config/tc-alpha.c:933 config/tc-i960.c:2702 +#: config/tc-alpha.c:939 config/tc-i960.c:2702 msgid "syntax error" msgstr "" -#: config/tc-alpha.c:1007 config/tc-h8300.c:1426 config/tc-h8500.c:1187 +#: config/tc-alpha.c:1013 config/tc-h8300.c:1426 config/tc-h8500.c:1187 #: config/tc-hppa.c:4019 config/tc-i860.c:931 config/tc-m68hc11.c:500 -#: config/tc-m68k.c:4201 config/tc-m88k.c:1011 config/tc-ns32k.c:1663 +#: config/tc-m68k.c:4205 config/tc-m88k.c:1011 config/tc-ns32k.c:1663 #: config/tc-or32.c:912 config/tc-sparc.c:2837 config/tc-z8k.c:1328 msgid "Bad call to MD_ATOF()" msgstr "" -#: config/tc-alpha.c:1057 +#: config/tc-alpha.c:1063 #, c-format msgid "Unknown CPU identifier `%s'" msgstr "" -#: config/tc-alpha.c:1101 +#: config/tc-alpha.c:1107 msgid "" "Alpha options:\n" "-32addr\t\t\ttreat addresses as 32-bit values\n" "-F\t\t\tlack floating point instructions support\n" -"-mev4 | -mev45 | -mev5 | -mev56 | -mpca56 | -mev6 | -mall\n" +"-mev4 | -mev45 | -mev5 | -mev56 | -mpca56 | -mev6 | -mev67 | -mev68 | -mall\n" "\t\t\tspecify variant of Alpha architecture\n" -"-m21064 | -m21066 | -m21164 | -m21164a | -m21164pc | -m21264\n" +"-m21064 | -m21066 | -m21164 | -m21164a | -m21164pc | -m21264 | -m21264a | -" +"m21264b\n" "\t\t\tthese variants include PALcode opcodes\n" msgstr "" -#: config/tc-alpha.c:1111 +#: config/tc-alpha.c:1117 msgid "" "VMS options:\n" "-+\t\t\thash encode (don't truncate) names longer than 64 characters\n" "-H\t\t\tshow new symbol after hash truncation\n" msgstr "" -#: config/tc-alpha.c:1284 +#: config/tc-alpha.c:1290 #, c-format msgid "unhandled relocation type %s" msgstr "" -#: config/tc-alpha.c:1297 +#: config/tc-alpha.c:1303 msgid "non-absolute expression in constant field" msgstr "" -#: config/tc-alpha.c:1311 +#: config/tc-alpha.c:1317 #, c-format msgid "type %d reloc done?\n" msgstr "" -#: config/tc-alpha.c:1359 config/tc-alpha.c:1366 config/tc-mips.c:8069 +#: config/tc-alpha.c:1365 config/tc-alpha.c:1372 config/tc-mips.c:8156 msgid "Used $at without \".set noat\"" msgstr "" -#: config/tc-alpha.c:1439 +#: config/tc-alpha.c:1445 #, c-format msgid "!samegp reloc against symbol without .prologue: %s" msgstr "" -#: config/tc-alpha.c:1588 +#: config/tc-alpha.c:1594 #, c-format msgid "cannot represent `%s' relocation in object file" msgstr "" -#: config/tc-alpha.c:1595 +#: config/tc-alpha.c:1601 #, c-format msgid "internal error? cannot generate `%s' relocation" msgstr "" -#: config/tc-alpha.c:1651 +#: config/tc-alpha.c:1657 #, c-format msgid "frame reg expected, using $%d." msgstr "" -#: config/tc-alpha.c:1752 +#: config/tc-alpha.c:1758 #, c-format msgid "No !literal!%ld was found" msgstr "" -#: config/tc-alpha.c:1758 +#: config/tc-alpha.c:1764 #, c-format msgid "No !tlsgd!%ld was found" msgstr "" -#: config/tc-alpha.c:1765 +#: config/tc-alpha.c:1771 #, c-format msgid "No !tlsldm!%ld was found" msgstr "" -#: config/tc-alpha.c:1773 +#: config/tc-alpha.c:1779 #, c-format msgid "No ldah !gpdisp!%ld was found" msgstr "" -#: config/tc-alpha.c:1823 +#: config/tc-alpha.c:1829 #, c-format msgid "too many !literal!%ld for %s" msgstr "" -#: config/tc-alpha.c:1853 +#: config/tc-alpha.c:1859 #, c-format msgid "No lda !gpdisp!%ld was found" msgstr "" #. only support one relocation op per insn -#: config/tc-alpha.c:1997 +#: config/tc-alpha.c:2003 msgid "More than one relocation op per insn" msgstr "" -#: config/tc-alpha.c:2013 +#: config/tc-alpha.c:2019 msgid "No relocation operand" msgstr "" -#: config/tc-alpha.c:2023 +#: config/tc-alpha.c:2029 #, c-format msgid "Unknown relocation operand: !%s" msgstr "" -#: config/tc-alpha.c:2033 +#: config/tc-alpha.c:2039 #, c-format msgid "no sequence number after !%s" msgstr "" -#: config/tc-alpha.c:2043 +#: config/tc-alpha.c:2049 #, c-format msgid "!%s does not use a sequence number" msgstr "" -#: config/tc-alpha.c:2053 +#: config/tc-alpha.c:2059 #, c-format msgid "Bad sequence number: !%s!%s" msgstr "" -#: config/tc-alpha.c:2381 +#: config/tc-alpha.c:2387 #, c-format msgid "operand out of range (%s not between %d and %d)" msgstr "" -#: config/tc-alpha.c:2495 config/tc-alpha.c:2519 config/tc-d10v.c:634 +#: config/tc-alpha.c:2501 config/tc-alpha.c:2525 config/tc-d10v.c:634 #: config/tc-d30v.c:640 config/tc-mn10200.c:995 config/tc-mn10300.c:1389 -#: config/tc-ppc.c:2088 config/tc-ppc.c:2269 config/tc-ppc.c:2281 +#: config/tc-ppc.c:2109 config/tc-ppc.c:2290 config/tc-ppc.c:2302 #: config/tc-s390.c:1072 config/tc-s390.c:1129 config/tc-v850.c:1764 #: config/tc-v850.c:1787 config/tc-v850.c:2007 msgid "too many fixups" msgstr "" -#: config/tc-alpha.c:2531 +#: config/tc-alpha.c:2537 msgid "invalid relocation for instruction" msgstr "" -#: config/tc-alpha.c:2542 +#: config/tc-alpha.c:2548 msgid "invalid relocation for field" msgstr "" -#: config/tc-alpha.c:2649 +#: config/tc-alpha.c:2655 #, c-format msgid "too many ldah insns for !gpdisp!%ld" msgstr "" -#: config/tc-alpha.c:2651 config/tc-alpha.c:2663 +#: config/tc-alpha.c:2657 config/tc-alpha.c:2669 #, c-format msgid "both insns for !gpdisp!%ld must be in the same section" msgstr "" -#: config/tc-alpha.c:2661 +#: config/tc-alpha.c:2667 #, c-format msgid "too many lda insns for !gpdisp!%ld" msgstr "" -#: config/tc-alpha.c:2713 +#: config/tc-alpha.c:2719 #, c-format msgid "too many lituse insns for !lituse_tlsgd!%ld" msgstr "" -#: config/tc-alpha.c:2716 +#: config/tc-alpha.c:2722 #, c-format msgid "too many lituse insns for !lituse_tlsldm!%ld" msgstr "" -#: config/tc-alpha.c:2733 +#: config/tc-alpha.c:2739 #, c-format msgid "duplicate !tlsgd!%ld" msgstr "" -#: config/tc-alpha.c:2735 +#: config/tc-alpha.c:2741 #, c-format msgid "sequence number in use for !tlsldm!%ld" msgstr "" -#: config/tc-alpha.c:2749 +#: config/tc-alpha.c:2755 #, c-format msgid "duplicate !tlsldm!%ld" msgstr "" -#: config/tc-alpha.c:2751 +#: config/tc-alpha.c:2757 #, c-format msgid "sequence number in use for !tlsgd!%ld" msgstr "" -#: config/tc-alpha.c:2796 config/tc-alpha.c:2869 +#: config/tc-alpha.c:2802 config/tc-alpha.c:2875 #, c-format msgid "inappropriate arguments for opcode `%s'" msgstr "" -#: config/tc-alpha.c:2798 config/tc-alpha.c:2871 +#: config/tc-alpha.c:2804 config/tc-alpha.c:2877 #, c-format msgid "opcode `%s' not supported for target %s" msgstr "" -#: config/tc-alpha.c:2802 config/tc-alpha.c:2875 config/tc-avr.c:1103 +#: config/tc-alpha.c:2808 config/tc-alpha.c:2881 config/tc-avr.c:1103 #, c-format msgid "unknown opcode `%s'" msgstr "" -#: config/tc-alpha.c:2922 +#: config/tc-alpha.c:2928 msgid "can not resolve expression" msgstr "" -#: config/tc-alpha.c:3066 config/tc-alpha.c:3245 +#: config/tc-alpha.c:3072 config/tc-alpha.c:3251 msgid "overflow in literal (.lita) table" msgstr "" -#: config/tc-alpha.c:3073 config/tc-alpha.c:3096 config/tc-alpha.c:3258 -#: config/tc-alpha.c:3473 config/tc-alpha.c:3518 config/tc-alpha.c:3592 -#: config/tc-alpha.c:3684 config/tc-alpha.c:3933 config/tc-alpha.c:4034 +#: config/tc-alpha.c:3079 config/tc-alpha.c:3102 config/tc-alpha.c:3264 +#: config/tc-alpha.c:3479 config/tc-alpha.c:3524 config/tc-alpha.c:3598 +#: config/tc-alpha.c:3690 config/tc-alpha.c:3939 config/tc-alpha.c:4040 msgid "macro requires $at register while noat in effect" msgstr "" -#: config/tc-alpha.c:3075 config/tc-alpha.c:3098 config/tc-alpha.c:3260 +#: config/tc-alpha.c:3081 config/tc-alpha.c:3104 config/tc-alpha.c:3266 msgid "macro requires $at while $at in use" msgstr "" -#: config/tc-alpha.c:3206 +#: config/tc-alpha.c:3212 msgid "bignum invalid; zero assumed" msgstr "" -#: config/tc-alpha.c:3208 +#: config/tc-alpha.c:3214 msgid "floating point number invalid; zero assumed" msgstr "" -#: config/tc-alpha.c:3213 +#: config/tc-alpha.c:3219 msgid "can't handle expression" msgstr "" -#: config/tc-alpha.c:3251 +#: config/tc-alpha.c:3257 msgid "overflow in literal (.lit8) table" msgstr "" -#: config/tc-alpha.c:4271 config/tc-ppc.c:1569 config/tc-ppc.c:3985 +#: config/tc-alpha.c:4277 config/tc-ppc.c:1582 config/tc-ppc.c:4006 #, c-format msgid ".COMMon length (%ld.) <0! Ignored." msgstr "" -#: config/tc-alpha.c:4300 config/tc-sparc.c:3707 config/tc-v850.c:254 +#: config/tc-alpha.c:4306 config/tc-sparc.c:3707 config/tc-v850.c:254 msgid "Ignoring attempt to re-define symbol" msgstr "" -#: config/tc-alpha.c:4309 config/tc-alpha.c:4318 config/tc-ppc.c:4022 +#: config/tc-alpha.c:4315 config/tc-alpha.c:4324 config/tc-ppc.c:4043 #, c-format msgid "Length of .comm \"%s\" is already %ld. Not changed to %ld." msgstr "" -#: config/tc-alpha.c:4420 ecoff.c:3082 +#: config/tc-alpha.c:4426 ecoff.c:3082 msgid ".ent directive has no name" msgstr "" -#: config/tc-alpha.c:4428 +#: config/tc-alpha.c:4434 msgid "nested .ent directives" msgstr "" -#: config/tc-alpha.c:4464 ecoff.c:3032 +#: config/tc-alpha.c:4470 ecoff.c:3032 msgid ".end directive has no name" msgstr "" -#: config/tc-alpha.c:4473 +#: config/tc-alpha.c:4479 msgid ".end directive names different symbol than .ent" msgstr "" -#: config/tc-alpha.c:4550 +#: config/tc-alpha.c:4556 #, c-format msgid "Invalid argument %d to .prologue." msgstr "" -#: config/tc-alpha.c:4642 +#: config/tc-alpha.c:4648 msgid "ECOFF debugging is disabled." msgstr "" -#: config/tc-alpha.c:4663 +#: config/tc-alpha.c:4669 msgid "Unknown section directive" msgstr "" -#: config/tc-alpha.c:4699 +#: config/tc-alpha.c:4705 msgid ".ent directive has no symbol" msgstr "" -#: config/tc-alpha.c:4726 +#: config/tc-alpha.c:4732 msgid "Bad .frame directive 1./2. param" msgstr "" -#: config/tc-alpha.c:4738 +#: config/tc-alpha.c:4744 msgid "Bad .frame directive 3./4. param" msgstr "" -#: config/tc-alpha.c:4763 +#: config/tc-alpha.c:4769 msgid ".pdesc directive not in link (.link) section" msgstr "" -#: config/tc-alpha.c:4771 +#: config/tc-alpha.c:4777 msgid ".pdesc has no matching .ent" msgstr "" -#: config/tc-alpha.c:4782 +#: config/tc-alpha.c:4788 msgid ".pdesc directive has no entry symbol" msgstr "" -#: config/tc-alpha.c:4795 +#: config/tc-alpha.c:4801 msgid "No comma after .pdesc " msgstr "" -#: config/tc-alpha.c:4818 +#: config/tc-alpha.c:4824 msgid "unknown procedure kind" msgstr "" -#: config/tc-alpha.c:4911 +#: config/tc-alpha.c:4917 msgid ".name directive not in link (.link) section" msgstr "" -#: config/tc-alpha.c:4919 +#: config/tc-alpha.c:4925 msgid ".name directive has no symbol" msgstr "" -#: config/tc-alpha.c:4953 +#: config/tc-alpha.c:4959 msgid "No symbol after .linkage" msgstr "" -#: config/tc-alpha.c:4981 +#: config/tc-alpha.c:4987 msgid "No symbol after .code_address" msgstr "" -#: config/tc-alpha.c:5014 +#: config/tc-alpha.c:5020 msgid "Bad .mask directive" msgstr "" -#: config/tc-alpha.c:5035 +#: config/tc-alpha.c:5041 msgid "Bad .fmask directive" msgstr "" -#: config/tc-alpha.c:5205 +#: config/tc-alpha.c:5211 #, c-format msgid "Expected comma after name \"%s\"" msgstr "" #. *symbol_get_obj (symbolP) = (signed char) temp; -#: config/tc-alpha.c:5216 +#: config/tc-alpha.c:5222 #, c-format msgid "unhandled: .proc %s,%d" msgstr "" -#: config/tc-alpha.c:5251 +#: config/tc-alpha.c:5257 #, c-format msgid "Tried to .set unrecognized mode `%s'" msgstr "" #. not fatal, but it might not work in the end -#: config/tc-alpha.c:5268 +#: config/tc-alpha.c:5274 msgid "File overrides no-base-register option." msgstr "" -#: config/tc-alpha.c:5285 +#: config/tc-alpha.c:5291 #, c-format msgid "Bad base register, using $%d." msgstr "" -#: config/tc-alpha.c:5307 +#: config/tc-alpha.c:5313 #, c-format msgid "Alignment too large: %d. assumed" msgstr "" -#: config/tc-alpha.c:5311 config/tc-d30v.c:2214 +#: config/tc-alpha.c:5317 config/tc-d30v.c:2214 msgid "Alignment negative: 0 assumed" msgstr "" -#: config/tc-alpha.c:5623 +#: config/tc-alpha.c:5629 #, c-format msgid "Chose GP value of %lx\n" msgstr "" -#: config/tc-alpha.c:5639 config/tc-ia64.c:958 +#: config/tc-alpha.c:5645 config/tc-ia64.c:958 msgid "Bad .section directive: want a,s,w,x,M,S,G,T in string" msgstr "" @@ -1864,8 +1866,8 @@ msgstr "" #: config/tc-arm.c:5702 config/tc-arm.c:8765 config/tc-arm.c:8865 #: config/tc-avr.c:866 config/tc-cris.c:3006 config/tc-d10v.c:1724 -#: config/tc-d30v.c:1863 config/tc-mips.c:3509 config/tc-mips.c:4523 -#: config/tc-mips.c:5436 config/tc-mips.c:6090 config/tc-ppc.c:5154 +#: config/tc-d30v.c:1863 config/tc-mips.c:3570 config/tc-mips.c:4594 +#: config/tc-mips.c:5505 config/tc-mips.c:6159 config/tc-ppc.c:5175 #: config/tc-v850.c:2287 config/tc-xstormy16.c:479 msgid "expression too complex" msgstr "" @@ -1904,7 +1906,7 @@ msgstr "" #: config/tc-arm.c:6904 config/tc-arm.c:6943 config/tc-arm.c:6956 #: config/tc-arm.c:7017 config/tc-arm.c:7056 config/tc-arm.c:7069 -#: config/tc-mips.c:9255 config/tc-mips.c:9285 +#: config/tc-mips.c:9336 config/tc-mips.c:9366 msgid "invalid register list" msgstr "" @@ -2595,8 +2597,8 @@ msgid "redefinition of mcu type `%s' to msgstr "" #: config/tc-avr.c:390 config/tc-d10v.c:319 config/tc-d30v.c:366 -#: config/tc-mips.c:9781 config/tc-mmix.c:2250 config/tc-mn10200.c:361 -#: config/tc-pj.c:357 config/tc-ppc.c:4814 config/tc-sh.c:2536 +#: config/tc-mips.c:9862 config/tc-mmix.c:2250 config/tc-mn10200.c:361 +#: config/tc-pj.c:357 config/tc-ppc.c:4835 config/tc-sh.c:2536 #: config/tc-v850.c:1194 msgid "bad call to md_atof" msgstr "" @@ -2692,7 +2694,7 @@ msgstr "" #: config/tc-avr.c:1073 config/tc-d10v.c:1659 config/tc-d30v.c:1807 #: config/tc-mn10200.c:1240 config/tc-mn10300.c:1781 config/tc-or32.c:1622 -#: config/tc-ppc.c:5538 config/tc-v850.c:2207 +#: config/tc-ppc.c:5573 config/tc-v850.c:2207 #, c-format msgid "reloc %d not supported by object file format" msgstr "" @@ -2947,7 +2949,7 @@ msgid "" msgstr "" #: config/tc-d10v.c:543 config/tc-d30v.c:550 config/tc-mn10200.c:937 -#: config/tc-mn10300.c:1315 config/tc-ppc.c:2120 config/tc-s390.c:1060 +#: config/tc-mn10300.c:1315 config/tc-ppc.c:2141 config/tc-s390.c:1060 #: config/tc-tic80.c:279 config/tc-v850.c:1981 msgid "illegal operand" msgstr "" @@ -3048,7 +3050,7 @@ msgstr "" msgid "bad opcode or operands" msgstr "" -#: config/tc-d10v.c:1503 config/tc-m68k.c:4310 +#: config/tc-d10v.c:1503 config/tc-m68k.c:4314 msgid "value out of range" msgstr "" @@ -3468,7 +3470,7 @@ msgstr "" msgid "invalid operands" msgstr "" -#: config/tc-h8300.c:1300 config/tc-h8500.c:1094 config/tc-mips.c:8834 +#: config/tc-h8300.c:1300 config/tc-h8500.c:1094 config/tc-mips.c:8915 #: config/tc-sh.c:2371 config/tc-sh64.c:2811 config/tc-w65.c:733 #: config/tc-z8k.c:1206 msgid "unknown opcode" @@ -3967,169 +3969,169 @@ msgstr "" msgid "No memory for symbol name." msgstr "" -#: config/tc-i386.c:658 +#: config/tc-i386.c:660 #, c-format msgid "%s shortened to %s" msgstr "" -#: config/tc-i386.c:714 +#: config/tc-i386.c:716 msgid "same type of prefix used twice" msgstr "" -#: config/tc-i386.c:732 +#: config/tc-i386.c:734 msgid "64bit mode not supported on this CPU." msgstr "" -#: config/tc-i386.c:736 +#: config/tc-i386.c:738 msgid "32bit mode not supported on this CPU." msgstr "" -#: config/tc-i386.c:769 +#: config/tc-i386.c:771 msgid "bad argument to syntax directive." msgstr "" -#: config/tc-i386.c:813 +#: config/tc-i386.c:815 #, c-format msgid "no such architecture: `%s'" msgstr "" -#: config/tc-i386.c:818 +#: config/tc-i386.c:820 msgid "missing cpu architecture" msgstr "" -#: config/tc-i386.c:832 +#: config/tc-i386.c:834 #, c-format msgid "no such architecture modifier: `%s'" msgstr "" -#: config/tc-i386.c:849 config/tc-i386.c:4857 +#: config/tc-i386.c:851 config/tc-i386.c:4944 msgid "Unknown architecture" msgstr "" -#: config/tc-i386.c:884 config/tc-i386.c:907 config/tc-m68k.c:3826 +#: config/tc-i386.c:886 config/tc-i386.c:909 config/tc-m68k.c:3830 #, c-format msgid "Internal Error: Can't hash %s: %s" msgstr "" -#: config/tc-i386.c:1150 +#: config/tc-i386.c:1152 msgid "There are no unsigned pc-relative relocations" msgstr "" -#: config/tc-i386.c:1157 config/tc-i386.c:5062 +#: config/tc-i386.c:1159 config/tc-i386.c:5151 #, c-format msgid "can not do %d byte pc-relative relocation" msgstr "" -#: config/tc-i386.c:1174 +#: config/tc-i386.c:1176 #, c-format msgid "can not do %s %d byte relocation" msgstr "" #. UnixWare fsub no args is alias for fsubp, fadd -> faddp, etc. -#: config/tc-i386.c:1386 +#: config/tc-i386.c:1396 #, c-format msgid "translating to `%sp'" msgstr "" -#: config/tc-i386.c:1431 +#: config/tc-i386.c:1441 #, c-format msgid "can't encode register '%%%s' in an instruction requiring REX prefix.\n" msgstr "" -#: config/tc-i386.c:1470 config/tc-i386.c:1565 +#: config/tc-i386.c:1480 config/tc-i386.c:1575 #, c-format msgid "no such instruction: `%s'" msgstr "" -#: config/tc-i386.c:1480 config/tc-i386.c:1597 +#: config/tc-i386.c:1490 config/tc-i386.c:1607 #, c-format msgid "invalid character %s in mnemonic" msgstr "" -#: config/tc-i386.c:1487 +#: config/tc-i386.c:1497 msgid "expecting prefix; got nothing" msgstr "" -#: config/tc-i386.c:1489 +#: config/tc-i386.c:1499 msgid "expecting mnemonic; got nothing" msgstr "" -#: config/tc-i386.c:1508 +#: config/tc-i386.c:1518 #, c-format msgid "redundant %s prefix" msgstr "" -#: config/tc-i386.c:1606 +#: config/tc-i386.c:1616 #, c-format msgid "`%s' is not supported on `%s'" msgstr "" -#: config/tc-i386.c:1611 +#: config/tc-i386.c:1621 msgid "use .code16 to ensure correct addressing mode" msgstr "" -#: config/tc-i386.c:1618 +#: config/tc-i386.c:1628 #, c-format msgid "expecting string instruction after `%s'" msgstr "" -#: config/tc-i386.c:1646 +#: config/tc-i386.c:1656 #, c-format msgid "invalid character %s before operand %d" msgstr "" -#: config/tc-i386.c:1660 +#: config/tc-i386.c:1670 #, c-format msgid "unbalanced parenthesis in operand %d." msgstr "" -#: config/tc-i386.c:1663 +#: config/tc-i386.c:1673 #, c-format msgid "unbalanced brackets in operand %d." msgstr "" -#: config/tc-i386.c:1672 +#: config/tc-i386.c:1682 #, c-format msgid "invalid character %s in operand %d" msgstr "" -#: config/tc-i386.c:1699 +#: config/tc-i386.c:1709 #, c-format msgid "spurious operands; (%d operands/instruction max)" msgstr "" -#: config/tc-i386.c:1722 +#: config/tc-i386.c:1732 msgid "expecting operand after ','; got nothing" msgstr "" -#: config/tc-i386.c:1727 +#: config/tc-i386.c:1737 msgid "expecting operand before ','; got nothing" msgstr "" #. We found no match. -#: config/tc-i386.c:2069 +#: config/tc-i386.c:2079 #, c-format msgid "suffix or operands invalid for `%s'" msgstr "" -#: config/tc-i386.c:2080 +#: config/tc-i386.c:2090 #, c-format msgid "indirect %s without `*'" msgstr "" #. Warn them that a data or address size prefix doesn't #. affect assembly of the next line of code. -#: config/tc-i386.c:2088 +#: config/tc-i386.c:2098 #, c-format msgid "stand-alone `%s' prefix" msgstr "" -#: config/tc-i386.c:2117 config/tc-i386.c:2132 +#: config/tc-i386.c:2127 config/tc-i386.c:2142 #, c-format msgid "`%s' operand %d must use `%%es' segment" msgstr "" -#: config/tc-i386.c:2212 +#: config/tc-i386.c:2222 msgid "" "no instruction mnemonic suffix given and no register operands; can't size " "instruction" @@ -4137,187 +4139,192 @@ msgstr "" #. Prohibit these changes in the 64bit mode, since the #. lowering is more complicated. -#: config/tc-i386.c:2296 config/tc-i386.c:2355 config/tc-i386.c:2372 -#: config/tc-i386.c:2404 config/tc-i386.c:2437 +#: config/tc-i386.c:2306 config/tc-i386.c:2365 config/tc-i386.c:2382 +#: config/tc-i386.c:2414 config/tc-i386.c:2447 #, c-format msgid "Incorrect register `%%%s' used with `%c' suffix" msgstr "" -#: config/tc-i386.c:2304 config/tc-i386.c:2362 config/tc-i386.c:2444 +#: config/tc-i386.c:2314 config/tc-i386.c:2372 config/tc-i386.c:2454 #, c-format msgid "using `%%%s' instead of `%%%s' due to `%c' suffix" msgstr "" -#: config/tc-i386.c:2319 config/tc-i386.c:2340 config/tc-i386.c:2391 -#: config/tc-i386.c:2422 +#: config/tc-i386.c:2329 config/tc-i386.c:2350 config/tc-i386.c:2401 +#: config/tc-i386.c:2432 #, c-format msgid "`%%%s' not allowed with `%s%c'" msgstr "" -#: config/tc-i386.c:2485 +#: config/tc-i386.c:2495 msgid "no instruction mnemonic suffix given; can't determine immediate size" msgstr "" -#: config/tc-i386.c:2518 +#: config/tc-i386.c:2528 #, c-format msgid "" "no instruction mnemonic suffix given; can't determine immediate size %x %c" msgstr "" #. Reversed arguments on faddp, fsubp, etc. -#: config/tc-i386.c:2567 +#: config/tc-i386.c:2577 #, c-format msgid "translating to `%s %%%s,%%%s'" msgstr "" #. Extraneous `l' suffix on fp insn. -#: config/tc-i386.c:2574 +#: config/tc-i386.c:2584 #, c-format msgid "translating to `%s %%%s'" msgstr "" -#: config/tc-i386.c:2593 +#: config/tc-i386.c:2602 #, c-format msgid "you can't `pop %%cs'" msgstr "" -#: config/tc-i386.c:2919 config/tc-i386.c:3012 config/tc-i386.c:3051 +#. lea +#: config/tc-i386.c:2621 +msgid "segment override on `lea' is ineffectual" +msgstr "" + +#: config/tc-i386.c:2930 config/tc-i386.c:3024 config/tc-i386.c:3069 msgid "skipping prefixes on this instruction" msgstr "" -#: config/tc-i386.c:3071 +#: config/tc-i386.c:3089 msgid "16-bit jump out of range" msgstr "" -#: config/tc-i386.c:3080 +#: config/tc-i386.c:3098 #, c-format msgid "can't handle non absolute segment in `%s'" msgstr "" -#: config/tc-i386.c:3418 +#: config/tc-i386.c:3539 #, c-format msgid "@%s reloc is not supported in %s bit mode" msgstr "" -#: config/tc-i386.c:3494 +#: config/tc-i386.c:3615 msgid "only 1 or 2 immediate operands are allowed" msgstr "" -#: config/tc-i386.c:3517 config/tc-i386.c:3708 +#: config/tc-i386.c:3638 config/tc-i386.c:3830 #, c-format msgid "junk `%s' after expression" msgstr "" #. Missing or bad expr becomes absolute 0. -#: config/tc-i386.c:3528 +#: config/tc-i386.c:3649 #, c-format msgid "missing or invalid immediate expression `%s' taken as 0" msgstr "" -#: config/tc-i386.c:3559 config/tc-i386.c:3769 +#: config/tc-i386.c:3681 config/tc-i386.c:3896 #, c-format msgid "unimplemented segment %s in operand" msgstr "" -#: config/tc-i386.c:3561 config/tc-i386.c:3771 +#: config/tc-i386.c:3683 config/tc-i386.c:3898 #, c-format msgid "unimplemented segment type %d in operand" msgstr "" -#: config/tc-i386.c:3605 config/tc-i386.c:5836 +#: config/tc-i386.c:3727 config/tc-i386.c:5925 #, c-format msgid "expecting scale factor of 1, 2, 4, or 8: got `%s'" msgstr "" -#: config/tc-i386.c:3612 +#: config/tc-i386.c:3734 #, c-format msgid "scale factor of %d without an index register" msgstr "" -#: config/tc-i386.c:3728 +#: config/tc-i386.c:3850 #, c-format msgid "bad expression used with @%s" msgstr "" #. Missing or bad expr becomes absolute 0. -#: config/tc-i386.c:3750 +#: config/tc-i386.c:3872 #, c-format msgid "missing or invalid displacement expression `%s' taken as 0" msgstr "" -#: config/tc-i386.c:3869 +#: config/tc-i386.c:3996 #, c-format msgid "`%s' is not a valid base/index expression" msgstr "" -#: config/tc-i386.c:3873 +#: config/tc-i386.c:4000 #, c-format msgid "`%s' is not a valid %s bit base/index expression" msgstr "" -#: config/tc-i386.c:3948 +#: config/tc-i386.c:4075 #, c-format msgid "bad memory operand `%s'" msgstr "" -#: config/tc-i386.c:3963 +#: config/tc-i386.c:4090 #, c-format msgid "junk `%s' after register" msgstr "" -#: config/tc-i386.c:3972 config/tc-i386.c:4087 config/tc-i386.c:4125 +#: config/tc-i386.c:4099 config/tc-i386.c:4214 config/tc-i386.c:4252 #, c-format msgid "bad register name `%s'" msgstr "" -#: config/tc-i386.c:3980 +#: config/tc-i386.c:4107 msgid "immediate operand illegal with absolute jump" msgstr "" -#: config/tc-i386.c:4002 +#: config/tc-i386.c:4129 #, c-format msgid "too many memory references for `%s'" msgstr "" -#: config/tc-i386.c:4080 +#: config/tc-i386.c:4207 #, c-format msgid "expecting `,' or `)' after index register in `%s'" msgstr "" -#: config/tc-i386.c:4104 +#: config/tc-i386.c:4231 #, c-format msgid "expecting `)' after scale factor in `%s'" msgstr "" -#: config/tc-i386.c:4111 +#: config/tc-i386.c:4238 #, c-format msgid "expecting index register or scale factor after `,'; got '%c'" msgstr "" -#: config/tc-i386.c:4118 +#: config/tc-i386.c:4245 #, c-format msgid "expecting `,' or `)' after base register in `%s'" msgstr "" #. It's not a memory operand; argh! -#: config/tc-i386.c:4159 +#: config/tc-i386.c:4286 #, c-format msgid "invalid char %s beginning operand %d `%s'" msgstr "" -#: config/tc-i386.c:4338 +#: config/tc-i386.c:4469 msgid "long jump required" msgstr "" -#: config/tc-i386.c:4646 +#: config/tc-i386.c:4733 msgid "Bad call to md_atof ()" msgstr "" -#: config/tc-i386.c:4810 +#: config/tc-i386.c:4897 msgid "No compiled in support for x86_64" msgstr "" -#: config/tc-i386.c:4831 +#: config/tc-i386.c:4918 msgid "" " -Q ignored\n" " -V print assembler version number\n" @@ -4326,63 +4333,63 @@ msgid "" " -s ignored\n" msgstr "" -#: config/tc-i386.c:4838 +#: config/tc-i386.c:4925 msgid " -q quieten some warnings\n" msgstr "" -#: config/tc-i386.c:4939 config/tc-s390.c:1601 +#: config/tc-i386.c:5026 config/tc-s390.c:1601 msgid "GOT already in symbol table" msgstr "" -#: config/tc-i386.c:5077 +#: config/tc-i386.c:5166 #, c-format msgid "can not do %d byte relocation" msgstr "" -#: config/tc-i386.c:5142 config/tc-s390.c:1969 +#: config/tc-i386.c:5231 config/tc-s390.c:1969 #, c-format msgid "cannot represent relocation type %s" msgstr "" -#: config/tc-i386.c:5438 +#: config/tc-i386.c:5527 #, c-format msgid "too many memory references for '%s'" msgstr "" -#: config/tc-i386.c:5601 +#: config/tc-i386.c:5690 #, c-format msgid "Unknown operand modifier `%s'\n" msgstr "" -#: config/tc-i386.c:5808 +#: config/tc-i386.c:5897 #, c-format msgid "`%s' is not a valid segment register" msgstr "" -#: config/tc-i386.c:5818 config/tc-i386.c:5939 +#: config/tc-i386.c:5907 config/tc-i386.c:6028 msgid "Register scaling only allowed in memory operands." msgstr "" -#: config/tc-i386.c:5849 +#: config/tc-i386.c:5938 msgid "Too many register references in memory operand.\n" msgstr "" -#: config/tc-i386.c:5918 +#: config/tc-i386.c:6007 #, c-format msgid "Syntax error. Expecting a constant. Got `%s'.\n" msgstr "" -#: config/tc-i386.c:5988 +#: config/tc-i386.c:6077 #, c-format msgid "Unrecognized token '%s'" msgstr "" -#: config/tc-i386.c:6005 +#: config/tc-i386.c:6094 #, c-format msgid "Unexpected token `%s'\n" msgstr "" -#: config/tc-i386.c:6149 +#: config/tc-i386.c:6238 #, c-format msgid "Unrecognized token `%s'\n" msgstr "" @@ -4391,7 +4398,7 @@ msgstr "" msgid "Unknown temporary pseudo register" msgstr "" -#: config/tc-i860.c:181 config/tc-mips.c:1060 +#: config/tc-i860.c:181 config/tc-mips.c:1074 #, c-format msgid "internal error: can't hash `%s': %s\n" msgstr "" @@ -4649,7 +4656,7 @@ msgstr "" msgid "option --link-relax is only supported in b.out format" msgstr "" -#: config/tc-i960.c:3218 write.c:2689 +#: config/tc-i960.c:3218 write.c:2664 msgid "callj to difference of two symbols" msgstr "" @@ -4760,7 +4767,7 @@ msgstr "" msgid "--gstabs is not supported for ia64" msgstr "" -#: config/tc-ia64.c:6743 config/tc-mips.c:1049 +#: config/tc-ia64.c:6743 config/tc-mips.c:1063 msgid "Could not set architecture and machine" msgstr "" @@ -4921,7 +4928,7 @@ msgid "" "is this intentional ?" msgstr "" -#: config/tc-m32r.c:1252 config/tc-ppc.c:1561 config/tc-ppc.c:3977 +#: config/tc-m32r.c:1252 config/tc-ppc.c:1574 config/tc-ppc.c:3998 msgid "Expected comma after symbol-name: rest of line ignored." msgstr "" @@ -4930,16 +4937,16 @@ msgstr "" msgid ".SCOMMon length (%ld.) <0! Ignored." msgstr "" -#: config/tc-m32r.c:1276 config/tc-ppc.c:1583 config/tc-ppc.c:2626 -#: config/tc-ppc.c:4001 +#: config/tc-m32r.c:1276 config/tc-ppc.c:1596 config/tc-ppc.c:2647 +#: config/tc-ppc.c:4022 msgid "ignoring bad alignment" msgstr "" -#: config/tc-m32r.c:1288 config/tc-ppc.c:1620 config/tc-v850.c:333 +#: config/tc-m32r.c:1288 config/tc-ppc.c:1633 config/tc-v850.c:333 msgid "Common alignment not a power of 2" msgstr "" -#: config/tc-m32r.c:1303 config/tc-ppc.c:1594 config/tc-ppc.c:4013 +#: config/tc-m32r.c:1303 config/tc-ppc.c:1607 config/tc-ppc.c:4034 #, c-format msgid "Ignoring attempt to re-define symbol `%s'." msgstr "" @@ -5290,326 +5297,326 @@ msgstr "" msgid "Can not do %d byte pic relocation" msgstr "" -#: config/tc-m68k.c:904 +#: config/tc-m68k.c:908 #, c-format msgid "Unable to produce reloc against symbol '%s'" msgstr "" -#: config/tc-m68k.c:948 config/tc-mips.c:12955 config/tc-vax.c:3442 +#: config/tc-m68k.c:952 config/tc-mips.c:13040 config/tc-vax.c:3442 #, c-format msgid "Cannot make %s relocation PC relative" msgstr "" -#: config/tc-m68k.c:1041 config/tc-tahoe.c:1495 config/tc-vax.c:1890 +#: config/tc-m68k.c:1045 config/tc-tahoe.c:1495 config/tc-vax.c:1890 msgid "No operator" msgstr "" -#: config/tc-m68k.c:1071 config/tc-tahoe.c:1512 config/tc-vax.c:1907 +#: config/tc-m68k.c:1075 config/tc-tahoe.c:1512 config/tc-vax.c:1907 msgid "Unknown operator" msgstr "" -#: config/tc-m68k.c:1846 +#: config/tc-m68k.c:1850 msgid "invalid instruction for this architecture; needs " msgstr "" -#: config/tc-m68k.c:1851 +#: config/tc-m68k.c:1855 msgid "fpu (68040, 68060 or 68881/68882)" msgstr "" -#: config/tc-m68k.c:1854 +#: config/tc-m68k.c:1858 msgid "mmu (68030 or 68851)" msgstr "" -#: config/tc-m68k.c:1857 +#: config/tc-m68k.c:1861 msgid "68020 or higher" msgstr "" -#: config/tc-m68k.c:1860 +#: config/tc-m68k.c:1864 msgid "68000 or higher" msgstr "" -#: config/tc-m68k.c:1863 +#: config/tc-m68k.c:1867 msgid "68010 or higher" msgstr "" -#: config/tc-m68k.c:1892 +#: config/tc-m68k.c:1896 msgid "operands mismatch" msgstr "" -#: config/tc-m68k.c:1949 config/tc-m68k.c:1955 config/tc-m68k.c:1961 +#: config/tc-m68k.c:1953 config/tc-m68k.c:1959 config/tc-m68k.c:1965 #: config/tc-mmix.c:2465 config/tc-mmix.c:2489 msgid "operand out of range" msgstr "" -#: config/tc-m68k.c:2018 +#: config/tc-m68k.c:2022 #, c-format msgid "Bignum too big for %c format; truncated" msgstr "" -#: config/tc-m68k.c:2086 +#: config/tc-m68k.c:2090 msgid "displacement too large for this architecture; needs 68020 or higher" msgstr "" -#: config/tc-m68k.c:2196 +#: config/tc-m68k.c:2200 msgid "" "scale factor invalid on this architecture; needs cpu32 or 68020 or higher" msgstr "" -#: config/tc-m68k.c:2201 +#: config/tc-m68k.c:2205 msgid "invalid index size for coldfire" msgstr "" -#: config/tc-m68k.c:2254 +#: config/tc-m68k.c:2258 msgid "Forcing byte displacement" msgstr "" -#: config/tc-m68k.c:2256 +#: config/tc-m68k.c:2260 msgid "byte displacement out of range" msgstr "" -#: config/tc-m68k.c:2303 config/tc-m68k.c:2341 +#: config/tc-m68k.c:2307 config/tc-m68k.c:2345 msgid "invalid operand mode for this architecture; needs 68020 or higher" msgstr "" -#: config/tc-m68k.c:2327 config/tc-m68k.c:2361 +#: config/tc-m68k.c:2331 config/tc-m68k.c:2365 msgid ":b not permitted; defaulting to :w" msgstr "" -#: config/tc-m68k.c:2438 +#: config/tc-m68k.c:2442 msgid "unsupported byte value; use a different suffix" msgstr "" -#: config/tc-m68k.c:2452 +#: config/tc-m68k.c:2456 msgid "unknown/incorrect operand" msgstr "" -#: config/tc-m68k.c:2485 config/tc-m68k.c:2493 config/tc-m68k.c:2500 -#: config/tc-m68k.c:2507 +#: config/tc-m68k.c:2489 config/tc-m68k.c:2497 config/tc-m68k.c:2504 +#: config/tc-m68k.c:2511 msgid "out of range" msgstr "" -#: config/tc-m68k.c:2553 +#: config/tc-m68k.c:2557 msgid "Can't use long branches on 68000/68010/5200" msgstr "" -#: config/tc-m68k.c:2663 +#: config/tc-m68k.c:2667 msgid "Expression out of range, using 0" msgstr "" -#: config/tc-m68k.c:2775 config/tc-m68k.c:2791 +#: config/tc-m68k.c:2779 config/tc-m68k.c:2795 msgid "Floating point register in register list" msgstr "" -#: config/tc-m68k.c:2781 +#: config/tc-m68k.c:2785 msgid "Wrong register in floating-point reglist" msgstr "" -#: config/tc-m68k.c:2797 +#: config/tc-m68k.c:2801 msgid "incorrect register in reglist" msgstr "" -#: config/tc-m68k.c:2803 +#: config/tc-m68k.c:2807 msgid "wrong register in floating-point reglist" msgstr "" #. ERROR -#: config/tc-m68k.c:3244 +#: config/tc-m68k.c:3248 msgid "Extra )" msgstr "" #. ERROR -#: config/tc-m68k.c:3255 +#: config/tc-m68k.c:3259 msgid "Missing )" msgstr "" -#: config/tc-m68k.c:3272 +#: config/tc-m68k.c:3276 msgid "Missing operand" msgstr "" -#: config/tc-m68k.c:3604 +#: config/tc-m68k.c:3608 #, c-format msgid "%s -- statement `%s' ignored" msgstr "" -#: config/tc-m68k.c:3653 +#: config/tc-m68k.c:3657 #, c-format msgid "Don't know how to figure width of %c in md_assemble()" msgstr "" -#: config/tc-m68k.c:3835 config/tc-m68k.c:3873 +#: config/tc-m68k.c:3839 config/tc-m68k.c:3877 #, c-format msgid "Internal Error: Can't find %s in hash table" msgstr "" -#: config/tc-m68k.c:3838 config/tc-m68k.c:3876 +#: config/tc-m68k.c:3842 config/tc-m68k.c:3880 #, c-format msgid "Internal Error: Can't hash %s: %s" msgstr "" -#: config/tc-m68k.c:4002 +#: config/tc-m68k.c:4006 #, c-format msgid "unrecognized default cpu `%s' ???" msgstr "" -#: config/tc-m68k.c:4014 +#: config/tc-m68k.c:4018 msgid "68040 and 68851 specified; mmu instructions may assemble incorrectly" msgstr "" -#: config/tc-m68k.c:4034 +#: config/tc-m68k.c:4038 msgid "options for 68881 and no-68881 both given" msgstr "" -#: config/tc-m68k.c:4036 +#: config/tc-m68k.c:4040 msgid "options for 68851 and no-68851 both given" msgstr "" -#: config/tc-m68k.c:4107 +#: config/tc-m68k.c:4111 #, c-format msgid "text label `%s' aligned to odd boundary" msgstr "" -#: config/tc-m68k.c:4326 +#: config/tc-m68k.c:4330 msgid "invalid byte branch offset" msgstr "" -#: config/tc-m68k.c:4363 +#: config/tc-m68k.c:4367 msgid "short branch with zero offset: use :w" msgstr "" -#: config/tc-m68k.c:4832 config/tc-m68k.c:4843 +#: config/tc-m68k.c:4836 config/tc-m68k.c:4847 msgid "expression out of range: defaulting to 1" msgstr "" -#: config/tc-m68k.c:4875 +#: config/tc-m68k.c:4879 msgid "expression out of range: defaulting to 0" msgstr "" -#: config/tc-m68k.c:4908 config/tc-m68k.c:4920 +#: config/tc-m68k.c:4912 config/tc-m68k.c:4924 #, c-format msgid "Can't deal with expression; defaulting to %ld" msgstr "" -#: config/tc-m68k.c:4934 +#: config/tc-m68k.c:4938 msgid "expression doesn't fit in BYTE" msgstr "" -#: config/tc-m68k.c:4938 +#: config/tc-m68k.c:4942 msgid "expression doesn't fit in WORD" msgstr "" -#: config/tc-m68k.c:5031 +#: config/tc-m68k.c:5035 #, c-format msgid "%s: unrecognized processor name" msgstr "" -#: config/tc-m68k.c:5096 +#: config/tc-m68k.c:5100 msgid "bad coprocessor id" msgstr "" -#: config/tc-m68k.c:5102 +#: config/tc-m68k.c:5106 msgid "unrecognized fopt option" msgstr "" -#: config/tc-m68k.c:5236 +#: config/tc-m68k.c:5240 #, c-format msgid "option `%s' may not be negated" msgstr "" -#: config/tc-m68k.c:5247 +#: config/tc-m68k.c:5251 #, c-format msgid "option `%s' not recognized" msgstr "" -#: config/tc-m68k.c:5280 +#: config/tc-m68k.c:5284 msgid "bad format of OPT NEST=depth" msgstr "" -#: config/tc-m68k.c:5343 +#: config/tc-m68k.c:5347 msgid "missing label" msgstr "" -#: config/tc-m68k.c:5367 config/tc-m68k.c:5396 +#: config/tc-m68k.c:5371 config/tc-m68k.c:5400 msgid "bad register list" msgstr "" -#: config/tc-m68k.c:5369 +#: config/tc-m68k.c:5373 #, c-format msgid "bad register list: %s" msgstr "" -#: config/tc-m68k.c:5467 +#: config/tc-m68k.c:5471 msgid "restore without save" msgstr "" -#: config/tc-m68k.c:5641 config/tc-m68k.c:6028 +#: config/tc-m68k.c:5645 config/tc-m68k.c:6032 msgid "syntax error in structured control directive" msgstr "" -#: config/tc-m68k.c:5690 +#: config/tc-m68k.c:5694 msgid "missing condition code in structured control directive" msgstr "" -#: config/tc-m68k.c:5762 +#: config/tc-m68k.c:5766 #, c-format msgid "" "Condition <%c%c> in structured control directive can not be encoded correctly" msgstr "" -#: config/tc-m68k.c:6071 +#: config/tc-m68k.c:6075 msgid "missing then" msgstr "" -#: config/tc-m68k.c:6153 +#: config/tc-m68k.c:6157 msgid "else without matching if" msgstr "" -#: config/tc-m68k.c:6187 +#: config/tc-m68k.c:6191 msgid "endi without matching if" msgstr "" -#: config/tc-m68k.c:6228 +#: config/tc-m68k.c:6232 msgid "break outside of structured loop" msgstr "" -#: config/tc-m68k.c:6267 +#: config/tc-m68k.c:6271 msgid "next outside of structured loop" msgstr "" -#: config/tc-m68k.c:6319 +#: config/tc-m68k.c:6323 msgid "missing =" msgstr "" -#: config/tc-m68k.c:6357 +#: config/tc-m68k.c:6361 msgid "missing to or downto" msgstr "" -#: config/tc-m68k.c:6393 config/tc-m68k.c:6427 config/tc-m68k.c:6646 +#: config/tc-m68k.c:6397 config/tc-m68k.c:6431 config/tc-m68k.c:6650 msgid "missing do" msgstr "" -#: config/tc-m68k.c:6530 +#: config/tc-m68k.c:6534 msgid "endf without for" msgstr "" -#: config/tc-m68k.c:6586 +#: config/tc-m68k.c:6590 msgid "until without repeat" msgstr "" -#: config/tc-m68k.c:6682 +#: config/tc-m68k.c:6686 msgid "endw without while" msgstr "" -#: config/tc-m68k.c:6806 +#: config/tc-m68k.c:6810 #, c-format msgid "unrecognized option `%s'" msgstr "" -#: config/tc-m68k.c:6851 +#: config/tc-m68k.c:6855 #, c-format msgid "unrecognized architecture specification `%s'" msgstr "" -#: config/tc-m68k.c:6944 +#: config/tc-m68k.c:6948 #, c-format msgid "" "680X0 options:\n" @@ -5623,7 +5630,7 @@ msgid "" "\t\t\t[default yes for 68020, 68030, and cpu32]\n" msgstr "" -#: config/tc-m68k.c:6955 +#: config/tc-m68k.c:6959 msgid "" "-m68851 | -mno-68851\n" "\t\t\ttarget has/lacks memory-management unit coprocessor\n" @@ -5636,7 +5643,7 @@ msgid "" "--bitwise-or\t\tdo not treat `|' as a comment character\n" msgstr "" -#: config/tc-m68k.c:6965 +#: config/tc-m68k.c:6969 msgid "" "--base-size-default-16\tbase reg without size is 16 bits\n" "--base-size-default-32\tbase reg without size is 32 bits (default)\n" @@ -5644,12 +5651,12 @@ msgid "" "--disp-size-default-32\tdisplacement with unknown size is 32 bits (default)\n" msgstr "" -#: config/tc-m68k.c:7000 +#: config/tc-m68k.c:7004 #, c-format msgid "Error %s in %s\n" msgstr "" -#: config/tc-m68k.c:7004 +#: config/tc-m68k.c:7008 #, c-format msgid "Opcode(%d.%s): " msgstr "" @@ -5923,426 +5930,426 @@ msgstr "" msgid "pc-relative" msgstr "" -#: config/tc-mips.c:690 +#: config/tc-mips.c:701 #, c-format msgid "internal Error, line %d, %s" msgstr "" -#: config/tc-mips.c:692 +#: config/tc-mips.c:703 msgid "MIPS internal Error" msgstr "" -#: config/tc-mips.c:1086 +#: config/tc-mips.c:1100 #, c-format msgid "internal: can't hash `%s': %s" msgstr "" -#: config/tc-mips.c:1094 +#: config/tc-mips.c:1108 #, c-format msgid "internal error: bad mips16 opcode: %s %s\n" msgstr "" -#: config/tc-mips.c:1275 +#: config/tc-mips.c:1289 #, c-format msgid "returned from mips_ip(%s) insn_opcode = 0x%x\n" msgstr "" -#: config/tc-mips.c:1830 config/tc-mips.c:13100 +#: config/tc-mips.c:1844 config/tc-mips.c:13185 msgid "extended instruction in delay slot" msgstr "" -#: config/tc-mips.c:1874 config/tc-mips.c:1885 +#: config/tc-mips.c:1888 config/tc-mips.c:1899 #, c-format msgid "jump to misaligned address (0x%lx)" msgstr "" -#: config/tc-mips.c:1878 config/tc-mips.c:1889 +#: config/tc-mips.c:1892 config/tc-mips.c:1903 #, c-format msgid "jump address range overflow (0x%lx)" msgstr "" -#: config/tc-mips.c:2693 config/tc-mips.c:3088 +#: config/tc-mips.c:2707 config/tc-mips.c:3108 msgid "Macro instruction expanded into multiple instructions" msgstr "" -#: config/tc-mips.c:2705 +#: config/tc-mips.c:2719 msgid "" "Macro instruction expanded into multiple instructions in a branch delay slot" msgstr "" -#: config/tc-mips.c:3141 +#: config/tc-mips.c:3143 config/tc-mips.c:7198 config/tc-mips.c:7227 +#: config/tc-mips.c:7297 config/tc-mips.c:7323 +msgid "operand overflow" +msgstr "" + +#: config/tc-mips.c:3170 config/tc-mips.c:6562 config/tc-mips.c:7404 +msgid "Macro used $at after \".set noat\"" +msgstr "" + +#: config/tc-mips.c:3207 msgid "unsupported large constant" msgstr "" -#: config/tc-mips.c:3143 +#: config/tc-mips.c:3209 #, c-format msgid "Instruction %s requires absolute expression" msgstr "" -#: config/tc-mips.c:3292 +#: config/tc-mips.c:3353 #, c-format msgid "Number (0x%lx) larger than 32 bits" msgstr "" -#: config/tc-mips.c:3314 +#: config/tc-mips.c:3375 msgid "Number larger than 64 bits" msgstr "" -#: config/tc-mips.c:3631 config/tc-mips.c:3709 config/tc-mips.c:5637 -#: config/tc-mips.c:5688 config/tc-mips.c:6236 config/tc-mips.c:6295 +#: config/tc-mips.c:3692 config/tc-mips.c:3770 config/tc-mips.c:5706 +#: config/tc-mips.c:5757 config/tc-mips.c:6305 config/tc-mips.c:6364 msgid "PIC code offset overflow (max 16 signed bits)" msgstr "" -#: config/tc-mips.c:3957 +#: config/tc-mips.c:4018 #, c-format msgid "Branch %s is always false (nop)" msgstr "" -#: config/tc-mips.c:3965 +#: config/tc-mips.c:4026 #, c-format msgid "Branch likely %s is always false" msgstr "" -#: config/tc-mips.c:3973 config/tc-mips.c:4042 config/tc-mips.c:4137 -#: config/tc-mips.c:4187 config/tc-mips.c:7426 config/tc-mips.c:7434 -#: config/tc-mips.c:7442 config/tc-mips.c:7551 +#: config/tc-mips.c:4034 config/tc-mips.c:4103 config/tc-mips.c:4198 +#: config/tc-mips.c:4248 config/tc-mips.c:7513 config/tc-mips.c:7521 +#: config/tc-mips.c:7529 config/tc-mips.c:7638 msgid "Unsupported large constant" msgstr "" #. result is always true -#: config/tc-mips.c:4007 +#: config/tc-mips.c:4068 #, c-format msgid "Branch %s is always true" msgstr "" -#: config/tc-mips.c:4259 config/tc-mips.c:4371 +#: config/tc-mips.c:4320 config/tc-mips.c:4432 msgid "Divide by zero." msgstr "" -#: config/tc-mips.c:4460 +#: config/tc-mips.c:4521 msgid "dla used to load 32-bit register" msgstr "" -#: config/tc-mips.c:4463 +#: config/tc-mips.c:4524 msgid "la used to load 64-bit address" msgstr "" -#: config/tc-mips.c:5044 +#: config/tc-mips.c:5115 msgid "MIPS PIC call to register other than $25" msgstr "" -#: config/tc-mips.c:5051 config/tc-mips.c:5062 config/tc-mips.c:5181 -#: config/tc-mips.c:5192 +#: config/tc-mips.c:5122 config/tc-mips.c:5133 config/tc-mips.c:5251 +#: config/tc-mips.c:5262 msgid "No .cprestore pseudo-op used in PIC code" msgstr "" -#: config/tc-mips.c:5056 config/tc-mips.c:5186 +#: config/tc-mips.c:5127 config/tc-mips.c:5256 msgid "No .frame pseudo-op used in PIC code" msgstr "" -#: config/tc-mips.c:5265 config/tc-mips.c:5354 config/tc-mips.c:5985 -#: config/tc-mips.c:6026 config/tc-mips.c:6044 config/tc-mips.c:6759 +#: config/tc-mips.c:5334 config/tc-mips.c:5423 config/tc-mips.c:6054 +#: config/tc-mips.c:6095 config/tc-mips.c:6113 config/tc-mips.c:6846 msgid "opcode not supported on this processor" msgstr "" -#: config/tc-mips.c:6493 config/tc-mips.c:7317 -msgid "Macro used $at after \".set noat\"" -msgstr "" - -#: config/tc-mips.c:6660 config/tc-mips.c:6681 config/tc-mips.c:6722 -#: config/tc-mips.c:6743 +#: config/tc-mips.c:6728 config/tc-mips.c:6755 config/tc-mips.c:6799 +#: config/tc-mips.c:6826 msgid "rotate count too large" msgstr "" -#: config/tc-mips.c:6799 +#: config/tc-mips.c:6886 #, c-format msgid "Instruction %s: result is always false" msgstr "" -#: config/tc-mips.c:6972 +#: config/tc-mips.c:7059 #, c-format msgid "Instruction %s: result is always true" msgstr "" -#: config/tc-mips.c:7111 config/tc-mips.c:7140 config/tc-mips.c:7210 -#: config/tc-mips.c:7236 -msgid "operand overflow" -msgstr "" - #. FIXME: Check if this is one of the itbl macros, since they #. are added dynamically. -#: config/tc-mips.c:7313 +#: config/tc-mips.c:7400 #, c-format msgid "Macro %s not implemented yet" msgstr "" -#: config/tc-mips.c:7584 +#: config/tc-mips.c:7671 #, c-format msgid "internal: bad mips opcode (mask error): %s %s" msgstr "" -#: config/tc-mips.c:7646 +#: config/tc-mips.c:7733 #, c-format msgid "internal: bad mips opcode (unknown operand type `%c'): %s %s" msgstr "" -#: config/tc-mips.c:7653 +#: config/tc-mips.c:7740 #, c-format msgid "internal: bad mips opcode (bits 0x%lx undefined): %s %s" msgstr "" -#: config/tc-mips.c:7767 +#: config/tc-mips.c:7854 #, c-format msgid "opcode not supported on this processor: %s (%s)" msgstr "" -#: config/tc-mips.c:7847 +#: config/tc-mips.c:7934 #, c-format msgid "Improper shift amount (%lu)" msgstr "" -#: config/tc-mips.c:7873 config/tc-mips.c:9187 config/tc-mips.c:9302 +#: config/tc-mips.c:7960 config/tc-mips.c:9268 config/tc-mips.c:9383 #, c-format msgid "Invalid value for `%s' (%lu)" msgstr "" -#: config/tc-mips.c:7891 +#: config/tc-mips.c:7978 #, c-format msgid "Illegal break code (%lu)" msgstr "" -#: config/tc-mips.c:7905 +#: config/tc-mips.c:7992 #, c-format msgid "Illegal lower break code (%lu)" msgstr "" -#: config/tc-mips.c:7918 +#: config/tc-mips.c:8005 #, c-format msgid "Illegal 20-bit code (%lu)" msgstr "" -#: config/tc-mips.c:7930 +#: config/tc-mips.c:8017 #, c-format msgid "Coproccesor code > 25 bits (%lu)" msgstr "" -#: config/tc-mips.c:7943 +#: config/tc-mips.c:8030 #, c-format msgid "Illegal 19-bit code (%lu)" msgstr "" -#: config/tc-mips.c:7955 +#: config/tc-mips.c:8042 #, c-format msgid "Invalid performance register (%lu)" msgstr "" -#: config/tc-mips.c:7992 +#: config/tc-mips.c:8079 #, c-format msgid "Invalid register number (%d)" msgstr "" -#: config/tc-mips.c:8168 +#: config/tc-mips.c:8255 #, c-format msgid "Invalid MDMX Immediate (%ld)" msgstr "" -#: config/tc-mips.c:8211 +#: config/tc-mips.c:8298 #, c-format msgid "Invalid float register number (%d)" msgstr "" -#: config/tc-mips.c:8221 +#: config/tc-mips.c:8308 #, c-format msgid "Float register should be even, was %d" msgstr "" -#: config/tc-mips.c:8260 +#: config/tc-mips.c:8347 #, c-format msgid "Bad element selector %ld" msgstr "" -#: config/tc-mips.c:8267 +#: config/tc-mips.c:8354 #, c-format msgid "Expecting ']' found '%s'" msgstr "" -#: config/tc-mips.c:8309 +#: config/tc-mips.c:8396 msgid "absolute expression required" msgstr "" -#: config/tc-mips.c:8377 +#: config/tc-mips.c:8464 #, c-format msgid "Bad floating point constant: %s" msgstr "" -#: config/tc-mips.c:8505 +#: config/tc-mips.c:8592 msgid "Can't use floating point insn in this section" msgstr "" -#: config/tc-mips.c:8546 config/tc-mips.c:8551 config/tc-mips.c:8682 -#: config/tc-mips.c:8687 +#: config/tc-mips.c:8635 config/tc-mips.c:8640 config/tc-mips.c:8763 +#: config/tc-mips.c:8768 msgid "bad composition of relocations" msgstr "" -#: config/tc-mips.c:8584 +#: config/tc-mips.c:8668 msgid "16 bit expression not in range 0..65535" msgstr "" -#: config/tc-mips.c:8621 +#: config/tc-mips.c:8705 msgid "16 bit expression not in range -32768..32767" msgstr "" -#: config/tc-mips.c:8706 +#: config/tc-mips.c:8787 msgid "lui expression not in range 0..65535" msgstr "" -#: config/tc-mips.c:8730 +#: config/tc-mips.c:8811 #, c-format msgid "invalid condition code register $fcc%d" msgstr "" -#: config/tc-mips.c:8755 +#: config/tc-mips.c:8836 msgid "invalid coprocessor sub-selection value (0-7)" msgstr "" -#: config/tc-mips.c:8760 +#: config/tc-mips.c:8841 #, c-format msgid "bad char = '%c'\n" msgstr "" -#: config/tc-mips.c:8771 config/tc-mips.c:8776 config/tc-mips.c:9327 +#: config/tc-mips.c:8852 config/tc-mips.c:8857 config/tc-mips.c:9408 msgid "illegal operands" msgstr "" -#: config/tc-mips.c:8843 +#: config/tc-mips.c:8924 msgid "unrecognized opcode" msgstr "" -#: config/tc-mips.c:8955 +#: config/tc-mips.c:9036 #, c-format msgid "invalid register number (%d)" msgstr "" -#: config/tc-mips.c:9046 +#: config/tc-mips.c:9127 msgid "used $at without \".set noat\"" msgstr "" -#: config/tc-mips.c:9221 +#: config/tc-mips.c:9302 msgid "can't parse register list" msgstr "" -#: config/tc-mips.c:9453 +#: config/tc-mips.c:9534 msgid "extended operand requested but not required" msgstr "" -#: config/tc-mips.c:9455 +#: config/tc-mips.c:9536 msgid "invalid unextended operand value" msgstr "" -#: config/tc-mips.c:9483 +#: config/tc-mips.c:9564 msgid "operand value out of range for instruction" msgstr "" -#: config/tc-mips.c:9715 +#: config/tc-mips.c:9796 msgid "internal error" msgstr "" -#: config/tc-mips.c:10048 +#: config/tc-mips.c:10129 #, c-format msgid "invalid architecture -mtune=%s" msgstr "" -#: config/tc-mips.c:10051 +#: config/tc-mips.c:10132 #, c-format msgid "invalid architecture -march=%s" msgstr "" -#: config/tc-mips.c:10054 +#: config/tc-mips.c:10135 #, c-format msgid "invalid architecture -mcpu=%s" msgstr "" -#: config/tc-mips.c:10066 +#: config/tc-mips.c:10147 #, c-format msgid "A different -mtune= was already specified, is now -mtune=%s" msgstr "" -#: config/tc-mips.c:10072 +#: config/tc-mips.c:10153 #, c-format msgid "A different -march= was already specified, is now -march=%s" msgstr "" -#: config/tc-mips.c:10078 +#: config/tc-mips.c:10159 #, c-format msgid "A different -mcpu= was already specified, is now -mcpu=%s" msgstr "" -#: config/tc-mips.c:10088 +#: config/tc-mips.c:10169 msgid "A different -march= or -mtune= was already specified, is now -m4650" msgstr "" -#: config/tc-mips.c:10100 +#: config/tc-mips.c:10181 msgid "A different -march= or -mtune= was already specified, is now -m4010" msgstr "" -#: config/tc-mips.c:10112 +#: config/tc-mips.c:10193 msgid "A different -march= or -mtune= was already specified, is now -m4100" msgstr "" -#: config/tc-mips.c:10124 +#: config/tc-mips.c:10205 msgid "A different -march= or -mtune= was already specified, is now -m3900" msgstr "" -#: config/tc-mips.c:10163 +#: config/tc-mips.c:10244 msgid "-G may not be used with embedded PIC code" msgstr "" -#: config/tc-mips.c:10176 +#: config/tc-mips.c:10257 msgid "-call_shared is supported only for ELF format" msgstr "" -#: config/tc-mips.c:10182 config/tc-mips.c:11627 config/tc-mips.c:11837 +#: config/tc-mips.c:10263 config/tc-mips.c:11708 config/tc-mips.c:11918 msgid "-G may not be used with SVR4 PIC code" msgstr "" -#: config/tc-mips.c:10191 +#: config/tc-mips.c:10272 msgid "-non_shared is supported only for ELF format" msgstr "" -#: config/tc-mips.c:10208 +#: config/tc-mips.c:10289 msgid "-G is not supported for this configuration" msgstr "" -#: config/tc-mips.c:10213 +#: config/tc-mips.c:10294 msgid "-G may not be used with SVR4 or embedded PIC code" msgstr "" -#: config/tc-mips.c:10227 +#: config/tc-mips.c:10308 msgid "-32 is supported for ELF format only" msgstr "" -#: config/tc-mips.c:10236 +#: config/tc-mips.c:10317 msgid "-n32 is supported for ELF format only" msgstr "" -#: config/tc-mips.c:10245 +#: config/tc-mips.c:10326 msgid "-64 is supported for ELF format only" msgstr "" -#: config/tc-mips.c:10250 config/tc-mips.c:10289 +#: config/tc-mips.c:10331 config/tc-mips.c:10370 msgid "No compiled in support for 64 bit object file format" msgstr "" -#: config/tc-mips.c:10276 +#: config/tc-mips.c:10357 msgid "-mabi is supported for ELF format only" msgstr "" -#: config/tc-mips.c:10296 +#: config/tc-mips.c:10377 #, c-format msgid "invalid abi -mabi=%s" msgstr "" -#: config/tc-mips.c:10363 +#: config/tc-mips.c:10444 msgid "" "MIPS options:\n" "-membedded-pic\t\tgenerate embedded position independent code\n" @@ -6353,7 +6360,7 @@ msgid "" "\t\t\timplicitly with the gp register [default 8]\n" msgstr "" -#: config/tc-mips.c:10371 +#: config/tc-mips.c:10452 msgid "" "-mips1\t\t\tgenerate MIPS ISA I instructions\n" "-mips2\t\t\tgenerate MIPS ISA II instructions\n" @@ -6365,20 +6372,20 @@ msgid "" "-march=CPU/-mtune=CPU\tgenerate code/schedule for CPU, where CPU is one of:\n" msgstr "" -#: config/tc-mips.c:10407 +#: config/tc-mips.c:10488 msgid "" "-mCPU\t\t\tequivalent to -march=CPU -mtune=CPU. Deprecated.\n" "-no-mCPU\t\tdon't generate code specific to CPU.\n" "\t\t\tFor -mCPU and -no-mCPU, CPU must be one of:\n" msgstr "" -#: config/tc-mips.c:10420 +#: config/tc-mips.c:10501 msgid "" "-mips16\t\t\tgenerate mips16 instructions\n" "-no-mips16\t\tdo not generate mips16 instructions\n" msgstr "" -#: config/tc-mips.c:10423 +#: config/tc-mips.c:10504 msgid "" "-mgp32\t\t\tuse 32-bit GPRs, regardless of the chosen ISA\n" "-mfp32\t\t\tuse 32-bit FPRs, regardless of the chosen ISA\n" @@ -6390,7 +6397,7 @@ msgid "" "--break, --no-trap\tbreak exception on div by 0 and mult overflow\n" msgstr "" -#: config/tc-mips.c:10433 +#: config/tc-mips.c:10514 msgid "" "-KPIC, -call_shared\tgenerate SVR4 position independent code\n" "-non_shared\t\tdo not generate position independent code\n" @@ -6398,223 +6405,223 @@ msgid "" "-mabi=ABI\t\tcreate ABI conformant object file for:\n" msgstr "" -#: config/tc-mips.c:10449 +#: config/tc-mips.c:10530 msgid "" "-32\t\t\tcreate o32 ABI object file (default)\n" "-n32\t\t\tcreate n32 ABI object file\n" "-64\t\t\tcreate 64 ABI object file\n" msgstr "" -#: config/tc-mips.c:10469 +#: config/tc-mips.c:10550 msgid "-G not supported in this configuration." msgstr "" -#: config/tc-mips.c:10488 +#: config/tc-mips.c:10569 msgid "" "The -mcpu option can't be used together with -march. Use -mtune instead of -" "mcpu." msgstr "" -#: config/tc-mips.c:10496 +#: config/tc-mips.c:10577 msgid "" "The -mcpu option can't be used together with -mtune. Use -march instead of -" "mcpu." msgstr "" -#: config/tc-mips.c:10545 config/tc-mips.c:10570 +#: config/tc-mips.c:10626 config/tc-mips.c:10651 msgid "The -mcpu option is deprecated. Please use -march and -mtune instead." msgstr "" #. This really should be an error instead of a warning, but old #. compilers only have -mcpu which sets both arch and tune. For #. now, we discard arch and preserve tune. -#: config/tc-mips.c:10590 +#: config/tc-mips.c:10671 msgid "The -march option is incompatible to -mipsN and therefore ignored." msgstr "" -#: config/tc-mips.c:10642 +#: config/tc-mips.c:10723 msgid "trap exception not supported at ISA 1" msgstr "" -#: config/tc-mips.c:10810 +#: config/tc-mips.c:10891 #, c-format msgid "Unmatched %%hi reloc" msgstr "" -#: config/tc-mips.c:11030 +#: config/tc-mips.c:11111 msgid "Invalid PC relative reloc" msgstr "" -#: config/tc-mips.c:11138 config/tc-sparc.c:3113 config/tc-sparc.c:3120 +#: config/tc-mips.c:11219 config/tc-sparc.c:3113 config/tc-sparc.c:3120 #: config/tc-sparc.c:3127 config/tc-sparc.c:3134 config/tc-sparc.c:3141 #: config/tc-sparc.c:3150 config/tc-sparc.c:3161 config/tc-sparc.c:3183 -#: config/tc-sparc.c:3207 write.c:1041 write.c:1104 +#: config/tc-sparc.c:3207 write.c:1038 write.c:1101 msgid "relocation overflow" msgstr "" -#: config/tc-mips.c:11149 +#: config/tc-mips.c:11230 #, c-format msgid "Branch to odd address (%lx)" msgstr "" -#: config/tc-mips.c:11214 +#: config/tc-mips.c:11295 msgid "Branch out of range" msgstr "" -#: config/tc-mips.c:11322 +#: config/tc-mips.c:11403 #, c-format msgid "%08lx UNDEFINED\n" msgstr "" -#: config/tc-mips.c:11385 +#: config/tc-mips.c:11466 #, c-format msgid "Alignment too large: %d. assumed." msgstr "" -#: config/tc-mips.c:11388 +#: config/tc-mips.c:11469 msgid "Alignment negative: 0 assumed." msgstr "" -#: config/tc-mips.c:11476 +#: config/tc-mips.c:11557 msgid "No read only data section in this object file format" msgstr "" -#: config/tc-mips.c:11499 +#: config/tc-mips.c:11580 msgid "Global pointers not supported; recompile -G 0" msgstr "" -#: config/tc-mips.c:11585 +#: config/tc-mips.c:11666 #, c-format msgid "%s: no such section" msgstr "" -#: config/tc-mips.c:11622 +#: config/tc-mips.c:11703 #, c-format msgid ".option pic%d not supported" msgstr "" -#: config/tc-mips.c:11633 +#: config/tc-mips.c:11714 #, c-format msgid "Unrecognized option \"%s\"" msgstr "" -#: config/tc-mips.c:11696 +#: config/tc-mips.c:11777 msgid "`noreorder' must be set before `nomacro'" msgstr "" -#: config/tc-mips.c:11760 config/tc-mips.c:11774 +#: config/tc-mips.c:11841 config/tc-mips.c:11855 #, c-format msgid "unknown ISA level %s" msgstr "" -#: config/tc-mips.c:11796 +#: config/tc-mips.c:11877 msgid ".set pop with no .set push" msgstr "" -#: config/tc-mips.c:11820 +#: config/tc-mips.c:11901 #, c-format msgid "Tried to set unrecognized symbol: %s\n" msgstr "" -#: config/tc-mips.c:11871 +#: config/tc-mips.c:11952 msgid ".cpload not in noreorder section" msgstr "" -#: config/tc-mips.c:11928 config/tc-mips.c:11947 +#: config/tc-mips.c:12009 config/tc-mips.c:12028 msgid "missing argument separator ',' for .cpsetup" msgstr "" -#: config/tc-mips.c:12128 +#: config/tc-mips.c:12213 msgid "Unsupported use of .gpword" msgstr "" -#: config/tc-mips.c:12263 +#: config/tc-mips.c:12348 msgid "expected `$'" msgstr "" -#: config/tc-mips.c:12271 +#: config/tc-mips.c:12356 msgid "Bad register number" msgstr "" -#: config/tc-mips.c:12319 +#: config/tc-mips.c:12404 msgid "Unrecognized register name" msgstr "" -#: config/tc-mips.c:12505 +#: config/tc-mips.c:12590 msgid "unsupported PC relative reference to different section" msgstr "" -#: config/tc-mips.c:12618 +#: config/tc-mips.c:12703 msgid "unsupported relocation" msgstr "" -#: config/tc-mips.c:12714 +#: config/tc-mips.c:12799 msgid "AT used after \".set noat\" or macro used after \".set nomacro\"" msgstr "" -#: config/tc-mips.c:12784 +#: config/tc-mips.c:12869 msgid "Double check fx_r_type in tc-mips.c:tc_gen_reloc" msgstr "" -#: config/tc-mips.c:12987 config/tc-sh.c:3799 +#: config/tc-mips.c:13072 config/tc-sh.c:3799 #, c-format msgid "Can not represent %s relocation in this object file format" msgstr "" -#: config/tc-mips.c:13338 +#: config/tc-mips.c:13423 msgid "missing .end at end of assembly" msgstr "" -#: config/tc-mips.c:13353 +#: config/tc-mips.c:13438 msgid "expected simple number" msgstr "" -#: config/tc-mips.c:13379 +#: config/tc-mips.c:13464 #, c-format msgid " *input_line_pointer == '%c' 0x%02x\n" msgstr "" -#: config/tc-mips.c:13381 +#: config/tc-mips.c:13466 msgid "invalid number" msgstr "" -#: config/tc-mips.c:13470 +#: config/tc-mips.c:13555 msgid ".end not in text section" msgstr "" -#: config/tc-mips.c:13474 +#: config/tc-mips.c:13559 msgid ".end directive without a preceding .ent directive." msgstr "" -#: config/tc-mips.c:13483 +#: config/tc-mips.c:13568 msgid ".end symbol does not match .ent symbol." msgstr "" -#: config/tc-mips.c:13490 +#: config/tc-mips.c:13575 msgid ".end directive missing or unknown symbol" msgstr "" -#: config/tc-mips.c:13564 +#: config/tc-mips.c:13649 msgid ".ent or .aent not in text section." msgstr "" -#: config/tc-mips.c:13567 +#: config/tc-mips.c:13652 msgid "missing .end" msgstr "" -#: config/tc-mips.c:13609 ecoff.c:3200 +#: config/tc-mips.c:13694 ecoff.c:3200 msgid ".frame outside of .ent" msgstr "" -#: config/tc-mips.c:13620 +#: config/tc-mips.c:13705 msgid "Bad .frame directive" msgstr "" -#: config/tc-mips.c:13653 +#: config/tc-mips.c:13738 msgid ".mask/.fmask outside of .ent" msgstr "" -#: config/tc-mips.c:13660 +#: config/tc-mips.c:13745 msgid "Bad .mask/.fmask directive" msgstr "" @@ -6866,19 +6873,19 @@ msgid "" "none yet\n" msgstr "" -#: config/tc-mn10200.c:793 config/tc-mn10300.c:936 config/tc-ppc.c:1883 +#: config/tc-mn10200.c:793 config/tc-mn10300.c:936 config/tc-ppc.c:1896 #: config/tc-s390.c:1299 config/tc-v850.c:1636 #, c-format msgid "Unrecognized opcode: `%s'" msgstr "" -#: config/tc-mn10200.c:1036 config/tc-mn10300.c:1459 config/tc-ppc.c:2318 +#: config/tc-mn10200.c:1036 config/tc-mn10300.c:1459 config/tc-ppc.c:2339 #: config/tc-s390.c:1224 config/tc-v850.c:2060 #, c-format msgid "junk at end of line: `%s'" msgstr "" -#: config/tc-mn10200.c:1349 config/tc-mn10300.c:2083 config/tc-ppc.c:1290 +#: config/tc-mn10200.c:1349 config/tc-mn10300.c:2083 config/tc-ppc.c:1303 #: config/tc-v850.c:1565 #, c-format msgid "operand out of range (%s not between %ld and %ld)" @@ -7196,216 +7203,216 @@ msgid "" "-Qy, -Qn\t\tignored\n" msgstr "" -#: config/tc-ppc.c:1075 +#: config/tc-ppc.c:1080 #, c-format msgid "Unknown default cpu = %s, os = %s" msgstr "" -#: config/tc-ppc.c:1100 +#: config/tc-ppc.c:1105 msgid "Neither Power nor PowerPC opcodes were selected." msgstr "" -#: config/tc-ppc.c:1181 config/tc-s390.c:477 +#: config/tc-ppc.c:1194 config/tc-s390.c:477 #, c-format msgid "Internal assembler error for instruction %s" msgstr "" -#: config/tc-ppc.c:1201 +#: config/tc-ppc.c:1214 #, c-format msgid "Internal assembler error for macro %s" msgstr "" -#: config/tc-ppc.c:1428 +#: config/tc-ppc.c:1441 msgid "identifier+constant@got means identifier@got+constant" msgstr "" -#: config/tc-ppc.c:1495 +#: config/tc-ppc.c:1508 #, c-format msgid "%s relocations do not fit in %d bytes\n" msgstr "" -#: config/tc-ppc.c:1602 +#: config/tc-ppc.c:1615 #, c-format msgid "Length of .lcomm \"%s\" is already %ld. Not changed to %ld." msgstr "" -#: config/tc-ppc.c:1684 +#: config/tc-ppc.c:1697 msgid "Relocation cannot be done when using -mrelocatable" msgstr "" -#: config/tc-ppc.c:1810 +#: config/tc-ppc.c:1823 #, c-format msgid "syntax error: invalid toc specifier `%s'" msgstr "" -#: config/tc-ppc.c:1824 +#: config/tc-ppc.c:1837 #, c-format msgid "syntax error: expected `]', found `%c'" msgstr "" -#: config/tc-ppc.c:2060 +#: config/tc-ppc.c:2081 msgid "[tocv] symbol is not a toc symbol" msgstr "" -#: config/tc-ppc.c:2071 +#: config/tc-ppc.c:2092 msgid "Unimplemented toc32 expression modifier" msgstr "" -#: config/tc-ppc.c:2076 +#: config/tc-ppc.c:2097 msgid "Unimplemented toc64 expression modifier" msgstr "" -#: config/tc-ppc.c:2080 +#: config/tc-ppc.c:2101 #, c-format msgid "Unexpected return value [%d] from parse_toc_entry!\n" msgstr "" -#: config/tc-ppc.c:2262 +#: config/tc-ppc.c:2283 msgid "unsupported relocation for DS offset field" msgstr "" -#: config/tc-ppc.c:2306 +#: config/tc-ppc.c:2327 #, c-format msgid "syntax error; found `%c' but expected `%c'" msgstr "" -#: config/tc-ppc.c:2430 +#: config/tc-ppc.c:2451 msgid "wrong number of operands" msgstr "" -#: config/tc-ppc.c:2486 +#: config/tc-ppc.c:2507 msgid "Bad .section directive: want a,e,w,x,M,S,G,T in string" msgstr "" -#: config/tc-ppc.c:2601 +#: config/tc-ppc.c:2622 msgid "missing size" msgstr "" -#: config/tc-ppc.c:2610 +#: config/tc-ppc.c:2631 msgid "negative size" msgstr "" -#: config/tc-ppc.c:2647 +#: config/tc-ppc.c:2668 msgid "missing real symbol name" msgstr "" -#: config/tc-ppc.c:2668 +#: config/tc-ppc.c:2689 msgid "attempt to redefine symbol" msgstr "" -#: config/tc-ppc.c:2902 +#: config/tc-ppc.c:2923 msgid "The XCOFF file format does not support arbitrary sections" msgstr "" -#: config/tc-ppc.c:2979 +#: config/tc-ppc.c:3000 msgid "missing rename string" msgstr "" -#: config/tc-ppc.c:3010 config/tc-ppc.c:3565 read.c:3058 +#: config/tc-ppc.c:3031 config/tc-ppc.c:3586 read.c:3058 msgid "missing value" msgstr "" -#: config/tc-ppc.c:3028 +#: config/tc-ppc.c:3049 msgid "illegal .stabx expression; zero assumed" msgstr "" -#: config/tc-ppc.c:3060 +#: config/tc-ppc.c:3081 msgid "missing class" msgstr "" -#: config/tc-ppc.c:3069 +#: config/tc-ppc.c:3090 msgid "missing type" msgstr "" -#: config/tc-ppc.c:3150 +#: config/tc-ppc.c:3171 msgid "missing symbol name" msgstr "" -#: config/tc-ppc.c:3344 +#: config/tc-ppc.c:3365 msgid "nested .bs blocks" msgstr "" -#: config/tc-ppc.c:3377 +#: config/tc-ppc.c:3398 msgid ".es without preceding .bs" msgstr "" -#: config/tc-ppc.c:3557 +#: config/tc-ppc.c:3578 msgid "non-constant byte count" msgstr "" -#: config/tc-ppc.c:3605 +#: config/tc-ppc.c:3626 msgid ".tc not in .toc section" msgstr "" -#: config/tc-ppc.c:3624 +#: config/tc-ppc.c:3645 msgid ".tc with no label" msgstr "" -#: config/tc-ppc.c:3735 +#: config/tc-ppc.c:3756 msgid "No previous section to return to. Directive ignored." msgstr "" #. Section Contents #. unknown -#: config/tc-ppc.c:4152 +#: config/tc-ppc.c:4173 msgid "Unsupported section attribute -- 'a'" msgstr "" -#: config/tc-ppc.c:4341 +#: config/tc-ppc.c:4362 msgid "bad symbol suffix" msgstr "" -#: config/tc-ppc.c:4434 +#: config/tc-ppc.c:4455 msgid "Unrecognized symbol suffix" msgstr "" -#: config/tc-ppc.c:4516 +#: config/tc-ppc.c:4537 msgid "two .function pseudo-ops with no intervening .ef" msgstr "" -#: config/tc-ppc.c:4529 +#: config/tc-ppc.c:4550 msgid ".ef with no preceding .function" msgstr "" -#: config/tc-ppc.c:4657 +#: config/tc-ppc.c:4678 #, c-format msgid "warning: symbol %s has no csect" msgstr "" -#: config/tc-ppc.c:4957 +#: config/tc-ppc.c:4978 msgid "symbol in .toc does not match any .tc" msgstr "" -#: config/tc-ppc.c:5256 config/tc-s390.c:1809 config/tc-v850.c:2331 +#: config/tc-ppc.c:5291 config/tc-s390.c:1809 config/tc-v850.c:2331 #: config/tc-xstormy16.c:536 msgid "unresolved expression that must be resolved" msgstr "" -#: config/tc-ppc.c:5259 +#: config/tc-ppc.c:5294 #, c-format msgid "unsupported relocation against %s" msgstr "" -#: config/tc-ppc.c:5334 +#: config/tc-ppc.c:5369 #, c-format msgid "cannot emit PC relative %s relocation against %s" msgstr "" -#: config/tc-ppc.c:5339 +#: config/tc-ppc.c:5374 #, c-format msgid "cannot emit PC relative %s relocation" msgstr "" -#: config/tc-ppc.c:5460 +#: config/tc-ppc.c:5495 msgid "must branch to an address a multiple of 4" msgstr "" -#: config/tc-ppc.c:5464 +#: config/tc-ppc.c:5499 #, c-format msgid "@local or @plt branch destination is too far away, %ld bytes" msgstr "" -#: config/tc-ppc.c:5495 +#: config/tc-ppc.c:5530 #, c-format msgid "Gas failure, reloc value %d\n" msgstr "" @@ -8114,6 +8121,7 @@ msgid ": asr number must be between 0 an msgstr "" #: config/tc-sparc.c:1658 +#, c-format msgid ": expecting %asrN" msgstr "" @@ -9532,7 +9540,7 @@ msgstr "" msgid "unassigned file number %ld" msgstr "" -#: dwarf2dbg.c:1311 dwarf2dbg.c:1319 dwarf2dbg.c:1327 dwarf2dbg.c:1347 +#: dwarf2dbg.c:1329 dwarf2dbg.c:1337 dwarf2dbg.c:1345 dwarf2dbg.c:1365 msgid "dwarf2 is not supported for this object file format" msgstr "" @@ -10567,7 +10575,7 @@ msgstr "" msgid "zero assumed for missing expression" msgstr "" -#: read.c:3571 read.c:4470 write.c:293 +#: read.c:3571 read.c:4470 write.c:290 msgid "register value used as expression" msgstr "" @@ -10614,79 +10622,83 @@ msgstr "" msgid "floating point constant too large" msgstr "" -#: read.c:4612 +#: read.c:4571 +msgid "strings must be placed into a section" +msgstr "" + +#: read.c:4621 msgid "expected " msgstr "" #. To be compatible with BSD 4.2 as: give the luser a linefeed!! -#: read.c:4645 read.c:4731 +#: read.c:4654 read.c:4740 msgid "unterminated string; newline inserted" msgstr "" -#: read.c:4739 +#: read.c:4748 msgid "bad escaped character in string" msgstr "" -#: read.c:4765 +#: read.c:4774 msgid "expected address expression" msgstr "" -#: read.c:4785 +#: read.c:4794 #, c-format msgid "symbol \"%s\" undefined; zero assumed" msgstr "" -#: read.c:4788 +#: read.c:4797 msgid "some symbol undefined; zero assumed" msgstr "" -#: read.c:4806 +#: read.c:4815 msgid "bad or irreducible absolute expression" msgstr "" -#: read.c:4841 +#: read.c:4850 msgid "this string may not contain '\\0'" msgstr "" -#: read.c:4878 +#: read.c:4887 msgid "missing string" msgstr "" -#: read.c:5001 +#: read.c:5010 #, c-format msgid ".incbin count zero, ignoring `%s'" msgstr "" -#: read.c:5027 +#: read.c:5036 #, c-format msgid "file not found: %s" msgstr "" -#: read.c:5041 +#: read.c:5050 #, c-format msgid "seek to end of .incbin file failed `%s'" msgstr "" -#: read.c:5052 +#: read.c:5061 #, c-format msgid "skip (%ld) + count (%ld) larger than file size (%ld)" msgstr "" -#: read.c:5059 +#: read.c:5068 #, c-format msgid "could not skip to %ld in file `%s'" msgstr "" -#: read.c:5068 +#: read.c:5077 #, c-format msgid "truncated file `%s', %ld of %ld bytes read" msgstr "" -#: read.c:5231 +#: read.c:5240 msgid "missing .func" msgstr "" -#: read.c:5248 +#: read.c:5257 msgid ".endfunc missing for previous .func" msgstr "" @@ -10751,7 +10763,7 @@ msgstr "" msgid "division by zero when setting `%s'" msgstr "" -#: symbols.c:1225 write.c:2028 +#: symbols.c:1225 write.c:2003 #, c-format msgid "can't resolve value for symbol `%s'" msgstr "" @@ -10770,102 +10782,102 @@ msgstr "" msgid "section symbols are already global" msgstr "" -#: write.c:179 +#: write.c:176 #, c-format msgid "field fx_size too small to hold %d" msgstr "" -#: write.c:320 +#: write.c:317 msgid "rva not supported" msgstr "" -#: write.c:528 +#: write.c:525 #, c-format msgid "attempt to .org/.space backwards? (%ld)" msgstr "" -#: write.c:1044 +#: write.c:1041 msgid "relocation out of range" msgstr "" -#: write.c:1047 +#: write.c:1044 #, c-format msgid "%s:%u: bad return from bfd_install_relocation: %x" msgstr "" -#: write.c:1091 +#: write.c:1088 msgid "internal error: fixup not contained within frag" msgstr "" -#: write.c:1107 +#: write.c:1104 #, c-format msgid "%s:%u: bad return from bfd_install_relocation" msgstr "" -#: write.c:1194 write.c:1218 +#: write.c:1191 write.c:1215 #, c-format msgid "FATAL: Can't write %s" msgstr "" -#: write.c:1250 +#: write.c:1247 msgid "cannot write to output file" msgstr "" -#: write.c:1503 +#: write.c:1486 #, c-format msgid "%d error%s, %d warning%s, generating bad object file" msgstr "" -#: write.c:1510 +#: write.c:1493 #, c-format msgid "%d error%s, %d warning%s, no object file generated" msgstr "" -#: write.c:1966 +#: write.c:1941 #, c-format msgid "local label `%s' is not defined" msgstr "" -#: write.c:2264 +#: write.c:2239 #, c-format msgid "alignment padding (%lu bytes) not a multiple of %ld" msgstr "" -#: write.c:2381 +#: write.c:2356 #, c-format msgid ".word %s-%s+%s didn't fit" msgstr "" -#: write.c:2466 +#: write.c:2441 msgid "attempt to .org backwards" msgstr "" -#: write.c:2494 +#: write.c:2469 msgid ".space specifies non-absolute value" msgstr "" -#: write.c:2501 +#: write.c:2476 msgid ".space or .fill with negative value, ignored" msgstr "" -#: write.c:2675 +#: write.c:2650 #, c-format msgid "negative of non-absolute symbol `%s'" msgstr "" -#: write.c:2769 +#: write.c:2744 #, c-format msgid "" "subtraction of two symbols in different sections `%s' {%s section} - `%s' {%" "s section} at file address %s" msgstr "" -#: write.c:2905 +#: write.c:2880 #, c-format msgid "value of %s too large for field of %d bytes at %s" msgstr "" -#: write.c:2917 +#: write.c:2892 #, c-format msgid "signed .word overflow; switch may be too large; %ld at 0x%lx" msgstr "" diff -Nurpa binutils-2.13/gas/po/tr.gmo binutils-2.13.1/gas/po/tr.gmo --- binutils-2.13/gas/po/tr.gmo 2002-08-06 09:31:39.000000000 -0400 +++ binutils-2.13.1/gas/po/tr.gmo 2002-11-07 17:40:02.000000000 -0500 @@ -1,61 +1,63 @@ -Þ•nŒC? ü†ø³ù³ ´!´ ;µcI¶­·IÇ·<¸>N¸?¸6͸[¹Ö`¹N7º;†º3º@öº?7»5w»—­»E¼tÖ¼ÎK½v¾?‘¾:ѾK ¿7X¿7¿LÈ¿OÀBeÀ2¨À?ÛÀÁŸÁI=Â;‡ÂOÃÂFÃ=ZÃD˜ÃBÝÃ" ÄÏCÄ>Å>RÅ,‘ÅK¾Å> -ÆHIÆ;’Æ"ÎÆAñÆ@3Ç>tÇD³ÇjøÇ3cÈ@—ÈLØÈH%ÉEnÉ-´É"âÊ4Ì=:Ì]xÌ>ÖÌ?ÍEUÍG›Í|ãÍL`Î…­ÎB3Ï?vÏ"¶ÏNÙÏ0(Ð8YÐ6’Ð"ÉÐHìÐO5ÑÎ…ÑZTÒ-¯Ó$ÝÓ Ô% ×%2×%X×~×"Ž×'±×Ù×ø× Ø1Ø4HØ}ØؠظØÁØÉØ$ÑØöØ4Ù2=Ù(pÙ™Ù¶Ù#ÆÙ%êÙ&Ú7Ú8JÚ ƒÚ ‘Ú!²Ú%ÔÚúÚÛ3*Û^Û`rÛ`ÓÛ&4Ü [Ü|Ü-œÜ1ÊÜ8üÜD5ÝzÝ™Ý-¹ÝçÝûݼ ÞÉßÑßåß"ìà,á@<ám}á$ëá$âÝ5â*ã%>ã1dã)–ã'ÀãDèãÁ-å'ïåeæ-}æ«æ…¾æ—Dè&Üè.é22é4eéšé2·éÂê颭ëWPí¢¨í%Kï,qï-žïÌïåï"þï!!ð Cð"dð!‡ð©ð$¿ð"äðñ#ñ"Añ"dñ3‡ñ4»ñ"ðñ$ò28ò3kò.Ÿò Îò3ïò2#ó4Vó3‹ó¿óßó(úó/#ô#Sô1wô2©ô2Üôõ'(õPõ*mõ6˜õ#Ïõ9óõ-öHö"eöˆö™ö³ö-Éö÷ö÷'÷>÷!R÷!t÷6–÷*Í÷ø÷ -ø+ øLøbøø+øÉø$åø, -ù7ù7Sù1‹ù1½ù3ïù3#úWú*rú4ú4Òú,û(4û$]û#‚û-¦û)Ôûþû&ü>ü9Uü6ü3Æü3úü.ýLýgýý4‘ý4Æý:ûý&6þA]þŸþ3¾þ3òþ/&ÿVÿ1pÿ,¢ÿ'Ïÿ÷ÿ#%4Zw%‘%·/Ý -D=Ù‚)\'†'®%Ö&ü#5Nav ‹¬Ç&ä ",On+‰$µ-Ú4="[~„ •)ŸÉá<ú57*mC˜CÜC Cd;¨9ä; 0Z !‹ 3­ á õ  -' -$B -g -‡ -< -³Ú -Ž 1­ Oß i/ C™ Ý $ú Ddƒ¡À à!2# V%w¼"Öù!'0!X"z*.È#÷''C#k#0³'ä# 600g˜­É!ç' 1F [ |±2Ì2ÿ2H]{‘§A¾6#R5v ¬¸Ìß!þ ;0Wˆ¤Ä×>í',Tl+ƒ¯Ï è 9)U6˜%Ïõú 1Id-„)²=Ü!<1Z:Œ:Ç=@O-b3;ÄG#H%l&’&¹àò&/Eu&ˆ¯Æ à2-%`-†+´ à" $  @  a 2‚ 6µ ì %!#&!2J!:}!0¸!6é! "37"2k"ž"$­"!Ò"1ô"=&#6d# ›#5¼#2ò#-%$FS$Mš$2è$ %.<%.k%&š%$Á%Aæ%,(&<U&<’&+Ï&@û&W<'%”(,º(Tç(*<)!g)‰)©)Æ)5Ö)0 *%=*c*$|*"¡*Ä*á*"+#+9+"W+z+Š+§+®+1¶+è+5,3>,*r,","À,ã,ý, -7=-u-Œ-%¢-/È-ø-'.&:. a.‚.š.º.Ù.6ø.//*7/$b/"‡/ª/Á/×/í/0+0G02_0’0,¨0Õ0 ó0%1!'1%I1'o1?—19×132!E2#g2‹2,©2%Ö2(ü24%3<Z3—31±3ã374:4L4l42Š4½44Ù45$.5S5-p54ž5Ó56ê5$!6)F6%p6!–61¸6ê6Dù6>8/X8$ˆ8*­8*Ø89#9B9\9v9’9«9Ê9Û9ì9:/:3G:/{:=«:Oé:J9;>„;*Ã;-î;0<(M<0v<0§<'Ø<0='1=#Y=}=.™=1È=3ú=4.>/c>.“>+Â>+î>&?%A?+g?-“?#Á?Oå?q5@§@RÅ@(ABAAA„A5ÆA,üA.)BsXBkÌB48C"mC+C!¼C+ÞC2 -D%=D1cD•D&¦D'ÍD-õD7#E0[E$ŒE)±E'ÛE(F),F(VFFšF¹FÑFìFG G =G^G$vG"›G&¾G åGH%H&AH&hHH&¯HÖHòH I(#I#LI#pI#”I¸I!ÖI øIJ(8J!aJ/ƒJ=³JñJK(K$GK&lK(“K"¼KßK ùKL/9L/iL™L³L(ÆLïL M!M8M1PM ‚M£M2¼M7ïM'N;N=RNN"¯NÒN+ðN(O8EO ~O"ŸOÂOßOÿOP$)PNP*aP8ŒPÅPÞPûP%Q*AQ1lQ-žQÌQéQR2RHR_R7wR8¯R9èR9"S2\S'S'·SßSýS&T-CT2qTH¤T(íUV(*VSWnW%‰W0¯WàW5ýW 3X TXuX•X´XÓX(óXY.7Y9fY  YªY¾YÙY$ëYZ#Z2ZDZ+cZ/Z*¿ZêZ7 -[B[_[o[€[2 [<Ó[\&\6>\u\$\¿µ\u_;Ž_(Ê_-ó_F!`5h`ž`"±`0Ô`aa$1aVa(oa$˜a!½a4ßa4b!Ib!kbbªbÈb ãb4ïb4$cYc)oc™c¨cÆcßcúcdd"3dVd,qdždB¸d&ûd "e2Ce:ve'±e%Ùe'ÿe%'f9Mf‡fA¦fèf&øf)g'Ig&qg+˜g#Äg"èg1 h=h'\h<„j?Áj k)k 8k1Yk-‹k/¹kRék…a…~…œ…º… Ö…%÷…†:†)W†† Ÿ†À†3Ú†‡'‡ B‡&c‡&Š‡8±‡$ꇈ*ˆDˆ"aˆ)„ˆ®ˆɈáˆúˆ‰/‰$N‰s‰Ž‰-¤‰0Ò‰©Š#­‹4Ñ‹Œ&"ŒIŒ7fŒ5žŒfÔŒ&;&b‰¦z¹>4Ž1s/¥.Õ"&A&h&­Ô5ò(‘C‘=^‘;œ‘Ø‘ñ‘ ú‘3’18’7j’.¢’6Ñ’“;!“(]“)†“-°“!Þ“&”/'”)W”3”-µ” ã”(•Q-•)•,©•Ö•*è•*–!>–`–0–)°–$Ú–ÿ–'—&E—+l— ˜— ¥—(²—Û—(ò—I˜3e˜™˜³˜ Ƙç˜#™ (™6™R™c™|™™¥™»™Ñ™å™/ú™*šEš cš!oš‘š°šΚ3éš›=›]› }›Až›-à›DœSœeœ'œ'§œ,Ïœ*üœ('P.l*›Æ*á- ž#:ž^žužŠžŸž,³žàžñžŸ!'ŸIŸfŸ„ŸšŸ®ŸÅŸÖŸõŸ) 2 R a ~ .— 2Æ ù ¡.1¡$`¡…¡š¡²¡&É¡4ð¡"%¢H¢(b¢$‹¢°¢Ë¢Þ¢ð¢££<£/X£ ˆ£)”£¾£У ê£ö£#¤6¤S¤j¤{¤›¤ µ¤Ö¤å¤¥6¥!V¥$x¥¥(±¥Ú¥ ø¥¦,8¦e¦¦ž¦½¦ݦ&÷¦ §"?§)b§Œ§ ª§˧3æ§&¨A¨R¨a¨x¨¨$«¨Ш"㨩)©H©*h©“©­©É©ç©ªª#-ª&Qª'xª) ªʪ*ܪ%«0-«6^«9•«/Ï«#ÿ«#¬?¬O¬#l¬&¬)·¬á¬"­#­A­$Z­!­=¡­/ß­0® @®a®€®-®Ë®(뮯/,¯)\¯ †¯&”¯"»¯)Þ¯#°,°C;°-°­°Ë°-ë°3±:M±:ˆ±5ñ*ù± $²+0²2\²*²!º²ܲ?ü²4<³:q³=¬³.ê³#´"=´8`´7™´:Ñ´: µGµCcµ§µ"¸µ&Ûµ¶¶30¶d¶}¶"–¶,¹¶4涷(2·[· {·#œ·#À·ä·2¸6¸V¸g¸€¸œ¸'¯¸׸)ó¸ ¹#>¹b¹!q¹“¹±¹ǹݹ ò¹ þ¹ ºº-ºDº Yºfº‚ºœº1»º$íº» ,»M»k»‚»™» ®»(º»0ã»1¼!F¼<h¼¥¼(ż)î¼½16½'h½/½À½ß½(þ½('¾&P¾w¾¾"¦¾+ɾõ¾¿$¿8¿M¿l¿%Œ¿$²¿*׿À"À/?À+oÀ›À+±À@ÝÀÁ!1ÁSÁ$mÁ’Á$¬Á!ÑÁóÁ+ =Â8^Â&—Â&¾Â åÂ!òÂÃp3à ¤ÃÅÃÜÃ&úÃ2!ÄTÄpÄ1ŠÄ¼Ä)ÑÄûÄ Å/Å3EÅ5yůÅ*ÆÅ+ñÅ'Æ"EÆ&hÆ!ƱÆ,ÈÆJõÆ'@Ç!hÇ"ŠÇ­Ç(ËÇ'ôÇÈ(;ÈdȀȓȣÈÀÈ9ÐÈ -ÉÉ4É!NÉ%pÉ–É+°ÉÜÉúÉÊ,3Ê`ÊÊ0–ÊÇÊ2äÊ'Ë?Ë]ËJuË)ÀË+êË&Ì4=Ì"rÌ0•Ì&ÆÌíÌ Í<(ÍeÍ)tÍ1žÍ$ÐÍ)õÍ*Î/JÎ*zÎ)¥ÎÏÎéÎ/Ï'6Ï6^ÏA•Ï1×Ï7 Ð-AÐ<oЬÐ+ÊÐ%öÐÑ79ÑqшџÑ"¸ÑÛÑòÑ -Ò$ÒCÒaÒ€ÒŸÒ ¹Ò!ÚÒJüÒ)GÓ#qÓ•Ó¬Ó)ÇÓ&ñÓ Ô"9Ô\ÔxÔ&”Ô»Ô"ÌÔ-ïÔ)Õ+GÕsÕ“Õ)¥Õ;ÏÕ Ö/'ÖWÖ(oÖ#˜Ö¼ÖÓÖ1óÖ&%×L×1hך״×Ò×ì× -Ø$Ø3Ø0BØ's؛رØAÁØÙÙ1ÙHÙ<_Ù"œÙ¿ÙÐÙ#ìÙÚ/ÚHÚ-^ڌڢڸÚÕÚóÚ"Û3ÛHÛ*fÛ‘Û¦Û½Û!ÑÛóÛ Ü#1Ü"UÜxܓܬÜÆÜÜÜòÜ Ý:+ÝfÝ+…Ý*±ÝÜÝ6îÝ8%Þ9^Þ;˜Þ;ÔÞ<ß-Mß.{ß&ªßJÑß6àSàqà;‡àEÃà áá>áQá$oá”á§á½á$Íá0òá##âGâ`â%qâ—â¶âÉâçâãã-(ãVãeã|ã ‹ã™ã¬ã Çã Ôãàã øãä$%ä Jä Xä bä läxä+Šä ¶äÄä"ãä6å=å -Våaå}å%å¶å Öåäåýå æ"æ1æAæ:_æ7šæÒæëæ çç&ç5ç IçVç kç xç,†ç ³çÀçÕç!ñç"è6èSè+pè-œèÊè)Üè éé'é@éPé$cé ˆé–é³éÅéÜéîéê"ê6ê Nê'oêU—êDíêJ2ë}ëœë#¹ëÝëøë ì(3ì\ì/tì)¤ì(Îì÷ì.í*>íií"‡íªíÈí.äíî,î Cî*dîîŸî³î*Äî8ïî (ï3Iï#}ï)¡ï2Ëï'þï&&ð/Mð}ð›ð¸ðÓðóð(ñ0<ñmñ/‚ñ1²ñ*äñò(òBò*Sò6~òµò,Çò0ôò5%ó[ózó)•ó)¿ó éóöóD -ô!Oô!qô$“ô¸ô Áô#Ïô$óô"õ ;õ%Gõmõ,Œõ ¹õ%Çõ"íõö ,ö3MööD¡ö'æö÷#÷ ?÷0`÷‘÷¦÷'¾÷$æ÷$ ø0ø'Pøxø’ø%²øØøìøýø!ù=ù$]ù%‚ù$¨ù-Íù!ûù%úCú_úú&™ú%Àúæúû û=ûZûDyû!¾û,àû ü'ü?üSü.mü5œü9Òü ý-!ý,Oý+|ý¨ý¿ýÑýäýIþ,MþDzþ1¿þñþÿ'!ÿ3Iÿ>}ÿ"¼ÿ'ßÿ/17(i -’0&Î2õ+(%T#z5žÔî  &;%bˆ¤<½&ú!4>%s™#·Û-â%6&Q0x.©ØGì'40\¥$Á3æ"5Xri‘#û#C+_‹,ª*×%/(X4a –£%»%á ! : ,S )€ 'ª (Ò #û * -7J -"‚ -¥ -*¾ -,é -- D +a  (§ DÐ ' 4= 4r 5§  Ý þ  *+ V "f #‰ #­ #Ñ õ %7Ic~˜±Ï%ä* -05f:{7¶î"%?!e"‡/ªÚ÷%*:e ¤¾ Ùú":Qh#‚(¦Ï×ì#ý!<'T0|­Íæõ /BWr‰¡À Úèÿ 81Y,‹:¸!ó 6Oc|!›½×ö1+F0r£"¹6Ü.B ]~!•*·â"þ'!I%]ƒ-˜1Æø1Gg1†¸!Ëí<&1c%•'»ã(ü%D:#£À[Ñ-DJ[*¦ÄÑ –">µ">ô"D3#<x#Jµ#N$ýO$ZM%=¨%6æ%@&?^&<ž&ŽÛ&Žj'~ù'éx(‰b)Aì):.*Xi*=Â*>+P?+N+Nß+0.,E_,¥,¤3-TØ-8-.Uf.P¼.9 /NG/H–/'ß/î0Iö0N@111IÁ1< 2FH292'É2Jñ2K<3Hˆ3LÑ3n4=4KË4}5O•5Kå5]16`78ð85)9U_96µ97ì9M$:Or:xÂ:T;;Ä;FU<Bœ<'ß<„=5Œ=NÂ=N>'`>Dˆ>~Í>ÖL?¹#@&ÝA$B.)B,XE,…E,²EßE$ôE2FLFiF „F¥F0ÅFöFG+GGGPGXG%`G†G:—G2ÒG3H9HXH4gH(œH)ÅHïH< IHI&_I)†I&°I$×IüI)J9JNTJN£J-òJ! KBK7_K;—K>ÓKFLYL yL8šL%ÓLùLé MöN%þNü$O"!P:DPNP‡ÎP+VQ+‚Qä®Q“R"²R1ÕR'S/S€OSãÐT,´UáU4oV¤Vª¶VÕaX-7Y5eY>›Y>ÚYZ>8Z8wZ¹°]]j_ÇÈ_,a3½a/ña!b=b-Yb+‡b,³b(àb c)c#Ec icŠc+¦cÒc*ñc9d5Vd!Œd0®d8ßd9e/Re(‚e@«e@ìeD-f@rf ³fÔf,ðf9g/Wg7‡g2¿g8òg+h-Jhxh;–hEÒh"i3;ioi‹i*©i Ôiáiüi:jIjej|j“j+¬j"Øj5ûj01kbkwk1k¿kÕkòk1lCl(`l2‰l¼l7Ùl1m;Cm?m@¿mn- n@NnAn0Ñn,o,/o&\o1ƒo1µoço1þo0pNGpK–p?âp@"q!cq!…q§qÅq@ÙqAr4\r4‘r;Ærs? s@`s7¡sÙs3ós2't-Zt!ˆt ªt$Ëtðt u,*u$Wu9|u¶uÈuÚuCìu0v"Dx#gx%‹x)±x)Ûxyy.yCy\y sy”y"²y#Õy ùy%z@z^z8}z#¶z*Úz3{9{!V{x{~{‡{ {2œ{Ï{ ï{0|CA|4…|Gº|G}GJ}G’}?Ú}=~>X~*—~+Â~Cî~2 Kl!‹$­&ÒùR€´b€%‚C=‚O‚eÑ‚>7ƒvƒ%‘ƒJ·ƒ!„ $„!E„'g„(„)¸„Gâ„*†-E†!s†•†"³†Ö†,ì†8‡ R‡ s‡)”‡4¾‡)ó‡0ˆ7Nˆ.†ˆ'µˆ@݈6‰.U‰<„‰-Á‰ï‰#Š%$ŠJŠ(iŠ’Š¬Š)ÆŠ)ðŠ‹3‹8S‹8Œ‹Å‹á‹(Œ*ŒGŒeŒG‚ŒÊŒ çŒ#(,HUž¯É*ä Ž0ŽJŽ>jŽ©Ž$ÇŽìŽýŽM?g/§×*ñ!>"X{Ž¬%Æì;‘+B‘n‘s‘&‹‘²‘Α'í‘3’.I’Lx’(Å’#î’A“8T“H“KÖ“"”5”(K”Dt”K¹”?•)E•(o•+˜•0Ä•õ• -–"–$@–7e––7°–è–ü–#—<—R—Dr—·—0Ó—1˜!6˜+X˜„˜%œ˜"˜:å˜9 ™Z™&q™%˜™B¾™GšCIš+š¹š6Ùš7›H›&Y›#€›9¤›IÞ›=(œ"fœ.‰œ2¸œ(ëœGP\2­'à5ž5>žtž(’ž7»ž-óžD!Ÿ9fŸ, Ÿ@ÍŸU (d¡+¡J¹¡*¢(/¢$X¢#}¢¡¢G´¢?ü¢'<£d£$|£¡£-Á£ï£ -¤$¤A¤#`¤„¤Ÿ¤½¤äJʤ%¥7;¥Ls¥2À¥)ó¥'¦E¦$e¦&Š¦F±¦"ø¦§!-§1O§§+§"ɧ%짨+¨C¨Z¨>q¨°¨-¸¨,æ¨'©;©[©w©•©´©5Ô© -ª0&ªWª)mª—ªµª%Ǫ"íª,«4=«Cr«8¶«4ï«'$¬(L¬ u¬7–¬9ά'­;0­9l­¦­0í!ô­:®Q®c®ƒ®0£®Ô®7ð®(¯!F¯%h¯>Ž¯=ͯ! °;-°4i°3ž°*Ò°2ý°C0±t±zˆ± ³($³1M³:³8º³ ó³"´7´U´p´"Ž´&±´Ø´ì´µµ54µ9jµ5¤µ=Úµb¶O{¶G˶9·0M·3~·/²·6â·6¸-P¸6~¸.µ¸&ä¸" ¹6.¹0e¹1–¹4ȹ5ý¹/3º%cº!‰º%«º#Ѻ/õº.%»T»Om»t½»2¼jP¼»¼1×¼F ½4P½…½0£½Ô½^T¾+³¾ß¾)ÿ¾)¿&I¿-p¿&ž¿:Å¿ À+ À+8À7dÀ5œÀ2ÒÀ"Á((Á&QÁ'xÁ+ Á+ÌÁøÁ"Â:ÂVÂuÂŽÂ#«ÂÏ ïÂ*Ã-;Ã1iÃ*›Ã#ÆÃ$êÃ(Ä98Ä.rÄ%¡ÄÇÄ!ãÄÅ-%Å.SÅ-‚Å °ÅÑÅ(ðÅ!Æ;Æ0XÆ9‰Æ0ÃÆ:ôÆ/ÇIÇhÇ#ˆÇ+¬Ç0ØÇ, È/6È#fÈ ŠÈ0«È0ÜÈ É)É,?É.lɛɰÉÆÉ2âÉ*Ê@Ê>^ÊDÊâÊüÊIË"bË%…Ë'«Ë*ÓË*þË?)ÌiÌ(ˆÌ ±ÌÒÌïÌÍ$Í@Í5WÍ;ÍÉÍäÍ/Î+2Î,^Î7‹Î1ÃÎ!õÎÏ3Ï)HÏrωÏ;£Ï<ßÏ=Ð8ZÐ=“Ð/ÑÐ+Ñ"-Ñ#PÑ tÑ/•Ñ:ÅÑØÒ+ÙÓÔˆÔ!Õ!¿Õ(áÕ& -Ö 1Ö6RÖ.‰Ö ¸ÖÙÖùÖ×7×-W×$…×)ª×,Ô×Ø Ø Ø9Ø"IØlØ }ØŠØšØ'¸Ø4àØ*Ù@Ù4^ٓٯٿÙÏÙ1ìÙEÚdÚ{ÚDÚÔÚ1îÚÆ Û çÝ]Þ&fÞ-ÞQ»Þ6 ßDß*^ß/‰ß¹ßÏß+èßà52à1hà+šà<Æà<á"@ácáááºáØá<çá;$â`â0{â¬â"Áâäâ ã#ã=ãNãdã„ã3œãÐãKëã(7ä4`äK•ä'áä3 å1=å7oå,§å2Ôåæ?æ _æ3mæ.¡æ%Ðæ$öæ@ç2\ç0ç0Àçñç~ èGŒêJÔêë97ë8që5ªë3àë3ìWHì ì»ì9×ì%í7íMUí)£í+Ííhùí/bñ’ñ ¬ñ(Íñ7öñ7.ò+fò0’ò"Ãòæò4ó;ó&QóBxó$»ó*àó! ô"-ôGPô:˜ô5Óô õp&õ$—õ0¼õ;íö)÷$>÷+c÷÷E§÷cí÷7QøF‰ø<Ðø' ù(5ù^ù1wù ©ù#Êù"îùú)/úYú+vú,¢ú8Ïú4û1=ûMoû9½ûŸ÷û(—ü;Àü5üüR2ýR…ýLØý %þ Fþ<gþ¤þ5Âþ2øþ++ÿ*Wÿ*‚ÿ*­ÿ!Øÿ·úÿ0²ã'÷37$kD5Õ. &:#a#…)©6Ó- -)8Qb8´í :+f!…<§äE)G1q1£ Õã%&!Df.w¦½)Ôþ4&HoŽ¬ Æç%/-&]„¡¼Úö' : V *t Ÿ ¶ Õ 7ì $ -= - Y -z -™ -/¸ -!è - - " : $U z š ³ Î ê  # *C %n !” (¶ 3ß Í *á@ ,M%z) 6ÊB‹D'Ð%ø;„P¡Õ9w.±-à&*.Q.€%¯.Õ%F*(qšK²BþAW_4h28Ð3 <=zP“.ä*#>,b'8·0ð0!%Rx)“S½53G{;”;Ð#  03Q-…)³#Ý1'3'[ ƒ )›Å(ßhFq¸Ô ç <Ji"x›±Èàø6%\w •$¡!Æ è 0' 'X '€ '¨ 'Ð Hø 6A!Bx!»!!Í!"ï!6")I"%s"$™"¾"2Û":#$I#'n#)–#&À#ç#$$6$4O$„$š$#¶$(Ú$&%!*%L%i%„%¡%$º%$ß%,&$1&V&&f& &,®&3Û&"'&2';Y'1•'Ç'Û'ù''(=@(0~(¯(7È(,)"-)P)f)~)š)*´)#ß)<*@*0P**—*³*%Ã*3é*&+D+[+%l+’+ ¬+Í+ Þ+'ÿ+;',"c,6†,½,*Ð,!û,;-!Y-0{-¬- É-!ê-! ...*K.v.‘.1®.#à.&/+/8B/&{/¢/¶/Å/ß/þ//0K0#]001“0#Å0Fé001M1,l1™1$¹1Þ1+ö11"2#T2)x2¢2Fº2(3:*39e38Ÿ34Ø3& 4!44V4f4#„4¨4/È4%ø4'5'F5n5&Œ5#³5U×5H-6*v6!¡6#Ã6ç6)ü6%&7*L7w7+Œ7.¸7 ç7õ7'888"X8{8GŒ8$Ô8ù89759Bm9H°9Jù9MD:&’:¹:'¿:6ç:';!F;h;R‚;3Õ;9 <<C<A€<(Â<(ë<@=?U=G•=FÝ=$>GD>Œ>ž>+¾>ê>þ>5?S?p?+Œ?.¸?Aç?#)@7M@&…@2¬@ß@+ÿ@"+A4NAƒA¢AÀAÝAõA)B&?B,fB-“B(ÁBêB&ùB C@CXCtC ŽC šC §CµCÉCàC õCDD$8D8]D)–DÀD&ÞDE"#EFE\E -rE5}E9³E:íE#(FJLF)—F9ÁF9ûF)5G7_G$—G>¼GûGH$-H$RH*wH¢HºH)ÑH9ûH(5I^IuIŠI I ÀI)áI J2*J']J.…J:´J3ïJ#K79KLqK¾K$ÔKùK.LHL$_L „L¥L4ÄLùL1M%IM%oM •M#¢M'ÆM‹îM1zN¬NÃN(ÜN'O-OGO$_O„O1˜OÊO ÝOþO:P<OPŒP8ªP8ãP*Q!GQ,iQ(–Q¿Q:ÜQ[R,sR R ¿R"àR.S.2S&aS-ˆS'¶SÞSîS$þS#T26TiTT ŸTÀT9ÞTU23UfU |UU0·UèUV='VeV2„V+·V"ãVWE#W'iW0‘W&ÂW4éW#X)BX)lX–X®X?ÉX Y'Y8;Y"tY)—Y(ÁY)êY,Z'AZiZ}Z)”Z¾Z:ÞZ@[-Z[?ˆ[4È[Fý[D\0`\-‘\¿\Rß\2]M]h]"€]£]¹]Ì]á]û]^.^H^]^"}^X ^4ù^*._Y_q_:_1Ë_ ý_*`I`g`#‚`¦`(¶`4ß`(a&=a$da‰a+œa>Èa"b4*b_b2|b%¯bÕb$ïb*c%?c#ec2‰c"¼cßcýcd7dSdcd;{d7·dïdeAe[exe•e²eJÌe'f?f!Rf*tf"ŸfÂfÙf2óf&g@g Wgxg!—g#¹gÝgùg*hCh[hqh*‡h²h,Ðh)ýh''iOiniŠi"¨i"Ëiîi'j9-j'gj;j4Ëjk;k<Sk1k@ÂkBlBFl3‰l4½l/òlP"mBsm"¶mÙmFñmI8n‚n–n²n!Æn)èno%o?oQo4lo+¡oÍoéo'úo"pAp"Tp#wp›pµp0Òpqq)qQ-§6Õ> ‚K‚j‚1…‚1·‚é‚ø‚7ƒ!Hƒ!jƒ)Œƒ¶ƒ¾ƒ*σ#úƒ-„ -L„'W„#„1£„Õ„'æ„$…3…%O…>u…%´…WÚ…)2†\†u†&“†Bº†ý†‡'0‡(X‡(‡ ª‡-ˇù‡'ˆ.@ˆoˆˆ˜ˆ%«ˆ!ш&óˆ&‰(A‰1j‰(œ‰'ʼní‰ Š*Š+GŠ+sŠŸŠ¼ŠÙŠöŠ!‹L5‹)‚‹6¬‹ã‹ÿ‹Œ2Œ0QŒC‚ŒMÆŒ.4<c5 ÖõŽ% ŽJFŽ'‘ŽH¹Ž>AW'q5™DÏ!361j3œ&Ð÷7 ‘-C‘9q‘1«‘)Ý‘"’,*’W’r’#’’¶’+Ô’)“*“D“FZ“$¡“ Æ“7ç“”?”+[”‡”7Ž”(Æ”ï”& -•/1•/a•‘•P¥•&ö•4–R–"r–/•–-Å–ó–$— 7—/X—|ˆ—+˜.1˜"`˜)ƒ˜"­˜5И&™$-™3R™†™4™Ä™"×™0ú™/+š#[š"š$¢š9Çš8›-:›/h›4˜›<Í›6 -œ+Aœmœ7‹œ2Ãœ3öœ**J u#–Hº5ž.9ž.hžB—žÚžñž Ÿ2"ŸUŸ(jŸ)“Ÿ'½Ÿ'åŸ  #! E ` z • ± Ì á û 3 ¡+@¡0l¡ ¡<¾¡3û¡/¢F¢.f¢$•¢&º¢á¢,£(.£(W£+€£'¬£ Ô£õ£¤¤'9¤0a¤%’¤.¸¤ç¤¥ !¥&B¥+i¥ -•¥ ¥»¥,Ï¥ü¥¦/,¦6\¦"“¦¶¦ͦÞ¦ô¦§§3§"I§l§…§$ §ŧã§ô§ ¨,¨ G¨6h¨Ÿ¨8¾¨$÷¨©<©W©h©‚©¢©Á©Û©ú©Fª/_ª;ª˪'êª5«8H««)ž«È«(ä«: ¬"H¬(k¬1”¬Ƭ(Ú¬!­-%­=S­+‘­@½­+þ­$*®4O®„®0›®Ì® â®9¯4=¯;r¯;®¯ê¯.°%4°HZ°&£°+Ê°ö°‚ònöóäpþ¡Õiôƒj–WTe" xOF3Ê}ö@CÛÅýÙk¿# ª²«6†x ,§6îoÕ]¼¦Ç:’äJò¥èÞ$_E;2Ú -5È¥$èõD̘ r -ða[rŠÓ½Ä°P>T`ðÁŽJVÄó»Ãºêí'ñ9´O'0È,¸séjæ©<â8¹yúM„0Èâù®JŸÃ!_¦åc=Pxû;µ`K=,<³·Ò–ä˜@4haå¹ÐÄá¡ `ðÝʵg×håwïTÌF´¿" K$BSÑŒ%w!徺€—¢¥\ç6:ѱ‹q¯Z˜¸ææUÁÄ…à ¨]ô›-G€ü'.\êð(#’ׯÚÞ`0yŒ2Îì5_;ìó½'9ÚÞJÛ‡GÆcï’ÐHWwEã¶ú4(ò6k,z -4NªRsL •81Ót/)Žý²‰z‘G·”[Ùê ©™õ®\„Ð#p¸üVop[CŽ£K -9@äôRH%A•=SRv!YÃ}ú†á0²þ“H .d/8<Jľ8Ýž”º1ÿo-“ùëNÞÕaæX)yÙ¾~++£:êˆSßWžV(‰XáÊ“ vÊ>2œ\“QÓÅ´³™oé íÕLv*íK(¨ÝV±³èû©¥w@ov: iÊë°@áÀP:Cbu*ŽØ¶Å3®Ê‚¥„.ôìOÄÏO4*#3ÑPÇ%¦CŠ›¼UIàÁ—‹Zo(µ*Óq{-¯É+MQõû£(P]ÒL窚&–+s¿3é³cËHßdÛõCAµYÝmøÃ?C›ÔßÃW•Ï7BlVQì³×´ƒÕck€`4ü“Ú”„)s¯^ë+f^F¸°&‚û|qÛŒÜà‡ Mòº‘ØîÂJ[1éò94Þ)x®g·³øÀÇy¾Ñ¥‹R¤Æˆñä#†ÔÒ­å¤?~£°&>w›úËrã°Ü…nOxœ¢UNZ$­¬’8; Œ•Ò‚^×|«f IÍ5<Òóȸf{~ø3 X·;¬Yô9”\0iëap7œ§^ ŠD$'§Ø×Í®ßÏ´íuþ¬˜¡'‰Í~^ Úàê=1}@KOÔ7#”Bv¼Í |s ͉B‚Ù‘ÝÝ[ -iUw`¨fÈ]ï”n\­6Ù@ÎãB½`•°Ʊ:UÑcEtŽ ÅjéÇÖ),ÅŒ>exiÿ¯L¯É5év¶üù÷Ö–çqÝÍ1aÒû™É‚µæï´ ØÜà\ªÉ½N- -ˆ¶sƒ²¸ »<É>>‰‘™bÂ3Î]«ú“/¿t%ECÍ*¹<OìBlÉP}ò‹[ô›oã¼:IlÌodž™…¤R³> óyM·ùŠ­þ‰q˜µ nbÙ|5+¡å gêXïšagS"ukßéù„ çß¿nì( †.Å y_ÇÔ‡ÈhŸ/d[öuèÎ;T±€…g¬¹‹r-.êtª’óLEè=W™ø[@a•’hO}¾÷iC‰ÀùŸÿ¹·ãÁÐ÷Q7‰Âg%Ä3îI¸i=ãÆ»ó´—J1Fš¾õ4ÕSþM¯uëA÷GË—™ ‹€èÒAzÓ I•"ál«{t €Ú„Â%í÷kÀ jkbY쵆 }ð›îp\nÏŒg*Dð¼±W9!ù"gnõœ%jG#Ý©QmÐ',’ÐH½¤T;7ᩧz…ˆVY Û|öÈ!÷÷«Uv -b>B¿Ú ZafDj“NHÍóÕïASôÆAñ˜qœMur«Ÿñ¸müú³"4Û*é¬t©?ñÖ3â<ºL~Ów2?# ×Ö–Õ²9!›bÇ{ÎqŒ5/?Nä. $_‘"ÌIŽ&Ì­5,H_Â8˜š¢»F¶±ÁGÊmkJ&ÞÄ ëžÿžRÞÛ]SSÔðñF·T$ÂŽdøÁöƒ28]Ìe£&NÆ eY‘í¤9ÅÜzhŸ—êâg—½)æ¢7òÆþ0°!ýìz=f 䈑•ÃúB–{‚E^Fü‡žû çýÿýVí&üfå"œ`bZ6¥_´ÿ^VšXÓž…eS9—6)<.H§Ôð¨Nw¡ö/Ô‡]£q§C¦F»ÿ¦Ú¨ËQÜ൧d Ù\ãØGõ“NV0=c¢Er<áœL Îß6PÆçøöûå?„çÀ”F/¹=f4:ZnU˪87]+n$ÌR~¬×˜†ƒætÒÅKmXUü-%˲}ºë?ì¤h²îÖD—_ô¡T{!ª5 -Á*WjIè(kÖ¡| ×ÜñQët‡ÖÀaW½€¿h!¨vÎ|XŸHÿú™ˆ7lføGØe®¬hPu&ûLlîéâY#±m¤-¯D›jMc»+‘ ¶ÙR–_ç‹;e¢šXÏè„ll.zOþÖÇ//z£^DAÜ{LZdIØ,-{l.»á¿¹@Ìœ,ˆjš¶õ Pr Ðm‡Éá…Kσ…É;Z>¦Ñ’Acî%®Ïâ¢Çp^u)RU1ÔÀe·ýŠ2Y‚JEŠpÂdpM$Y~º})'«&eQ~X¨Ëâ¥ÁWB:¦i€öh‹Œ2Tˆxy¦†2žàcÓ bb1Ø÷7ä?ñˤ¬5ƒK±i¼[8kDmºÑ1ýà|xРã+"ýsŽy¨ù²Ÿ®»ÀªGs†M¾­`I«6m†AE°Èí© -έ‡D¾æ*­§2(KÊ3š £?0¹øÞÑ0Zdâr¢òþ”'ÛQ¼¶T -ß [default is %d] +Þ•< üI[ Ü“HÅIÅ]ÅqÅ ‹Æc™ÇýÈIÉ<aÉ>žÉ?ÝÉ6Ê!TÊ[vÊLÒÊNÌ;nÌ3ªÌ@ÞÌ?Í5_Í—•Í-Ît¾ÎÎ3ÏvÐ?yÐ:¹ÐKôÐ7@Ñ7xÑL°ÑOýÑBMÒ2Ò?ÃÒ=ÓŸAÓ@áÓI"Ô;lÔO¨ÔFøÔ=?ÕD}ÕBÂÕ"ÖÏ(Ö>øÖ>7×,v×K£×>ï×H.Ø;wØ"³ØAÖØ@Ù>YÙD˜ÙjÝÙ3HÚ@|ÚL½Ú– +ÛH¡ÛEêÛ-0Ü=^Ý]œÝ>úÝ?9ÞEyÞG¿Þ|ßL„ß…ÑßBWà?šà"ÚàNýà0Lá8}á6¶á"íáHâOYâ ©âZ³ã-å$<å!aå%ƒå%©å%Ïåõå*æ"0æ2Sæ'†æ®æÍæ åæç4çRçbçuçç–çžç$¦çËç4Ýç2è(Eènè‹è#›è%¿è&åè é8é Xé fé!‡é%©éÏéìé3ÿé3ê`Gê`¨ê& ë 0ëQë-që1Ÿë8ÑëD +ìOìnì-Žì¼ìÐì¼áìžî¦îºî"Áï,äï@ðmRð$Àð$åðÝ +ñ*èñ%ò19ò)kò3•ò'ÉòDñòÁ6ô'øôe õ-†õ-´õ$âõúöø…ø—›ù23ú&fú.ú2¼ú,ïú+û8Hû4û¶û2Óû#ü#*üÂNü#þ#5þ¢YþWüÿAT'–7¾8ö4/*d2¢Â&e(Œ6µ%ì/:B,}4ª-ß &"?!b „"¥!Èê$"%H#^"‚"¥3È4ü"1$T2y3¬.à 302d4—3Ì  (; /d #” 1¸ 2ê 2 +P +'i +‘ +*® +6Ù +# #4 9X ’ ­ "Ê í þ  -. \ u Œ £ !· !Ù 6û *2 ] o +… ± Ç ä +.$J,oœ7¸1ð1"3T3ˆ¼*×447,l(™$Â#ç- )9cE|&Âé96:3q3¥Ù÷*4<4q:¦&áAJ3i3/Ñ1,M'z¢#»%ß"%<%bˆ˜¨D¸Öý)Ô'þ'&%N&t›­ÆÙî $?&\ ƒ"¤Çæ+$--R4€µ"Óö3ü(05Y˜  )ªÔì<5B*xC£CçC+Co;³9ï;)0e!–3¸ì  2 $M r ’ <¨ ³å ™"#¸"1Ü"O#i^#CÈ# $$)$DN$“$²$Ð$ï$ %!0%2R% …&%¦&Ì&ë&"'('!=''_'!‡'"©'*Ì'.÷'#&('J('r(#š(#¾(0â(')#;)6_)0–)Ç)Ü)ø)!*'8*`*u* Š* «*Ì*à*6û*62+i++”+²+È+Þ+Aõ+7,M,f,†,#¢,5Æ, ü,(-)1-[-o-‚-!¡-Ã-Þ-0ú-+.G.g.z.>.'Ï.÷./+&/-R/€/ / ¹/Ú/î/ +0)&0P06i0% 0Æ0Ë0 á01151-U1)ƒ1=­1!ë1 21+2:]2˜2:·2=ò203?3-R33€3;´3#ð3%4&:4&a4ˆ4š4¯4Î4/í45&05W5n5 ˆ5©5¼52Õ5%6-.6+\6 ˆ6"©6Ì6 è6 72*76]7”7%¨7#Î72ò7:%80`86‘8È83ß829F9$U9!z91œ9=Î96 : C:5d:2š:-Í:Fû:MB;2; Ã;.ä;.<&B<$i<AŽ<,Ð<<ý<<:=+w=@£=Wä=%˜S*×S-T00T(aT0ŠT0»T'ìT0U'EU#mU‘U/­U1ÝU3V4CV/xV.¨V+×V+W&/W%VW+|W-¨W#ÖWOúWqJX¼XRÚX(-YBVYA™Y5ÛY,Z.>ZsmZkáZ4M["‚[+¥[!Ñ[+ó[2\%R\1x\ª\&»\'â\- +]78]0p]$¡])Æ]'ð](^)A^(k^”^¯^Î^æ^__ 1_ R_s_$‹_"°_&Ó_ú_ `8`W`&s`&š`Á`&á`a%aAa[asa(Ša#³a#×a#ûab!=b _b€bŸb¼b(Úb+c+/c2[c2Žc7Ác7ùc!1d/Sd=ƒdÁdßd"øde$:e&_e(†e"¯eÒe ìe f/,f/\fŒf¦f(¹fâfþfg+g1Cg ug–g±g2Êg7ýg5hIh=`hžh"½hàh+þh(*i8Si Œi"­iÐiíi jj$7j\j*oj8šjÓjìj k%)k*Ok1zk-¬kÚk÷kl2#lVlml7…l8½l9öl90m2jm'm'Åmím n&*n-Qn3n2³nHæn(/pXp(lp•q°q4Ëq%r0&rWr5trLªr ÷r s9sYsxs—s(·sàs.ûs9*t dtnt‚tt$¯tÔtçtötu+'u/Su"ƒu*¦uÑu7ñu)vFvVvgv2‡v<ºv÷v w6%w\w$ww¿œw\z;uz(±z-ÚzF{5O{…{"˜{0»{ì{þ{|0|$I|n|(‡|$°|!Õ|4÷|4,}!a}!ƒ}¥}Â}à} û}4~4<~q~#‡~)«~Õ~ä~6J["o’,­ÚBô&7€ ^€2€:²€'í€%';%c9‰ÃAâ$‚&4‚)[‚'…‚&­‚+Ô‚#ƒ"$ƒ1Gƒyƒ'˜ƒ<À…?ý… =†)J† t†1•†-dž/õ†R%‡x‡!—‡¹‡Ù‡4ð‡$%ˆJˆ?cˆ,£ˆ,Ј~ýˆ*|Œ§Œ$ÃŒ*èŒ76K.‚"±Ôë7Ž<ŽSŽ1pŽ#¢Ž!ÆŽ&èŽ0-5^ ”2µ"è "ùAH;‘?„‘Ä‘Ô‘ñ‘ +’9’aY’5»’<ñ’6.“$e“-Š“¸“.Ö“” ”:”!T”+v”¢”-¿”í”% •*2•(]•.†•Dµ•ú•u–3Œ–=À–Bþ–QA—Q“—Få—%,˜%R˜9x˜;²˜<î˜+™-K™4y™*®™)Ù™)š)-š-Wš.…š”´š%I›o›'›©›0¿›ð›4œ$Dœ%iœœ3¥œ3Ùœ/ <='z+¢5Î0ž"5žXž0rž"£ž&Æž3íž!Ÿ,8Ÿ%eŸ'‹Ÿ'³Ÿ +ÛŸæŸþŸ : W !l Ž § ¼ Ñ ð /¡1¡Q¡i¡ƒ¡!˜¡º¡Ï¡-ê¡"¢;¢X¢v¢”¢ °¢%Ñ¢÷¢£)1£[£ y£š£3´£è£¤ ¤&=¤&d¤8‹¤$Ĥ餥¥";¥)^¥ˆ¥£¥»¥Ô¥î¥ ¦$(¦M¦h¦-~¦0¬¦©ݦ#‡¨4«¨à¨&ü¨J#©n©7‹©5éfù©&`ª&‡ª®ª˪!Þª«z «>›«1Ú¬/ ­.<­k­‰­&¨­&Ï­ö­&®;®5Y®®ª®=Å®;¯?¯X¯ a¯3k¯1Ÿ¯7ѯ. °68°o°;ˆ°(Ä°)í°-±!E±&g±/Ž±)¾±3è±-² J²(k²Q”²)æ²,³=³*O³*z³!¥³dz0æ³)´$A´f´'„´&¬´+Ó´ ÿ´ µ<µ<Vµ(“µ¼µ(ÓµIüµ3F¶z¶”¶ §¶ȶ#å¶ ··3·D·]·q·†·œ·²·Æ·/Û· ¸&¸ D¸!P¸r¸‘¸¯¸3ʸþ¸¹>¹ ^¹A¹-Á¹Dï¹4ºFºZºrº-º»º'Õº'ýº,%»*R»(}»¦».»*ñ»¼*7¼-b¼#¼´¼˼à¼õ¼, ½6½G½^½!}½Ÿ½¼½Ú½ð½¾¾,¾K¾)^¾ˆ¾¨¾·¾Ô¾.í¾2¿O¿j¿.‡¿$¶¿Û¿ð¿À&À4FÀ"{ÀžÀ(¸À$áÀÁ!Á4ÁFÁ\ÁsÁ’Á/®Á ÞÁ)êÁÂ& @ÂLÂ#hΩÂÀÂÑÂñ Ã,Ã;ÃXÃ6uÃ!¬Ã$ÎÃóÃ(Ä0Ä NÄoÄ,ŽÄ»ÄÕÄôÄÅ3Å&MÅ tÅ •Å ¶Å"×Å)úÅ$Æ BÆcÆ3~Æ&²ÆÙÆêÆùÆÇE(ÇnÇ$‰Ç®ÇÀÇ"ÓÇöÇ)È8È*XȃÈȹÈ×ÈðÈ +É#É&AÉ'hÉ)ɺÉ*ÌÉ%÷É0Ê6NÊ9…Ê/¿Ê#ïÊË/Ë?Ë#\Ë&€Ë)§ËÑËðË Ì *Ì"KÌnÌŒÌ$¥Ì!ÊÌ=ìÌ/*Í0ZÍ ‹Í¬ÍËÍ-èÍÎ(6Î_Î/wÎ)§Î ÑÎ&ßÎ"Ï))Ï#SÏwÏ$†ÏC«Ï-ïÏÐ;Ð-[Ð3‰Ð:½Ð:øÐ53Ñ*iÑ ”Ñ+ Ñ2ÌÑ*ÿÑ/*Ò!ZÒ|Ò?œÒ4ÜÒ:Ó=LÓ.ŠÓ#¹Ó"ÝÓ8Ô79Ô:qÔ:¬ÔçÔCÕGÕ"XÕ {Õ&œÕÃÕØÕîÕ$ÿÕ$Ö3AÖuÖŽÖ"§Ö,ÊÖ4÷Ö,×(C×l× Œ×#­×#Ñ×õ×2ØGØgØxؑحØ'ÀØèØ)Ù .Ù#OÙsÙ!‚Ù¤ÙÂÙØÙîÙÚ Ú %Ú 2Ú@ÚTÚkÚ €ÚÚ©ÚÃÚ1âÚ$Û9Û SÛtÛ’Û©ÛÀÛ ÕÛ(áÛ0 +Ü1;Ü!mÜ<ÜÌÜ(ìÜ)Ý?Ý1]Ý'Ý/·ÝçÝÞ(%Þ(NÞ&wÞžÞ¶Þ"ÍÞ+ðÞß<ß%Kßqßߡ߶ßÕß%õß$à*@àkà"…à/¨à+Øàá+á@Fá‡á!šá¼á$Öáûá$â":â!]ââ+â Éâ8êâ&#ã&Jã qã!~ã ãp¿ã 0äQähä†ä&˜ä2¿äòäå1(åZå)oå™å ¬åÍå3ãå5æMæ*dæ+æ'»æ"ãæ&ç!-çOç,fçJ“ç'Þç!è"(èKè(iè'’èºè(Ùèéé1éAé^é9né¨é¹éÒé!ìé%ê4ê+Nêzê˜ê¸ê,Ñêþêë04ëeë2‚ë'µëÝëûëJì)^ì+ˆì&´ì4Ûì"í03í&dí‹íªíÆí<âíî).î1Xî$Šî)¯î*Ùî:ï/?ï*oï)šïÄïÞï/ûï'+ð6SðAŠð1Ìð7þð-6ñ<dñ¡ñ+¿ñ%ëñò7.òfò}ò”ò"­òÐòçòýòó2óJódóƒó¡óÀóßó ùóJô)eô#ô³ôÊô)åô&õ 6õ"Wõzõ–õ&²õÙõ"êõ- ö);öeö+ƒö¯öÏö)áö; ÷G÷/c÷“÷(«÷#Ô÷ø÷ø1/ø&aøˆø1¤øÖøðøù(ùFù`ùoù0~ù'¯ù×ùíùAýù?úVúmú„ú<›ú"Øú.ûú.*û.Yû.ˆû.·û/æû-ü/Dü)tü(žü(Çü1ðü&"ýIýZývý#ý±ý Êýëý-þ/þEþ[þxþ–þ"³þÖþëþ* ÿ4ÿIÿ`ÿ!tÿ–ÿ ³ÿ#Ôÿ"øÿ6Oiˆž´Í:í(+G*sž6°8ç9 ;Z;–<Ò-.=&lJ“6Þ3;IE…Ëà$1Vi$0´#å "%3Yx‹©ÈØ-ê'> M[n„ Ÿ ¬¸ ÐÝ$ý " 0 > H R^p+¯ Ûé" 6+ b {  +‘ œ ¸ %Ë ñ   + +8 + P +] +l +| +:š +7Õ + &  < I a p  „ ‘  ¦  ³ ,Á  î û  !, "N q Ž +« -×  )  A K b { ‹ $ž  à Ñ î )I]q ‰'ªUÒD(Jm¸×#ô3 M(n—/¯)ß( 2.J*y¤"Âå.Ng ~*ŸÊÚî*ÿ8* c3„#¸)Ü2'9&a/ˆ¸Öó*J(j0“2Ä÷/ 1<(n*—ÂÛõ* 6K‚,”0Á5ò(G b)ƒ)­ ×äDø!=!_$/¦Ö ß#í$"6 Y%e‹,ª ×%å" . J3kŸD¿',A ]0~¯Ä'Ü$$)N'n–¦À%à+!Ik$‹%°$Ö-û!)%Kq‡£Ã&Ý% * G d  ž D½ !!,$!Q!k!ƒ!—!.±!à!ø!"."F"5^"9”"Î"-ã",#+>#j##“#¦#IÅ#,$D<$1$³$Ê$'ã$3 %>?%"~%'¡%/É%1ù%(+&%T&&z& +¡&0¬&&Ý&2'+7'%c'#‰'5­'ã'ý'(/(&J(%q(—(³(<Ì(& )0)4M)%‚)¨)#Æ)ê)-ñ)%*E*&`*0‡*.¸*ç*Gû*'C+0k+œ+´+$Ð+3õ+),"D,g,,i ,# +-.-#M-q-+-¹-,Ø-*.%0./V.†.4. Ä.Ñ.%é.%/5/O/h/,/)®/'Ø/(0#)0*M07x0"°0Ó0*ì0,1-D1r1+1»1(Õ1Dþ1'C24k28 24Ù253 D3e3‚3˜3*¯3Ú3"ê3# 4+14,]4#Š4#®4Ò4ä4ú45*5<5V5q5‹5¤5Â5%×5*ý50(6Y6:n67©6á6ô6"7%27!X7"z7/7Í7ê7%8*-8X8 t8‚8—8±8 Ì8í8" +9-9D9[9#u9(™9Â9Ê9ß9#ð9:#/:S:n:†:'—:0¿:#ð:;4;M;\;p;‚;–;¬;Â;Õ;ê;<<4<S< m<{<’< ­<3Î<,=:/=!j= Œ=­=Æ=Ú=ó=>!.>P>j>‰>1§>+Ù>0?6?"L?6o?.¦?Õ? ð?@!(@*J@u@"‘@'´@Ü@%ð@A+A«N>êND)O<nOJ«O&öONPlPZúQ=UR6“R@ÊR? S<KSŽˆSŽT~¦Té%U‰VA™V:ÛVXW=oW>­WPìWN=XNŒX0ÛXE YIRY¤œYJAZTŒZ8áZU[Pp[9Á[Nû[HJ\'“\î»\Iª]Nô]1C^Iu^<¿^Fü^9C_'}_J¥_Kð_H<`L…`nÒ`=AaKa}Ëa¢IbOìbKkuFªuñu v82v%kv‘vé¤vŽx%–xü¼x"¹y:ÜyNz‡fz+îz+{äF{+|"J|1m|'Ÿ|?Ç|}€'}ã¨~,Œ¹4G€4|€5±€*瀃ª$ƒÕÏ„4¥…-Ú…5†>>†,}†/ª†3Ú†>‡M‡>l‡"«‡"·8ñ‡"*‹"M‹¹p‹]*Gˆ+Ð?ü4<Ž$qŽ"–Ž5¹ŽÇïŽ*·4â?‘,W‘B„‘7Ç‘3ÿ‘A3’/u’¥’Á’-Ý’+ “,7“(d““­“#É“ í“”+*”V”*u”9 ”5Ú”!•02•8c•9œ•/Ö•(–@/–@p–D±–@ö– 7—X—,t—9¡—/Û—7 ˜2C˜8v˜¯˜-Θü˜;™EV™"œ™"¿™3♚2š*Pš {šˆš£š:µšðš ›#›:›+S›"›5¢›0Ø› œœ14œfœ|œ™œ1¸œêœ(20c7€1¸;ê?&ž@fž§ž-Çž@õžA6Ÿ0xŸ,©Ÿ,ÖŸ& 1* 1\ Ž T¥ 1ú ,¡NC¡K’¡?Þ¡@¢!_¢!¢£¢Á¢@Õ¢A£4X£4£;£þ£?¤@\¤7¤Õ¤3ï¤2#¥-V¥!„¥ ¦¥$ǥ쥦,&¦$S¦x¦Š¦œ¦C®¦ò¦"©#&©%J©)p©)š©Ä©Õ©í©ªª 2ªSª"qª#”ª ¸ª%Ùªÿª«8<«#u«*™«3Ä«ø«!¬7¬5=¬-s¬3¡¬Õ¬Þ¬ æ¬2ó¬&­ F­0g­C˜­4Ü­G®GY®G¡®Gé®?1¯=q¯>¯¯*î¯+°CE°‰° ¢°ð!â°$±&)±P±Rf±´¹±%n³.”³CóO´eW´>½´ü´%µJ=µ!ˆµ ªµ!˵'íµ(¶)>¶Gh¶°·-Ë·!ù·¸"9¸\¸,r¸8Ÿ¸ ظ ù¸)¹4D¹)y¹0£¹7Ô¹. º';º@cº6¤º.Ûº< +»-G»u»#†»%ª»л(ﻼ2¼)L¼)v¼ ¼¹¼:Ù¼:½O½k½(‹½´½ѽï½G ¾T¾q¾ ‹¾#¬¾(оHù¾B¿-S¿,¿®¿È¿*ã¿ À/ÀIÀ>iÀ¨À$ÆÀëÀüÀMÁ?fÁ/¦ÁÖÁ*ðÁ1Â!MÂoÂ"‰Â¬Â¿ÂÝÂ%÷ÂÃ;7Ã+sßäÃ&¼ÃãÃÿÃ'Ä3FÄ.zÄL©Ä(öÄ#ÅACÅ8…Å,¾ÅHëÅK4ƀƓÆ(©ÆDÒÆKÇ)cÇ(Ç+¶Ç0âÇÈ(È@È$^È7ƒÈ»È7ÎÈÉÉ#6ÉZÉpÉDÉÕÉ0ñÉ1"Ê!TÊ+vÊ¢Ê%ºÊ"àÊ:Ë9>ËxË&Ë%¶ËBÜËGÌCgÌ+«Ì×Ì6÷Ì7.ÍfÍ&wÍ#žÍ9ÂÍIüÍ=FÎ"„Î.§Î2ÖÎ( ÏG2ÏPzÏ2ËÏ'þÏ5&Ð5\Ð’Ð(°Ð7ÙÐ-ÑD?Ñ9„Ñ,¾Ñ@ëÑU,Ò(‚Ó+«Ó×ÓJõÓ*@Ô(kÔ$”Ô#¹ÔÝÔGðÔ?8Õ'xÕ Õ$¸ÕÝÕ-ýÕ+ÖFÖ`Ö}Ö#œÖÀÖÛÖùÖÿÖJ×%Q×7w×L¯×2ü×)/Ø'YØØ$¡Ø&ÆØFíØ"4ÙWÙrÙ!„Ù1¦ÙØÙ+ôÙ7 Ú"XÚ%{Ú¡ÚºÚÒÚéÚ>Û?Û-GÛ,uÛ'¢ÛÊÛêÛÜ$ÜCÜ5cÜ™Ü0µÜæÜ)üÜ+&ÝRÝpÝ%‚Ý"¨Ý,ËÝ4øÝC-Þ8qÞ4ªÞ'ßÞ(ß 0ß7Qß9‰ß'Ãß;ëß9'àaà0~à!¯à:Ñà áá>á0^áá7«áãá!â%#â>Iâ=ˆâ!Æâ;èâ4$ã3Yã*ã2¸ãCëã/äÏCä ç(4ç1]ç:ç8Êç"è&èDè_è"}è& èÇèÛèñè é5#é9Yé5“é=ÉébêOjêGºê9ë0<ë3më/¡ë6Ñë6ì-?ì6mì.¤ì&Óì"úì6í0Tí1…í4·í5ìí/"î%Rî!xî%šî#Àî/äî.ïCïO\ït¬ï!ðj?ðªð1ÆðFøð4?ñtñ0’ñÃñ^Cò+¢òÎò)îòó&8ó-_ó&ó:´ó ïó+ûó+'ô7Sô5‹ô2Áô"ôô(õ&@õ'gõ+õ+»õçõ"ö)öEödö}ö#šö¾ö Þö*ÿö-*÷1X÷Š÷*©÷#Ô÷$ø÷(ø9Fø.€ø%¯øÕøóø!ù1ùGù-gù.•ù-Äù òùú(2ú![ú}úšú"¹ú0Üú) û)7û0aû0’û5Ãû5ùû9/ü0iü:šüÕüïü%ý4ý#Tý+xý0¤ý,Õý/þ#2þ Vþ0wþ0¨þÙþõþ, ÿ.8ÿgÿ|ÿ’ÿ2®ÿ*áÿ '>ED„ÉãIÿ"I"l'*·*â? M(l •¶Óæ$ÿ$5;;q­È/æ+,B7o1§!Ùû),Vm;‡<Ã=8>=w/µ+å"#4 X/yE©8ïØ(+ +- +ˆ< +!Å !ç . (8 &a  ˆ 6© Kà .,  [ | œ » Ú -ú $()M,w¤¬ÃÜ"ì -='[4ƒ#¸*Ü4%Zv†–1³Eå+BDV›1µÆç ®]Ï&--TQ‚6Ô *%/P€–¯Æ+Þ +5(1^+<¼<ù"6Yw“°Î<Ý;V*q0œÍ"â #D^o…¥3½ñK (X4K¶'3*1^7,È2õ(?@ €3Ž.Â%ñ$@<2}0°0á~.G­!Jõ!@"9X"8’"5Ë"3#35#Wi#Á#$Ü#"$$$9@$%z$ $M¾$) %+6%‹b%/î() 8)(Y)7‚)7º)+ò)0*"O*r*4’*Ç*&Ý*B+$G+*l+!—+"¹+GÜ+:$,#_,5ƒ,¹,pÖ,$G-0l-D.;â./$3/+X/„/Eœ/câ/7F0F~0<Å0'1(*1S11l1 ž1#¿1"ã12)$2N28k2+¤2,Ð28ý24631k3M39ë3Ÿ%4(Å4;î45*5R`5R³5L6 S6 t6<•64Ò657=75[72‘7+Ä7*ð7*8*F8!q8,“8·À80x9©9'½9å93ý9$1:DV:5›:.Ñ:&;#';#K;)o;6™;-Ð;)þ;Q(<8z<³<Ñ<:ñ<,=!K=<m=ª=EÇ=) >17>1i> ›>©>%Æ>ì>! +?,?.=?l?ƒ?š?)±?Û?4ð?&%@L@k@‰@ £@Ä@%ä@/ +A&:AaA~A™A·AÓA'ïAB3B*QB|B“B²B7ÉBCC 6CWCvC/•C!ÅCçCÿCD$2DWDwDD«DÇDßD#üD* E%KE!qE(“E3¼EÍðE*¾G@éG,*H%WH\}H)ÚH6IB;I‹~I' +J%2JXJuJ!ŠJ+¬J„ØJ¡]K9ÿL.9M-hM–M&²M.ÙM.N%7N.]N%ŒNF²N(ùN"OK:OB†OÉOßOçO4ðO2%P8XP3‘P<ÅPQPQ.lQ*›Q#ÆQ,êQ'R8?R0xR0©R%ÚRS)SSES5™S3ÏST;T;XT#”T ¸T3ÙT- U);U#eU1‰U'»U'ãU V VB#VBfV)©VÓV(íVhWFWÆWâW õWX*X JXXXwX"†X©X¿XÖXîXYY63YjY…Y £Y$¯Y!ÔY öYZ05Z'fZ'ŽZ'¶Z'ÞZH[6O[B†[É[Û[ñ[\>,\!k\"\6°\)ç\%]$7]\]2y]:¬]$ç]' ^)4^&^^…^ ^º^Ô^4í^"_8_#T_(x_&¡_!È_ê_`"`?`$X`$}`,¢`$Ï`ô`&a +a,La3ya"­a&Ða;÷a13bebyb—b'¶b=Þb0cMc7fc,žc"Ëcîcdd8d*Rd#}d<¡dÞd0îde5eQe%ae3‡e&»eâeùe% +f0f Jfkf |f'f;Åf"g6$g[g*ng!™g;»g!÷g0hJh gh!ˆh!ªhÌh*éh#i#8i\iwi1”i#Æi&êij8(j&ajˆjœj«jÅj?äj$k/Akqkƒk#•k¹k1Ëk#ýkF!lhl…l,¤lÑl$ñlm+.m1Zm#Œm)°mÚmFòm(9n:bn9n8×n4o&Eo!loŽožo#¼oào/p%0pVp,gp)”p'¾p'æpq&,q#SqUwqHÍq*r!Ar#cr‡r)œr%Ær*ìrs+,s.Xs ‡s•s'°sØs"øst$,tGQt$™t¾tÛt7útB2uHuuJ¾uM v&Wv~v'„v6¬v'ãv+ w!7wYwRsw3Æw9úw<4xAqx(³x(Üx@y?FyG†yFÎyzG5z}zz+¯z+Ûz{{8{)L{v{5•{Ë{è{+|.0|A_|#¡|7Å|&ý|2$}W}+w}"£}4Æ}û}~8~U~m~)~&·~,Þ~- (9b&q˜¸Ðè€ € *€ 7€E€Y€p€ …€’€©€$È€8í€)&P&n•"³Öì +‚5 ‚9C‚:}‚#¸‚JÜ‚)'ƒ9Qƒ9‹ƒ)Ń7ïƒ$'„>L„‹„¤„$½„$â„*…2…J…)a…9‹…(Å…î…*†0†O†d†z† š†)»†å†2‡'7‡._‡:Ž‡3ɇý‡7ˆLKˆ˜ˆ$®ˆÓˆ.óˆ"‰$9‰5^‰ ”‰µ‰4Ô‰ Š1'Š%YŠ%Š ¥Š#²Š'ÖŠ‹þŠ1Š‹¼‹Ó‹ì‹(ý‹'&ŒNŒhŒ$€Œ¥Œ1¹ŒëŒ þŒ:5<p­8Ë8Ž*=Ž!hŽ,ŠŽ(·ŽàŽ:ýŽ[8,”Á à".$.S&‚-©'×ÿ‘$‘D‘2W‘Š‘ ‘ À‘á‘9ÿ‘9’2T’‡’ ’¾’0Ø’ “)“=H“†“2¥“+Ø“"”'”ED”'Š”0²”&ã”4 +•#?•)c•)•·•Ï•ä•?ÿ• ?–'I–8q–"ª–)Í–(÷–C —)d—,Ž—'»—ã—÷—)˜8˜:X˜@“˜-Ô˜?™4B™Fw™¾™0Ú™- š9šRYš¬šÇšâš"úš›3›L›c›|››¤›¾›×›ñ› œ œX@œ4™œ*Îœùœ:01k *¾éž#"žFž(Vž4ž(´žÝž&ùž$ ŸEŸ+XŸ>„Ÿ"ß4柠28 %k ‘ $« *Р%û #!¡2E¡"x¡›¡¹¡Õ¡ó¡¢¢;7¢7s¢«¢¢AÕ¢£4£Q£n£Jˆ£'Ó£4û£30¤4d¤4™¤4Τ4¥48¥4m¥+¢¥*Î¥)ù¥6#¦2Z¦¦! ¦¦*ܦ§§=§2W§Š§¤§ »§ܧ!û§#¨A¨]¨*|¨§¨¿¨Õ¨*먩,4©)a©'‹©³©Ò©î©( ª"5ª"Xª{ª'’ª9ºª'ôª;«4X««;¤«<à«1¬@O¬B¬BÓ¬3­4J­/­P¯­B®"C®f®F~®IÅ®¯#¯?¯!S¯)u¯Ÿ¯²¯̯Þ¯4ù¯+.°Z°v°'‡°¯°ΰ"á°#±(±B±0_±± ±¶±ɱܱô±$² +6² A²#K² o²|²#›² ¿² ˲ײß² ç²ñ²³³),³ V³*d³&³<¶³ó³´ +´%´ @´L´l´ ˆ´•´§´ +¿´ Ê´Ö´$å´; +µ7Fµ~µ˜µ µµ¿µ ӵߵ ñµþµ +¶ "¶3/¶c¶t¶"‹¶®¶'˶ó¶·%)·4O·„·-–· Ä·Ñ·é·ý·¸*#¸ N¸#Z¸~¸”¸®¸<ĸ¹¹5¹.Q¹2€¹X³¹= ºCJºŽº!¬ºκ麻»))»S»0r» £»3Ä»ø»'¼#<¼%`¼,†¼³¼ϼ.ì¼!½=½'Z½'‚½ª½»½ؽ2ô½L'¾&t¾6›¾6Ò¾9 ¿:C¿.~¿%­¿+Ó¿!ÿ¿ !ÀBÀ[ÀrÀÀ+¬À=ØÀ5ÁLÁ7dÁ<œÁ-ÙÁBÂJÂg„¡Â,´Â>á Ã-7Ã6eÃ>œÃÛÃúÃ-Ä1CÄ1uħĶÄ7ÎÄ!Å!(Å)JÅ-tŢŪÅ*»Å#æÅ- +Æ +8Æ'CÆ#kÆ1ÆÁÆ'ÒÆ$úÆÇ%;Ç>aÇ% ÇWÆÇ)ÈHÈaÈ&ÈB¦ÈéÈÉ'É(DÉ(mÉ –É-·ÉåÉúÉ'Ê.AÊpʀʙÊ%¬Ê!ÒÊ&ôÊ&Ë(BË1kË(Ë'ÆËîËÌ !ÌBÌ+_Ì+‹Ì·ÌÔÌñÌÍ!+ÍLMÍ)šÍ6ÄÍûÍÎ3ÎJÎ0iΚΠ³Î ÔÎõÎÏC'ÏMkϹÏ.ÙÏ<Ð5EÐ{КЭÐ%ÅÐJëÐ'6ÑH^Ñ>§ÑæÑüÑ'Ò5>ÒDtÒ!¹Ò3ÛÒ1Ó3AÓ&uÓ)œÓ/ÆÓöÓ7 +Ô-BÔ9pÔ1ªÔ)ÜÔ"Õ,)ÕVÕqÕ#‘ÕµÕ+ÓÕ)ÿÕ)ÖCÖFYÖ$ Ö ÅÖ7æÖ×>×+Z׆×7×(Å×î×& Ø/0Ø/`ØØP¤Ø&õØ4ÙQÙ"qÙ/”Ù-ÄÙòÙ$Ú 6Ú/WÚ|‡Ú+Û,0Û.]Û"ŒÛ)¯Û"ÙÛ5üÛ&2Ü$YÜ3~ܲÜ4»ÜðÜ"Ý0&Ý/WÝ#‡Ý"«Ý$ÎÝ9óÝ8-Þ-fÞ/”Þ4ÄÞ<ùÞ66ß+mß™ß7·ß2ïß3"àVà*và ¡à#ÂàHæà5/á.eá4”á.ÉáBøá;â%Râxââ2©âÜâ(ñâ)ã1Dã2vã'©ã'Ñãùã ä#%äIädä~ä™äµäÐäåäÿä3å+Då0på ¡å<Âå3ÿå3æJæ.jæ$™æ&¾æåæ,ç(2ç([ç+„ç'°ç Øçùç è!è'=è0eè%–è.¼èëè é %é&Fé+mé +™é¤é¿éÓéóé, ê:êPêjê/~ê6®ê$åê" +ë-ëDëUëkëë•ë«ëÂë×ë"íëì)ì$Dìiì‡ì˜ì±ì Ìì8íì&í8Eí$~í£íÃíÞíïí î&îFîeîîžîF¼î/ï;3ïoï'Žï5¶ï8ìï%ð)Bðlð(ˆð:±ð"ìð(ñ18ñjñ(~ñ!§ñ$Éñ%îñ$ò%9ò$_ò%„ò$ªò%Ïò&õò!ó">ó"aó$„ó"©ó"Ìó$ïó$ô$9ô"^ô#ô$¥ô%Êô$ðô%õ%;õ%aõ$‡õ%¬õ%Òõ%øõ'ö#Fö$jö$ö%´ö#Úö&þö"%÷$H÷"m÷$÷$µ÷&Ú÷'ø*)ø+Tø+€ø$¬ø#Ñø#õø!ù-;ù;iù¥ùNÄùNú=bú2 ú#Óú#÷ú+û@Gû+ˆû$´û4Ùûü0%üVü lü9ü4Çü;üü;8ýtý.ý%¾ýHäý&-þ+Tþ€þ9»á‚>ü +Šå¾ó´=7ïÊÈd \¤¿!ØÀb¥—ÔbUš'M%±ØÀŸD¨$c¥éÿ»ĎQÆ\‚ˆV¢î”¿õm?Iæ‹|¥Å,p[£¥<PËLËá? E|ü”Lí©l§H;M펞̼/¸awý(çÊâ +^õ®œ  +õšD}%^RÂd‡–^5A­;>}{·æ„Ø•ÛÎém­Ï~¬gÕã}Áâ‡çÓè£&3|€"êŠ)p  GL´Ÿ“fy@ë†raí×þ﹩ZˆY|½" =ÃLAF*œT·BnÙË °éä }¥3F\-%áÚfaÄÞ +Ï®è'Š Î`BFXPêÉ?'—¬@¡²º»Pyôˆc2R9RuV4³u…°’ó~òÃdºPùÙ{G›ÃY8`”w3 ¼:‰Ý÷ó¹JÙÍØ·vs½Ì¢Û ?O &éê~íÜÂXû _û/w Èáê³Ph¨’_ÿøbõzvZ0O|™ßÛ¦2©ÿÛ¦ÇJÿOà†û‹•<µ.ǹ«"ÌCà Á³KÓÒåpë´deôˆ i9ì–G`':×£¬4š1Z àæp-“ÒtÄ,ïßsn>;ýgs, Ðk¦£cƒ4â ÎCîµ öœdô3hVÊÖr‹3Y¦°ñù„O²ŒÐ(ÝFÈ ç^VNÁ,¤fO"o ÑY¤Û§Æ¯+/‰a©Œ*ÿ¨zGžJ1ƒhf:ó8§ÿ¨:ðÆn܉”Ã5.kcÇ‹µHס«/ŠC·°˜Ò‘í3m˜I¥ú¸Úh<™£ü67Ëõ£l-Ø«®b• qi60 cH’úûÊi+ñQå(5  ýñRÚÿ\|‚)U7XrU-ã ôê~­,x?“FÎ2hûˆ@·´s[KxQ™­¢Uü÷o 9z*Zyi,úkv‹Hu‹]hE€‹t‚*ë O‚(æ´¯AžÐë„(_ÙàϤ0Õ _W`[ièorŸ‚váý†*óõY Ü;É>ŒÙ‡µ#J2¡#qíáÓÍ2«?yxuMjN±Ïš›ÄlòŽ$ ¬”èù¬Oܪ­žþßEe*Á]Bçn+º%ÉŒÍ`­snÑ’»øDߦ™ÊŒ«ÏWr´§Ÿ˜\lv¦²< ZÂ+zaîMí:¡Ýì¡ÎEb¸yÓ 'Ûv€âöÃFmEØz7n¹Öož¦W¯wº=ÝçLÆ{¹ÐÞZÖc¢½•ÕZy½>ôé¯Wùn%ÒJ¿åÞ {=‘8À«C’ÿÛ¡…0Gð1ï­{Êr ÷û²,‡A Í1Õ†jOBƒÐïKTÂ\ È@]Õ…N$ð®ÊíÎd›¼ 5gÏx] Å¡ïy ÇjÊ°ô‹=DSx* в1(øà( \2²¾ÇW?º±•P·½‹ªiÚ±sU Ú8Kˆ®ë±¼¤ <r­@ÓfQߺ¦äëCá¯1 Tf!щÈÅŠ¦0 p¾=¹@ßÖÏÁ¿* EnÞ“™6²(ÙVPø„6oŽ Ô±˜±i`îœ ›ì‰׳ƒnm¥L_Ò™p|€æ«™Y†â ½©¶øØ6)úäa!çÛѸæôâÑ4 Ô’µ‡¾©ÕR  j-~¸eÚ 5}gX`8 ÷à Ó<;ô œ ÀÏq‘ß¿©´Š">'øv{’Ý). –fV L zF²ªŸèæý"ü +uîâszD^v7ºÞ`¾ƒötÔ§}‘ijûåö à/ÉûÚ- QñosxŽðB¢ÑƒèJK—G[˜Ìˆ xä[?êK˜¬ñt†æþe 3Éyÿ©k¬d S§ï=V6 [6ì'H»‘L!-˜àìÅŽSI^÷-ã‰#ÎE¹+$M|H¬U5 üu0=5Œü»êWVbéR­MóÓ1Ä|ø ¿ äDqÜ‚ƒîâ $4µÞ7¾ƒùI ŸNØâÆ4H¹lÉ#2 TÓÉ "ÖË6AÅÁQg%SM mÖð÷BeuPòR-Õ –Üxžc'–˜ä.†/ÉJñVÚQšÅÝ$j¿Û¶ ¨®>j@žð›«¼õÅ&~8ž„€/zéÄ8N¹u% 9»–¸¼o@Ò¸,öÍ•ð…]ŸïýaT°¶Ù!׈ ¿›£X¢`Eagç¢#…\…,öròS¼Tš9FN b^ËBl )¤;‚³“_ðtóY"õ tAÌ[.ë´„ ejªÝrò¼& U¯$÷ëBFNc9.‘ž«PãW È7 &å7G–³Ñä]+*ÇGa<xsƒmçQ“ýdÆmvÍ̾Ò?gåÕ,Œ/]¤à•GóòŽö&¨ãSß±ñþ+ Mü@/C! &À ×Uí]#IèáWÕC5—Þ±°•A…q¤£Db>p=ùo3®_ìI6EþùŸÉê!%ýX' ¥5^; "~”1g~4…Ƶ—&å§4œþÊ#. °ˆjl¯CŠ ‘”šk ‡ª¡Îf“9 em”ÄŠK#i‰Re : Ëé-N…qÀ)—'Ñ<þÀd“< + ÇK×>ÑI Ò§hÜúwªXÃI×7îeÆÚ†&ß–ïÞ}é5 Éî¶Ô1*¡’Ó +iÐ +¤µ) ¸ì{T³·æ{ +ò_£Žçëöw¶¯¸ÙØñyJ;àjÐŽSÂÍŠk$:·™/ ”käÆ%‰:½¥!„¾Ì!)ªTDðœĄ́Üq¼ñ¿Qp ù4 w H®YŒº+ Z#2\ÜšËhãk“3¬§ÈÎ÷lø½ú€;Ð.!¢ äp›Ç9ô¨—²ŽMDU(úB# €¶ +}]¶8´8ö„À¶‚oªò°ª·×2¢80YNÍáêÁgœX$ ®[^t_ù{å(Äãz³µÁ.©u—ÔÍ:˜l9õãf•ìbݨ$0hœSÅT ÷cË3» ÈìøL’™1ÀIÙèÔqã¶Þ‘ÖÔ‡;ò›04ÝÈÒA€ûSÖ›óýÇÌþ)ZÔ.‡}èJ»„w¾AÏ~wŸ% ú€úC)HO6<º:‘–ü0"†t—t7KÚW Œq2+[Ö+k¯Rî&X‡þ [default is %d] [default is %s] specify variant of 960 architecture @@ -85,12 +87,15 @@ Please report this bug. Registers will not need any prefix. Registers will require a `$'-prefix. emulate output (default %s) + Record the cpu type -V print assembler version number -Qy, -Qn ignored S390 options: -mregnames Allow symbolic names for registers -mwarn-areg-zero Warn about zero base/index registers -mno-regnames Do not allow symbolic names for registers + -m31 Set file format to 31 bit format + -m64 Set file format to 64 bit format --MD FILE write dependency information in FILE (default none) --defsym SYM=VAL define symbol SYM to given value --fatal-warnings treat warnings as errors @@ -118,11 +123,11 @@ Please report this bug. --version print assembler version number and exit --warn don't suppress warnings -D produce assembler debugging messages - -EB assemble code for a big endian cpu - -EL assemble code for a little endian cpu + -EB assemble code for a big-endian cpu -EL generate code for little endian mode (default) -EB generate code for big endian mode -mwarn-expand warn if pseudo operations are expanded + -EL assemble code for a little-endian cpu -I DIR add DIR to search list for .include directives -J don't warn about signed overflow -K warn when differences altered for long displacements @@ -154,6 +159,7 @@ Please report this bug. -globalize-symbols Make all symbols global. -gnu-syntax Turn off mmixal syntax compatibility. -h, -H Don't execute, print this help text. Deprecated. + -linker-allocated-gregs If there's no suitable GREG definition for the operands of an instruction, let the linker resolve. -m32r disable support for the m32rx instruction set -m32rx support the extended m32rx instruction set -mall-opcodes accept all AVR opcodes, even if not supported by MCU @@ -161,11 +167,6 @@ Please report this bug. (default for avr4, avr5) -mno-wrap reject rjmp/rcall instructions with 8K wrap-around (default for avr3, avr5) - -mapcs-32, -mapcs-26 specify which ARM Procedure Calling Standard to use - -matpcs use ARM/Thumb Procedure Calling Standard - -mapcs-float floating point args are passed in FP regs - -mapcs-reentrant the code is position independent/reentrant - -moabi support the old ELF ABI -mv850 The code is targeted at the v850 -mv850any The code is generic, despite any processor specific instructions -mv850e The code is targeted at the v850e @@ -189,32 +190,21 @@ Please report this bug. -warn-unmatched-high warn when an (s)high reloc has no matching low reloc -x Do not warn when an operand to GETA, a branch, PUSHJ or JUMP is not known to be within range. - The linker will catch any errors. - [-s] [--copysource] copy source through as comments + The linker will catch any errors. Implies + -linker-allocated-gregs. [-s] [--copysource] copy source through as comments [-u] [--unreasonable] allow unreasonable nesting [-v] [--version] print the program version [-Dname=value] create preprocessor variable called name, with value [-Ipath] add to include path list [in-file] (Requires %s; requested architecture is %s.) *input_line_pointer == '%c' 0x%02x - ARM Specific Assembler Options: - -m[arm][] select processor variant - -m[arm]v[2|2a|3|3m|4|4t|5[t][e]] select architecture variant - -marm9e allow Cirrus/DSP instructions - -mthumb only allow Thumb instructions - -mthumb-interwork mark the assembled code as supporting interworking - -mall allow any instruction - -mfpa10, -mfpa11 select floating point architecture - -mfpe-old don't allow floating-point multiple instructions - -mvfpxd allow vfp single-precision instructions - -mvfp allow all vfp instructions - -mno-fpu don't allow any floating-point instructions. - -k generate PIC code. + ARM-specific assembler options: FR30 specific command line options: M32R specific command line options: MMIX-specific command line options: V850 options: -!%s does not use a sequence number"%d" (instance number %d of a %s label)".else" without matching ".if"".elseif" after ".else"".elseif" without matching ".if"".endif" without ".if"# Example of `%s' instructions + XSTORMY16 specific command line options: +!%s does not use a sequence number!samegp reloc against symbol without .prologue: %s"%d" (instance number %d of a %s label)".else" without matching ".if"".elseif" after ".else"".elseif" without matching ".if"".endif" without ".if"# Example of `%s' instructions .sect .text _start: # bars register# conflicts length#4 not valid on H8/300.###% operator needs absolute expression%08lx UNDEFINED @@ -244,7 +234,8 @@ _start: -EB generate code for a big endian machine --little-endian-data generate code for a machine having big endian instructions and little endian data. --G is not supported for this configuration-G may not be used with SVR4 PIC code-G may not be used with SVR4 or embedded PIC code-G may not be used with embedded PIC code-G not supported in this configuration.-KPIC generate PIC +-G is not supported for this configuration-G may not be used with SVR4 PIC code-G may not be used with SVR4 or embedded PIC code-G may not be used with embedded PIC code-G n Data >= n bytes is in small data area +-G not supported in this configuration.-KPIC generate PIC -V print assembler version number -undeclared-regs ignore application global register usage without appropriate .register directive (default) @@ -260,7 +251,19 @@ _start: -R option not supported on this target.-TSO use Total Store Ordering -PSO use Partial Store Ordering -RMO use Relaxed Memory Ordering --call_shared is supported only for ELF format-k generate PIC +-call_shared is supported only for ELF format-expand-pt32 invalid together with -no-expand-expand-pt32 only valid with -abi=64-isa=[shmedia set default instruction set for SH64 + | SHmedia + | shcompact + | SHcompact] +-abi=[32|64] set size of expanded SHmedia operands and object + file type +-shcompact-const-crange emit code-range descriptors for constants in + SHcompact code sections +-no-mix disallow SHmedia code in the same section as + constants and SHcompact code +-no-expand do not expand MOVI, PT, PTA or PTB instructions +-expand-pt32 with -abi=64, expand PT, PTA and PTB instructions + to 32 bits only-k generate PIC -m68851 | -mno-68851 target has/lacks memory-management unit coprocessor [default yes for 68020 and up] @@ -273,11 +276,17 @@ _start: -mCPU equivalent to -march=CPU -mtune=CPU. Deprecated. -no-mCPU don't generate code specific to CPU. For -mCPU and -no-mCPU, CPU must be one of: +-mPIC Note large position independent code -mabi is supported for ELF format only-mcoff-version={0|1|2} Select COFF version -mcpu= Specify the CPU version +-mcpu={fr500|fr400|fr300|frv|simple|tomcat} +-mdouble Note fp double insns are used +-mdword Note stack is aligned to a 8 byte boundary -me Redirect errors to a file -merrors-to-file -mfar-mode | -mf Use extended addressing +-mfpr-32 Note 32 fprs are used +-mfpr-64 Note 64 fprs are used -mgp32 use 32-bit GPRs, regardless of the chosen ISA -mfp32 use 32-bit FPRs, regardless of the chosen ISA -O0 remove unneeded NOPs, do not swap branches @@ -286,6 +295,8 @@ _start: --[no-]construct-floats [dis]allow floating point values to be constructed --trap, --no-break trap exception on div by 0 and mult overflow --break, --no-trap break exception on div by 0 and mult overflow +-mgpr-32 Note 32 gprs are used +-mgpr-64 Note 64 gprs are used -mips1 generate MIPS ISA I instructions -mips2 generate MIPS ISA II instructions -mips3 generate MIPS ISA III instructions @@ -296,6 +307,13 @@ _start: -march=CPU/-mtune=CPU generate code/schedule for CPU, where CPU is one of: -mips16 generate mips16 instructions -no-mips16 do not generate mips16 instructions +-mlibrary-pic Compile library for large position indepedent code +-mmedia Note media insns are used +-mmuladd Note multiply add/subtract insns are used +-mno-dword Note stack is aligned to a 4 byte boundary +-mno-pack Do not allow instructions to be packed +-mpack Note instructions are packed +-mpic Note small position independent code -mrelocatable support for GCC's -mrelocatble option -mrelocatable-lib support for GCC's -mrelocatble-lib option -memb set PPC_EMB bit in ELF flags @@ -306,23 +324,26 @@ _start: -mno-solaris do not generate code for Solaris -V print assembler version number -Qy, -Qn ignored --n32 is supported for ELF format only-non_shared is supported only for ELF format.ASSIGNA needs constant expression argument. +-msoft-float Note software fp is used +-mtomcat-debug Debug tomcat workarounds +-mtomcat-stats Print out stats for tomcat workarounds +-n32 is supported for ELF format only-no-expand only valid with SHcompact or SHmedia-no-mix is invalid without specifying SHcompact or SHmedia-non_shared is supported only for ELF format-shcompact-const-crange is invalid without SHcompact.ASSIGNA needs constant expression argument. .ASSIGNA without label. .ASSIGNS without label. .COMMon length (%d.) < 0! Ignored..COMMon length (%d.) <0! Ignored..COMMon length (%ld) < 0 ignored.COMMon length (%ld.) <0! Ignored..ENDM without a matching .MACRO. .EQU must use a label.EXIT must appear within a procedure.REG expression must be a register.REG must use a label.SCOMMon length (%ld.) <0! Ignored..abort detected. Abandoning ship..align needs absolute fill value. -.begin directive without a preceding .ent directive.begin directive without a preceding .file directive.begin/.bend in different segments.bend directive names unknown symbol.bend directive without a preceding .ent directive.bend directive without a preceding .file directive.callinfo is not within a procedure definition.cpload not in noreorder section.def pseudo-op used inside of .def/.endef: ignored..def pseudo-op used inside of .def/.endef; ignored.dim pseudo-op used outside of .def/.endef: ignored..dim pseudo-op used outside of .def/.endef; ignored.ef with no preceding .function.end directive has no name.end directive missing or unknown symbol.end directive names different symbol than .ent.end directive names unknown symbol.end directive without a preceding .ent directive.end directive without a preceding .ent directive..end directive without a preceding .file directive.end not in text section.end symbol does not match .ent symbol..end%s without preceding .%s.endef pseudo-op used before .def; ignored.endef pseudo-op used outside of .def/.endef: ignored..endfunc missing for previous .func.endr encountered without preceeding .rept, .irc, or .irp.ent directive has no name.ent directive has no symbol.ent or .aent not in text section..err encountered.es without preceding .bs.fail %ld encountered.field count '%d' out of range (1 <= X <= 32).fill size clamped to %d.fmask outside of .ent.frame outside of .ent.ifeqs syntax error.incbin count zero, ignoring `%s'.instr needs absolute expresson. -.linkonce is not supported for this object file format.ln pseudo-op inside .def/.endef: ignored..loc before .file.loc outside of .text.loc pseudo-op inside .def/.endef: ignored..mask outside of .ent.mask/.fmask outside of .ent.name directive has no symbol.name directive not in link (.link) section.option pic%d not supported.pdesc directive has no entry symbol.pdesc directive not in link (.link) section.pdesc has no matching .ent.popsection without corresponding .pushsection; ignored.previous without corresponding .section; ignored.sblock may be used for initialized sections only.scl pseudo-op used outside of .def/.endef ignored..scl pseudo-op used outside of .def/.endef; ignored.set pop with no .set push.size expression too complicated to fix up.size pseudo-op used outside of .def/.endef ignored..size pseudo-op used outside of .def/.endef; ignored.space or .fill with negative value, ignored.space repeat count is negative, ignored.space repeat count is zero, ignored.space specifies non-absolute value.space/.bes repeat count is negative, ignored.space/.bes repeat count is zero, ignored.stab%c is not supported.stab%c: ignoring non-zero other field.stab%c: missing comma.syntax %s requires command-line option `--no-underscore'.syntax %s requires command-line option `--underscore'.tag pseudo-op used outside of .def/.endef ignored..tag pseudo-op used outside of .def/.endef; ignored.tag requires a structure tag.tag target '%s' undefined.tc not in .toc section.tc with no label.type pseudo-op used outside of .def/.endef ignored..type pseudo-op used outside of .def/.endef; ignored.uses does not refer to a local symbol in the same section.uses pseudo-op seen when not relaxing.uses target does not refer to a local symbol in the same section.val expression is too copmlex.val pseudo-op used outside of .def/.endef ignored..val pseudo-op used outside of .def/.endef; ignored.var may only be used within a macro definition.word %s-%s+%s didn't fit0x%lx: "%s" type = %ld, class = %d, segment = %d -16 bit expression not in range -32768..3276716 bit expression not in range 0..6553516-bit jump out of range32-bit conditional branch generated32bit mode not supported on this CPU.5-bit field must be absolute5-bit immediate too large62-bit relocation not yet implemented64bit mode not supported on this CPU.64bit operations available only in 64bit modes.68000 or higher68010 or higher68020 or higher68040 and 68851 specified; mmu instructions may assemble incorrectly680X0 options: +.begin directive without a preceding .ent directive.begin directive without a preceding .file directive.begin/.bend in different segments.bend directive names unknown symbol.bend directive without a preceding .ent directive.bend directive without a preceding .file directive.callinfo is not within a procedure definition.cpload not in noreorder section.def pseudo-op used inside of .def/.endef: ignored..def pseudo-op used inside of .def/.endef; ignored.dim pseudo-op used outside of .def/.endef: ignored..dim pseudo-op used outside of .def/.endef; ignored.ef with no preceding .function.end directive has no name.end directive missing or unknown symbol.end directive names different symbol than .ent.end directive names unknown symbol.end directive without a preceding .ent directive.end directive without a preceding .ent directive..end directive without a preceding .file directive.end not in text section.end symbol does not match .ent symbol..end%s without preceding .%s.endef pseudo-op used before .def; ignored.endef pseudo-op used outside of .def/.endef: ignored..endfunc missing for previous .func.endfunc missing for previous .proc.endr encountered without preceeding .rept, .irc, or .irp.ent directive has no name.ent directive has no symbol.ent or .aent not in text section..err encountered.es without preceding .bs.fail %ld encountered.field count '%d' out of range (1 <= X <= 32).fill size clamped to %d.fmask outside of .ent.frame outside of .ent.ifeqs syntax error.incbin count zero, ignoring `%s'.instr needs absolute expresson. +.linkonce is not supported for this object file format.ln pseudo-op inside .def/.endef: ignored..loc before .file.loc outside of .text.loc pseudo-op inside .def/.endef: ignored..mask outside of .ent.mask/.fmask outside of .ent.name directive has no symbol.name directive not in link (.link) section.option pic%d not supported.pdesc directive has no entry symbol.pdesc directive not in link (.link) section.pdesc has no matching .ent.popsection without corresponding .pushsection; ignored.previous without corresponding .section; ignored.sblock may be used for initialized sections only.scl pseudo-op used outside of .def/.endef ignored..scl pseudo-op used outside of .def/.endef; ignored.set pop with no .set push.size expression too complicated to fix up.size pseudo-op used outside of .def/.endef ignored..size pseudo-op used outside of .def/.endef; ignored.space or .fill with negative value, ignored.space repeat count is negative, ignored.space repeat count is zero, ignored.space specifies non-absolute value.space/.bes repeat count is negative, ignored.space/.bes repeat count is zero, ignored.stab%c is not supported.stab%c: description field '%x' too big, try a different debug format.stab%c: ignoring non-zero other field.stab%c: missing comma.syntax %s requires command-line option `--no-underscore'.syntax %s requires command-line option `--underscore'.tag pseudo-op used outside of .def/.endef ignored..tag pseudo-op used outside of .def/.endef; ignored.tag requires a structure tag.tag target '%s' undefined.tc not in .toc section.tc with no label.type pseudo-op used outside of .def/.endef ignored..type pseudo-op used outside of .def/.endef; ignored.uses does not refer to a local symbol in the same section.uses pseudo-op seen when not relaxing.uses target does not refer to a local symbol in the same section.val expression is too copmlex.val pseudo-op used outside of .def/.endef ignored..val pseudo-op used outside of .def/.endef; ignored.var may only be used within a macro definition.word %s-%s+%s didn't fit0x%lx: "%s" type = %ld, class = %d, segment = %d +16 bit expression not in range -32768..3276716 bit expression not in range 0..6553516-bit jump out of range32-bit conditional branch generated32bit mode not supported on this CPU.5-bit field must be absolute5-bit immediate too large62-bit relocation not yet implemented64bit mode not supported on this CPU.68000 or higher68010 or higher68020 or higher68040 and 68851 specified; mmu instructions may assemble incorrectly680X0 options: -l use 1 word for refs to undefined symbols [default 2] -m68000 | -m68008 | -m68010 | -m68020 | -m68030 | -m68040 | -m68060 | -m68302 | -m68331 | -m68332 | -m68333 | -m68340 | -m68360 | -mcpu32 | -m5200 | -m5202 | -m5204 | -m5206 | -m5206e | -m5307 | -m5407 - specify variant of 680X0 architecture [default 68020] + specify variant of 680X0 architecture [default %s] -m68881 | -m68882 | -mno-68881 | -mno-68882 target has/lacks floating-point coprocessor [default yes for 68020, 68030, and cpu32] -: PC-relative operand can't be a constant: There are only 32 f registers; [0-31]: There are only 64 f registers; [0-63]: asr number must be between 0 and 31: asr number must be between 16 and 31: expecting %asrN: invalid ASI expression: invalid ASI name: invalid ASI number: invalid cpreg name: invalid membar mask expression: invalid membar mask name: invalid membar mask number: invalid prefetch function expression: invalid prefetch function name: invalid prefetch function number: invalid siam mode expression: invalid siam mode number: rd on write only ancillary state register: unrecognizable privileged register: unrecognizable v9a ancillary state register: unrecognizable v9a or v9b ancillary state register:24 not valid for this opcode:b not permitted; defaulting to :w,X